Ceramic Components Directory

CERAMIC components directory A Publication of Ceramic Industry • www www.ceramicindustry.com ceramicindustry com

2011-2012

Purchasing Directory & Reference Resource

YOUR ULTRASOURCE FOR MACHINING HARD & BRITTLE MATERIALS

www.bullentech.com 1301 Miller Williams Rd. Eaton, Ohio 54320 USA Phone: (937) 456-7133 • Fax: (937) 456-2779 Email: [email protected]

September 2011 • Vol. 7, No. 1 CERAMIC COMPONENTS DIRECTORY OFFICE 6075 B Glick Road • Powell, OH 43065 614-789-1880 (p) • 614-760-5922 (f )

2011-2012 Purchasing Directory & Reference Resource

EDITORIAL/ PRODUCTION STAFF

CONTENTS How to Use the Ceramic Components Directory . . . . . . 6 Typical Material Properties . . . . . . . . . . . . . . . . . . . . . 7 Master Component Index . . . . . . . . . . . . . . . . . . . . . . 25 Trade Names . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 Component Listings . . . . . . . . . . . . . . . . . . . . . . . . . . 30 Professional Services . . . . . . . . . . . . . . . . . . . . . . . . . 58 Supplier Address Index. . . . . . . . . . . . . . . . . . . . . . . . 64 Trade Associations . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 Display Advertisers’ Index . . . . . . . . . . . . . . . . . . . . . 78

Amy Vallance, Publisher 281-550-5855 (p) • 248-283-6543 (f) [email protected] Susan Sutton, Editor-in-Chief, Integrated Media 330-336-4098 (p) • 248-502-2033 (f ) [email protected] Teresa McPherson, Managing Editor 734-332-0541 (p) • 248-502-2102 (f) [email protected] Kelsey Seidler, Associate Editor 614-789-1881 (p) • 248-502-2051 (f) [email protected] Cory Emery, Art Director 248-391-2325 (p) • 248-502-2077 (f ) [email protected] Bryon T. Palmer, Production Manager 248-244-6435 (p) • 248-502-9113 (f ) [email protected]

SALES STAFF

ONLINE The online version of the the Ceramic Components Directory at www.ceramicindustry.com/CCD is fully searchable by product or supplier. Also look for hotlinks, spec sheets and videos for certain suppliers.

CERAMIC components directory A Publication of Ceramic Industry s www.ceramicindustry.com www ceramicindustry com

ON THE COVER: Cover design by Cory Emery.

2011-2012

Purchasing h i Directory i & Reference Resource

Amy Vallance • [email protected] Brandon Miller • [email protected] Patrick Connolly • [email protected] To order additional copies of the Ceramic Components Directory ($35 each), contact Ann Kalb at (248) 244-6499 or email [email protected]. For other circulation questions, contact Kristine Wyatt, Audience Development Manager, at [email protected].

CORPORATE HEADQUARTERS 2401 W. Big Beaver Rd., Suite 700 Troy, MI 48084-3333 248-362-3700 (p) • 248-362-0317 (f )

BNP Media Helps People Succeed in Business with Superior Information

CERAMIC INDUSTRY’S Ceramic Components Directory is published by BNP Media, 2401 W. Big Beaver Rd., Suite 700, Troy, MI 48084-3333. Telephone: (248) 362-3700, Fax: (248) 362-0317. Printed in the U.S.A. Copyright 2011, by BNP Media. All rights reserved. The contents of this publication may not be reproduced in whole or in part without the consent of the publisher. The publisher is not responsible for product claims and representations. To order additional copies of the Ceramic Components Directory ($35 each), contact Ann Kalb at (248) 244-6499 or email [email protected].

4

WWW.CERAMICINDUSTRY.COM/CCD

800-839-2189

[email protected]

www.ceradyne.com

How to Use the

Ceramic Components Directory

W

elcome to Ceramic Industry’s exclusive

If you do not know the manufacturer/sup-

annual Ceramic Components Directory. plier, consult the Master Component Index Ceramic Industry is proud to serve as

(pp. 25-28), which provides an alphabetical listing

the exclusive global voice of ceramic and glass of the more than 500 components included in the business and manufacturing. We’ve taken our Ceramic Components Directory. Turn to the page ceramic knowledge and experience to the next number indicated to the right of the product heading. level to bring you this exclusive resource that If you know the name of a product and need to find contains the information you need to make the the manufacturer that produces it, take a look at the best possible ceramic component design and Trade Names listings on p. 29 purchasing decisions.

In the Component Listings section (pp. 30-58),

To learn more about the typical performance an alphabetical listing of manufacturers/supcharacteristics of some ceramic materials, turn

pliers appears under each product heading. For

to the Material Properties Charts beginning on help with design, machining or other assistance, p. 7. While specific characteristics will vary by supplier— consult the Professional Services section and, indeed, can often be tailored specifically to the (pp. 58-63). Arrows indicate display advertisers application—these charts can provide you with some in this edition. If you’d like to know more about general guidelines regarding which type of ceramic how ceramic and glass components are being material might be best suited to a particular function.

used in your industry, try contacting one of the

The Ceramic Components Directory wouldn’t trade associations listed on pp. 77-78. Groups be complete without the directory itself. If such as the Association of American Ceramic you know the name of the manufacturer/ Component Manufacturers (AACCM) and the U.S. supplier(s) you’re looking for, check the Display

Advanced Ceramics Association (USACA) special-

Advertisers’ Index (p. 78) for the page number

ize in promoting the use of ceramics in a variety

of their ad. To obtain more information from of applications. these advertisers, contact them directly using

Keep this useful book handy as a yearlong

the information in their advertisement, flip to resource for reference and supplier information. the Address Index* (pp. 64-76) to find more You can also find the listing of manufacturinformation about the company, or look them ers/suppliers and products in a fully searchup online using the website address listed in able format on Ceramic Industry’s website at the Display Advertisers’ Index.

www.ceramicindustry.com/CCD. 

Editors’ note: Your input for making this book more useful is always welcome. Please contact Susan Sutton at (330) 336-4098 or [email protected] with your suggestions. *All company listings in the Ceramic Components Directory indicate paid advertising.

6

WWW.CERAMICINDUSTRY.COM/CCD

Material Properties Charts

Important Information

O

n the following pages, we have collected a number of charts detailing applications and properties for some of the most commonly used ceramic materials. While the data in these charts is, in most cases, typical of what you will find from ceramic component suppliers, it is only intended to be a general point of reference and should not be used for material selection or specification. The manufacture of ceramic components involves many different variables—from the starting material and additives used, to the forming method, sintering process/ temperature and final finishing techniques, as well as the size and shape of the part itself—all of which affect the component’s final property values. In many cases, manufacturers can tailor properties to specific applications through partnerships with design engineers during the initial phases of a design concept. It is also important to note that some of these charts originate from different sources. While we did our best to ensure that the data was comparable, different analysis techniques and units of measurement

will affect the property values provided. As you review these charts, be sure to note the source (indicated at the bottom of each chart) and any differences in the type of information provided before using the data for comparison purposes. Ceramic materials offer a number of benefits in a variety of applications. They provide high wear, heat and corrosion resistance, as well as high tensile strength, volume resistivity, dielectric strength and modulus of elasticity. These materials also offer lower thermal expansion than metals or plastics, and a longer part life at original design dimensions and tolerances. We hope that the information on the following pages will help guide your decision toward ceramic components as a viable design option, but these charts should only be used as a general starting point. Please contact the suppliers listed in the Address Index (pp. 64-76), Component Listings (pp. 30-58) or Professional Services (pp. 58-63) sections of this directory for specific ceramic component design information.

Contents 8 . . . . . Key Features/Benefits of Some Advanced Technical Ceramics 9 . . . . . Typical Alumina 99.5% Properties 10 . . . . Typical Aluminum Nitride Properties 11 . . . . Typical Boron Carbide Properties 12 . . . . Typical Boron Nitride Properties 13 . . . . Typical Cordierite Properties 14 . . . . Typical Graphite Properties 15 . . . . Typical Mullite Properties 16 . . . . Typical Sapphire Properties

17 . . . . Typical Silicon Carbide Properties 18. . . . . Terminology Commonly Associated with Silicon Carbide Processing 19 . . . . Typical Silicon Nitride Properties 20 . . . . Terminology Commonly Associated with Silicon Nitride Processing 21 . . . . Typical Steatite L-5 Properties 22 . . . . Typical Titanium Diboride Properties 23 . . . . Typical Tungsten Carbide Properties 24 . . . . Typical Zirconia Properties

Compressive Strength Comparison Material Ceramic 99.9% Al2O3 Plastic Polycarbonate Resin Metal 316 Stainless Steel

Test

Compressive Yield Strength (psi)

ASTM C773

392,000

ASTM D695

12,500

Typical Value

30,000

Source: CoorsTek, Inc., Golden, Colo., www.coorstek.com. Note: Although we have no reason to doubt the accuracy of the data presented, this information is offered for comparison only. CoorsTek and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

CERAMIC COMPONENTS DIRECTORY ³ 2011

7

Key Features/Benefits of Some Advanced Technical Ceramics Aluminum Oxide (Al2O3). Aluminum oxide (alumina) is the workhorse of advanced technical ceramics. It has good mechanical and electrical properties, wear resistance and corrosion resistance. It has relatively poor thermal shock resistance. It is used as an electrical insulator for a number of electrical and electronic applications, including spark plug insulators and electronic substrates. It is also used in chemical, medical and wear applications. Zirconium Oxide (ZrO2). Zirconium oxide has the highest fracture toughness of any advanced technical ceramic. Its toughness, mechanical properties and corrosion resistance make it ideal for medical and selected wear applications. Its thermal expansion coefficient is very close to steel, making it an ideal plunger for use in a steel bore. Its properties are derived from a very precise phase composition. Some environmental conditions can make the material unstable, causing it to lose its mechanical properties. Its relatively low hardness and high weight also limit its broad use in wear applications. Fused Silica (SiO2). Fused silica is an excellent thermal insulator and has essentially zero thermal expansion. It has good chemical resistance to molten metals but is limited by its very low strength. It is used for a number of refractory and glass applications, as well as radomes for missiles. Titanium Diboride (TiB2). Titanium diboride is an electrically conducting ceramic and can be machined using electron discharge machining (EDM) techniques. It is a very hard material; however, its mechanical properties are poor. Its major use is in metallurgical applications involving molten aluminum. It is also used for some limited wear applications, such as ballistic armor to stop large-diameter (>14.5 mm) projectiles. Boron Carbide (B4C). Boron carbide is the hardest material after diamond, giving it outstanding wear resistance. Its mechanical properties, especially its fracture toughness, are low, limiting its application. However, it is used extensively for ballistic armor and blast nozzles. Boron carbide is also a neutron absorber, making it a primary choice for control rods and other nuclear applications. Silicon Carbide (SiC). Silicon carbide has outstanding wear and thermal shock resistance. It has good mechanical properties, especially at high temperatures. It is a semiconductor material with electrical resistivities in the 10^5 ohm-cm range. It can be processed to a very high purity. Silicon carbide is used extensively for mechanical seals because of its chemical and wear resistance. Tungsten Carbide (WC). Tungsten carbide is generally made with high percentages of either cobalt or nickel as a second, metallic phase. These ceramic metals, or “cermets,” have wide use as cutting tools and other metal-forming tools. Pure tungsten carbide can be made as an advanced technical ceramic using a high-temperature hot isostatic pressing process. This material has very high hardness and wear resistance and is used for abrasive water jet nozzles; however, its weight limits its use in many applications. Aluminum Nitride (AlN). Aluminum nitride has a very high thermal conductivity while being an electrical insulator. This makes it an ideal material for use in electrical and thermal management situations. Boron Nitride (BN). Hexagonal boron nitride is a chalky white material and is often called “white graphite.” It has generally poor mechanical properties. It has outstanding high-temperature resistance (>2500ºC) in inert atmospheres but cannot be used above 500ºC in an air atmosphere. It is used as a high-temperature insulator and in combination with TiB2 in many ferrous and aluminum metallurgical applications. Silicon Nitride (Si3N4). Silicon nitride has the best combination of mechanical, thermal and electrical properties of any advanced technical ceramic material. Its high strength and toughness make it the material of choice for automotive and bearing applications. Source: Ceradyne Inc., Costa Mesa, Calif., www.ceradyne.com. Note: Although we have no reason to doubt the accuracy of the data presented, this information is offered for comparison only. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ceradyne and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

8

WWW.CERAMICINDUSTRY.COM/CCD

Typical Alumina (Al2O3) 99.5% Properties Alumina represents the most commonly used ceramic material in industry. It provides superior abrasion, high temperature and chemical resistance, and is also electrically insulating. This material has an excellent cost-to-part life performance record. Purity levels are available from 85% through 99.9%. Applications include wear- and heat-resistant liners, mechanical and pump seals, nozzles, semiconductor equipment components, insulators, etc.

Properties Physical Chemical Formula Density, l Color Crystal Structure Water Absorption Hardness Hardness Mechanical Compressive Strength Tensile Strength Modulus of Elasticity (Young’s Modulus) Flexural Strength (MOR) Poisson’s Ratio, p Fracture Toughness, KIc Thermal Max. Use Temperature (in air) Thermal Shock Resistance Thermal Conductivity Coefficient of Linear Thermal Expansion, _l Specific Heat, cp Electrical Dielectric Constant Dielectric Strength Electrical Resistivity

Units

Test

g/cm3

ASTM C20

% @ room temperature (R.T.) Mohs Knoop (kg/mm2)

ASTM C373 Knoop 100 g

Al2O3 3.7-3.97 ivory/white hexagonal 0.0 9 2000

MPa @ R.T. MPa @ R.T.

ASTM C773 ACMA Test #4

2070-2620 260-300

GPa MPa @ R.T.

ASTM C848 ASTM F417 ASTM C818 Notched Beam Test

393 310-379 0.27 4.5

ºC 6T (ºC) W/m-K @ R.T. +m/m-ºC (~25ºC through ±1000ºC) cal/g-ºC @ R.T.

No load cond. Quenching ASTM C408 ASTM C372

1750 200 35 8.4

ASTM C351

0.21

1 MHz @ R.T. kV/mm 1cm @ R.T.

ASTM D150 ASTM D116 ASTM D1829

9.6 15 >1014

MPa x m1/2

Value

Source: Ferro-Ceramic Grinding, Inc., Wakefield, Mass., www.ferroceramic.com. Note: Although we have no reason to doubt the accuracy of the data presented, this information is offered for comparison only. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ferro-Ceramic Grinding and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

CERAMIC COMPONENTS DIRECTORY ³ 2011

9

Typical Aluminum Nitride (AlN) Properties While AlN is not a new material, manufacturability developments over the past 15 years have made it an exciting and viable ceramic design option. One of the most useful applications AlN has found is in replacing beryllium oxide (BeO) in the semiconductor industry due to BeO’s toxicity. The thermal expansion coefficient of AlN is lower than BeO or alumina, and closely matches that of the silicon wafers used in electronics. While this was once a limitation for AlN’s use in electronic applications, there are now processes to metallize AlN. Electronic and structural grades of this material exist, classified as such by the thermal conductivity, which is controlled by the purity of the AlN. Pristine material is white, high-purity is tan, and a gray color indicates contaminants.

Properties Physical Chemical Formula Density, l Color Crystal Structure Water Absorption Hardness Hardness Mechanical Compressive Strength Tensile Strength Modulus of Elasticity (Young’s Modulus) Flexural Strength (MOR) Poisson’s Ratio, p Fracture Toughness, KIc Thermal Max. Use Temperature (in air) Thermal Shock Resistance Thermal Conductivity Coefficient of Linear Thermal Expansion, _l Specific Heat, cp Electrical Dielectric Constant Dielectric Strength Electrical Resistivity

Units

Test

g/cm3

ASTM C20

% @ room temperature (R.T.) Mohs Knoop (kg/mm2)

ASTM C373 Knoop 100 g

AlN 3.25 white/tan/gray hexagonal 0.0 5 1170

MPa @ R.T. MPa @ R.T.

ASTM C773 ACMA Test #4

2068 —

GPa MPa @ R.T.

ASTM C848 ASTM F417 ASTM C818 Notched Beam Test

308 428 0.25 3.5

MPa x m1/2

Value

ºC 6T (ºC) W/m-K @ R.T. +m/m-ºC (~25ºC through ±1000ºC) cal/g-ºC @ R.T.

No load cond. Quenching ASTM C408 ASTM C372

1600 400 82.3-170 4.6-5.7

ASTM C351

0.25

1 MHz @ R.T. kV/mm 1cm @ R.T.

ASTM D150 ASTM D116 ASTM D1829

8.0-9.1 15 >1014

Source: Ferro-Ceramic Grinding, Inc., Wakefield, Mass., www.ferroceramic.com. Note: Although we have no reason to doubt the accuracy of the data presented, this information is offered for comparison only. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ferro-Ceramic Grinding and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

10

WWW.CERAMICINDUSTRY.COM/CCD

Typical Boron Carbide (B4C) Properties Boron carbide is the hardest material after diamond, giving it outstanding wear resistance. Its mechanical properties, especially its fracture toughness, are low, limiting its application. However, it is used extensively for ballistic armor and blast nozzles. Boron carbide is also a neutron absorber, making it a primary choice for control rods and other nuclear applications.*

Properties Physical Chemical Formula Density, l Color Crystal Structure Water Absorption Hardness Hardness Mechanical Compressive Strength Tensile Strength Modulus of Elasticity Flexural Strength (MOR) Poisson’s Ratio, p Fracture Toughness, KIc Thermal Max. Use Temperature (melting point temperature) Thermal Shock Resistance Thermal Conductivity Coefficient of Linear Thermal Expansion, _l Specific Heat, cp Electrical Dielectric Constant Dielectric Strength Electrical Resistivity

Units

Value

% @ room temperature (R.T.) Vickers @ R.T. (GPa) Knoop (kg/mm2)

B4C 2.51 black or dark gray* hexagonal ng 36 ng

GPa @ R.T. MPa @ 980ÞC GPa @ R.T. MPa @ R.T. @ R.T. MPa x m1/2

2.9 155 445 375 0.19 ng

ºC 6T (ºC) W/m-K @ R.T. 10-6 K-1 (~25ºC through ±1000ºC) J kg-1 K-1 @ R.T.

2450 ng 28 5.54

1 MHz @ R.T. kV/mm 1cm @ R.T.

ng ng ng

g/cm3

945

Source: NIST, www.ceramics.nist.gov/srd/scd/Z00093.htm#M1P1. Note: Typical values usually are representative of trends of values commonly found for a general class of B4C materials and are not necessarily the best or most appropriate values for any particular material. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ceramic Industry disclaims any and all liability from error, omissions or inaccuracies in the above chart. * = information added by the editors; ng = not given in the original source

CERAMIC COMPONENTS DIRECTORY ³ 2011

11

Typical Boron Nitride (BN) Properties BN is made using a hot pressing process and comes as a lubricious white solid. It can be machined using standard carbide drills. Due to its crystal structure, BN is anisotropic electrically and mechanically. It exhibits a high electrical resistance, low dielectric constant and loss tangent, low thermal expansion, chemical inertness, and good thermal shock resistance. There are several different purity levels for this material. All offer very high thermal conductivity and stability in inert and reducing atmospheres up to 2800°C, and up to 850°C in oxidizing environments. Typical uses include vacuum components, low-friction seals, various electronic parts, nuclear applications and plasma arc insulators.

Properties Physical Chemical Formula Density, l Color Crystal Structure Water Absorption Hardness Hardness Mechanical Compressive Strength Tensile Strength Modulus of Elasticity (Young’s Modulus) Flexural Strength (MOR) Poisson’s Ratio, p Fracture Toughness, KIc Thermal Max. Use Temperature (in air) Thermal Shock Resistance Thermal Conductivity Coefficient of Linear Thermal Expansion, _l Specific Heat, cp Electrical Dielectric Constant Dielectric Strength Electrical Resistivity

Units

Test

g/cm3

ASTM C20

% @ room temperature (R.T.) Mohs Knoop (kg/mm2)

ASTM C373 Knoop 100 g

BN 2.28 white hexagonal 0.0-1.0 2 25-205

MPa @ R.T. MPa @ R.T.

ASTM C773 ACMA Test #4

23.5 2.41 (1000ºC)

GPa MPa @ R.T.

ASTM C848 ASTM F417 ASTM C818 Notched Beam Test

675 51.8 0.05 2.6

MPa x m1/2

Value

ºC 6T (ºC) W/m-K @ R.T. +m/m-ºC (~25ºC through ±1000ºC) cal/g-ºC @ R.T.

No load cond. Quenching ASTM C408 ASTM C372

985 >1500 20 1.0-2.0

ASTM C351

0.19

1 MHz @ R.T. kV/mm 1cm @ R.T.

ASTM D150 ASTM D116 ASTM D1829

4.08 374 1013

Source: Ferro-Ceramic Grinding, Inc., Wakefield, Mass., www.ferroceramic.com. Note: Although we have no reason to doubt the accuracy of the data presented, this information is offered for comparison only. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ferro-Ceramic Grinding and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

12

WWW.CERAMICINDUSTRY.COM/CCD

Typical Cordierite Properties Cordierite is mainly a structural ceramic and is often used for kiln furniture due to its extremely good thermal shock resistance. Like other structural ceramic materials, cordierite also has good thermal and electrical insulating capabilities.

Properties Physical Chemical Formula Density, l Color Crystal Structure Water Absorption Hardness Hardness Mechanical Compressive Strength Tensile Strength Modulus of Elasticity (Young’s Modulus) Flexural Strength (MOR) Poisson’s Ratio, p Fracture Toughness, KIc Thermal Max. Use Temperature (in air) Thermal Shock Resistance Thermal Conductivity Coefficient of Linear Thermal Expansion, _l Specific Heat, cp Electrical Dielectric Constant Dielectric Strength Electrical Resistivity

Units

Test

g/cm3

ASTM C20

Value

% @ room temperature (R.T.) ASTM C373 Mohs Knoop (kg/mm2) Knoop 100 g

2MgO-2Al2O3-5SiO2 2.60 tan orthorhombic 0.02-3.2 7 —

MPa @ R.T. MPa @ R.T.

ASTM C773 ACMA Test #4

350 25.5

GPa MPa @ R.T.

ASTM C848 ASTM F417 ASTM C818 Notched Beam Test

70 117 0.21 —

MPa x m1/2 ºC 6T (ºC) W/m-K @ R.T. +m/m-ºC (~25ºC through ±1000ºC) cal/g-ºC @ R.T.

No load cond. Quenching ASTM C408 ASTM C372

1371 500 3.0 1.7

ASTM C351

0.35

1 MHz @ R.T. kV/mm 1cm @ R.T.

ASTM D150 ASTM D116 ASTM D1829

4.7 5.11 1014

Source: Ferro-Ceramic Grinding, Inc., Wakefield, Mass., www.ferroceramic.com. Note: Although we have no reason to doubt the accuracy of the data presented, this information is offered for comparison only. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ferro-Ceramic Grinding and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

CERAMIC COMPONENTS DIRECTORY ³ 2011

13

Typical Graphite (C) Properties Graphite oxidizes under (heated) use in an air (oxidizing) environment and therefore finds its use in inert and vacuum applications such as furnace insulation packages and semiconductors. This material has the same lubricious properties as boron nitride, thanks to the same crystal structure. In inert atmospheres, use temperatures can be upwards of 3500°C.

Properties Physical Chemical Formula Density, l Color Crystal Structure Water Absorption Hardness Hardness Mechanical Compressive Strength Tensile Strength Modulus of Elasticity (Young’s Modulus) Flexural Strength (MOR) Poisson’s Ratio, p Fracture Toughness, KIc Thermal Max. Use Temperature (in air) Thermal Shock Resistance Thermal Conductivity Coefficient of Linear Thermal Expansion, _l Specific Heat, cp Electrical Dielectric Constant Dielectric Strength Electrical Resistivity

Units

Test

g/cm3

ASTM C20

% @ room temperature (R.T.) Mohs Knoop (kg/mm2)

ASTM C373 Knoop 100 g

C 2.28 black hexagonal 0.5-3.0 0.1-1.5 —

MPa @ R.T. MPa @ R.T.

ASTM C773 ACMA Test #4

96 4.8

GPa MPa @ R.T.

ASTM C848 ASTM F417 ASTM C818 Notched Beam Test

4.8 50 — —

MPa x m1/2

Value

ºC 6T (ºC) W/m-K @ R.T. +m/m-ºC (~25ºC through ±1000ºC) cal/g-ºC @ R.T.

No load cond. Quenching ASTM C408 ASTM C372

3650 200-250 24 8.39

ASTM C351

0.16

1 MHz @ R.T. kV/mm 1cm @ R.T.

ASTM D150 ASTM D116 ASTM D1829

— — 7 x 10-3

Source: Ferro-Ceramic Grinding, Inc., Wakefield, Mass., www.ferroceramic.com. Note: Although we have no reason to doubt the accuracy of the data presented, this information is offered for comparison only. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ferro-Ceramic Grinding and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

14

WWW.CERAMICINDUSTRY.COM/CCD

Typical Mullite Properties Mullite is an excellent structural material due to its high temperature stability, strength and creep resistance. It has a low dielectric constant and high electrical insulation capabilities. Typical applications include kiln furniture, furnace center tubes, heat exchange parts, heat insulation parts and rollers.

Properties Physical Chemical Formula Density, l Color Crystal Structure Water Absorption Hardness Hardness Mechanical Compressive Strength Tensile Strength Modulus of Elasticity (Young’s Modulus) Flexural Strength (MOR) Poisson’s Ratio, p Fracture Toughness, KIc Thermal Max. Use Temperature (in air) Thermal Shock Resistance Thermal Conductivity Coefficient of Linear Thermal Expansion, _l Specific Heat, cp Electrical Dielectric Constant Dielectric Strength Electrical Resistivity

Units

Test

g/cm3

ASTM C20

% @ room temperature (R.T.) Mohs Knoop (kg/mm2)

ASTM C373 Knoop 100 g

3Al2O3-SiO2 2.80 tan orthorhombic 0.0 8 1450

MPa @ R.T. MPa @ R.T.

ASTM C773 ACMA Test #4

551 103.5

GPa MPa @ R.T.

ASTM C848 ASTM F417 ASTM C818 Notched Beam Test

150 170 0.25 2.0

MPa x m1/2

Value

ºC 6T (ºC) W/m-K @ R.T. +m/m-ºC (~25ºC through ±1000ºC) cal/g-ºC @ R.T.

No load cond. Quenching ASTM C408 ASTM C372

1700 300 3.5 5.3

ASTM C351

0.23

1 MHz @ R.T. kV/mm 1cm @ R.T.

ASTM D150 ASTM D116 ASTM D1829

6.0 9.8 1013

Source: Ferro-Ceramic Grinding, Inc., Wakefield, Mass., www.ferroceramic.com. Note: Although we have no reason to doubt the accuracy of the data presented, this information is offered for comparison only. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ferro-Ceramic Grinding and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

CERAMIC COMPONENTS DIRECTORY ³ 2011

15

Typical Sapphire Properties The advantages of sapphire as a design material are numerous. Extremely high use temperature, hardness, optical clarity, flexural strength and chemical resistance make it an increasingly popular choice. Applications include grocery store scanner windows, watch glasses, and countless semiconductor and aerospace/military applications.

Properties Physical Chemical Formula Density, l Color Crystal Structure Water Absorption Hardness Hardness Mechanical Compressive Strength Tensile Strength Modulus of Elasticity (Young’s Modulus) Flexural Strength (MOR) Poisson’s Ratio, p Fracture Toughness, KIc Thermal Max. Use Temperature (in air) Thermal Shock Resistance Thermal Conductivity Coefficient of Linear Thermal Expansion, _l Specific Heat, cp Electrical Dielectric Constant Dielectric Strength Electrical Resistivity

Units

Test

Value

g/cm3

ASTM C20

% @ room temperature (R.T.) Mohs Knoop (kg/mm2)

ASTM C373 Knoop 100 g

3.97 white/transparent trigonal 0.0 9 2200

MPa @ R.T. MPa @ R.T.

ASTM C773 ACMA Test #4

2000 250-400

GPa MPa @ R.T.

ASTM C848 ASTM F417 ASTM C818 Notched Beam Test

250-400 760-1035 0.29 1.89

ºC 6T (ºC) W/m-K @ R.T. +m/m-ºC (~25ºC through ±1000ºC) cal/g-ºC @ R.T.

No load cond. Quenching ASTM C408 ASTM C372

~2000 200 40 7.9-8.8

ASTM C351

0.18

1 MHz @ R.T. kV/mm 1cm @ R.T.

ASTM D150 ASTM D116 ASTM D1829

9.3-11.4 15-50 1017

_-Al2O3

MPa x m1/2

Source: Ferro-Ceramic Grinding, Inc., Wakefield, Mass., www.ferroceramic.com. Note: Although we have no reason to doubt the accuracy of the data presented, this information is offered for comparison only. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ferro-Ceramic Grinding and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

16

WWW.CERAMICINDUSTRY.COM/CCD

Typical Silicon Carbide (SiC) Properties SiC is an artificial (man-made) mineral known for its very high hardness and abrasion resistance. Common applications include pump seals, valve components, and wear-intensive applications such as rollers and paper industry retainers.

Properties Physical Chemical Formula Density, l Color Crystal Structure Water Absorption Hardness Hardness Mechanical Compressive Strength Tensile Strength Modulus of Elasticity (Young’s Modulus) Flexural Strength (MOR) Poisson’s Ratio, p Fracture Toughness, KIc Thermal Max. Use Temperature (in air) Thermal Shock Resistance Thermal Conductivity Coefficient of Linear Thermal Expansion, _l Specific Heat, cp Electrical Dielectric Constant Dielectric Strength Electrical Resistivity

Units

Test

g/cm3

ASTM C20

% @ room temperature (R.T.) Mohs Knoop (kg/mm2)

ASTM C373 Knoop 100 g

_-SiC 3.21 dark gray hexagonal 0.0 9-10 2800

MPa @ R.T. MPa @ R.T.

ASTM C773 ACMA Test #4

1725-2500 310

GPa MPa @ R.T.

ASTM C848 ASTM F417 ASTM C818 Notched Beam Test

476 324 0.19 4.0

MPa x m1/2

Value

ºC 6T (ºC) W/m-K @ R.T. +m/m-ºC (~25ºC through ±1000ºC) cal/g-ºC @ R.T.

No load cond. Quenching ASTM C408 ASTM C372

1400 350-500 41 5.12

ASTM C351

0.15

1 MHz @ R.T. kV/mm 1cm @ R.T.

ASTM D150 ASTM D116 ASTM D1829

10.2 — 108

Source: Ferro-Ceramic Grinding, Inc., Wakefield, Mass., www.ferroceramic.com. Note: Although we have no reason to doubt the accuracy of the data presented, this information is offered for comparison only. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ferro-Ceramic Grinding and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

CERAMIC COMPONENTS DIRECTORY ³ 2011

17

Terminology Commonly Associated with Silicon Carbide Processing Recrystallized Silicon Carbide (RXSIC, ReSIC, RSIC, R-SIC). The starting raw material is silicon carbide. No densification aids are used. The green compacts are heated to over 2200ºC for final consolidation. The resulting material has about 25% porosity, which limits its mechanical properties; however, the material can be very pure. The process is very economical. Reaction Bonded Silicon Carbide (RBSIC). The starting raw materials are silicon carbide plus carbon. The green component is then infiltrated with molten silicon above 1450ºC with the reaction: SiC + C + Si -> SiC. The microstructure generally has some amount of excess silicon, which limits its high-temperature properties and corrosion resistance. Little dimensional change occurs during the process; however, a layer of silicon is often present on the surface of the final part. Nitride Bonded Silicon Carbide (NBSIC, NSIC). The starting raw materials are silicon carbide plus silicon powder. The green compact is fired in a nitrogen atmosphere where the reaction SiC + 3Si + 2N2 -> SiC + Si3N4 occurs. The final material exhibits little dimensional change during processing. The material exhibits some level of porosity (typically about 20%). Direct Sintered Silicon Carbide (SSIC). Silicon carbide is the starting raw material. Densification aids are boron plus carbon, and densification occurs by a solid-state reaction process above 2200ºC. Its hightemperature properties and corrosion resistance are superior because of the lack of a glassy second phase at the grain boundaries. Liquid Phase Sintered Silicon Carbide (LSSIC). Silicon carbide is the starting raw material. Densification aids are yttrium oxide plus aluminum oxide. Densification occurs above 2100ºC by a liquid-phase reaction and results in a glassy second phase. The mechanical properties are generally superior to SSIC, but the high-temperature properties and the corrosion resistance are not as good. Hot Pressed Silicon Carbide (HPSIC). Silicon carbide powder is used as the starting raw material. Densification aids are generally boron plus carbon or yttrium oxide plus aluminum oxide. Densification occurs by a simultaneous application of mechanical pressure and temperature inside a graphite die cavity. The shapes are simple plates. Low amounts of sintering aids can be used. Mechanical properties of hot pressed materials are used as the baseline against which other processes are compared. Electrical properties can be altered by changes in the densification aids. CVD Silicon Carbide (CVDSIC). This material is formed by a chemical vapor deposition (CVD) process involving the reaction: CH3SiCl3 -> SiC + 3HCl. The reaction is carried out under a H2 atmosphere with the SiC being deposited onto a graphite substrate. The process results in a very high-purity material; however, only simple plates can be made. The process is very expensive because of the slow reaction times. Chemical Vapor Composite Silicon Carbide (CVCSiC). This process starts with a proprietary graphite precursor that is machined into near-net shapes in the graphite state. The conversion process subjects the graphite part to an in situ vapor solid-state reaction to produce a polycrystalline, stoichiometrically correct SiC. This tightly controlled process allows complicated designs to be produced in a completely converted SiC part that has tight tolerance features and high purity. The conversion process shortens the normal production time and reduces costs over other methods.* Source (except where noted): Ceradyne Inc., Costa Mesa, Calif., www.ceradyne.com. *Source: Poco Graphite, Inc., Decatur, Texas, www.poco.com. Note: The above information is for general reference only and is not intended to represent the processes used by all SiC suppliers. Consult your supplier for specific SiC processing information. Ceradyne, Poco Graphite and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

18

WWW.CERAMICINDUSTRY.COM/CCD

Typical Silicon Nitride (Si3N4) Properties Si3N4 has the strongest covalent bond properties next to silicon carbide. It is used as a high-temperature structural ceramic due to its superior heat resistance, strength and hardness. It also offers excellent wear and corrosion resistance. Various types are available (sintered, CVD, HP), and they are used for different purposes. Main applications include heat exchangers, rotors, nozzles, bearings, valves, chemical plant parts, engine components and armor.

Properties

Units

Test

Physical Chemical Formula Density, l Color Crystal Structure

g/cm3

ASTM C20

% @ room temperature (R.T.) Mohs Knoop (kg/mm2)

ASTM C373 Knoop 100 g

Si3N4 3.31 dark gray hexagonal (alpha & beta) 0.0 9 2200

MPa @ R.T. MPa @ R.T.

ASTM C773 ACMA Test #4

689-2760 360-434

GPa MPa @ R.T.

ASTM C848 ASTM F417 ASTM C818 Notched Beam Test

317 679-896 0.23 5.0-8.0

ºC 6T (ºC) W/m-K @ R.T. +m/m-ºC (~25ºC through ±1000ºC) cal/g-ºC @ R.T.

No load cond. Quenching ASTM C408 ASTM C372

1500 750 27 3.4

ASTM C351

0.17

1 MHz @ R.T. kV/mm 1cm @ R.T.

ASTM D150 ASTM D116 ASTM D1829

7.0 17.7 1013

Water Absorption Hardness Hardness Mechanical Compressive Strength Tensile Strength Modulus of Elasticity (Young’s Modulus) Flexural Strength (MOR) Poisson’s Ratio, p Fracture Toughness, KIc Thermal Max. Use Temperature (in air) Thermal Shock Resistance Thermal Conductivity Coefficient of Linear Thermal Expansion, _l Specific Heat, cp Electrical Dielectric Constant Dielectric Strength Electrical Resistivity

MPa x m1/2

Value

Source: Ferro-Ceramic Grinding, Inc., Wakefield, Mass., www.ferroceramic.com. Note: Although we have no reason to doubt the accuracy of the data presented, this information is offered for comparison only. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ferro-Ceramic Grinding and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

CERAMIC COMPONENTS DIRECTORY ³ 2011

19

Terminology Commonly Associated with Silicon Nitride Processing Reaction Bonded Silicon Nitride (RBSN). Starting raw material is silicon. Formed by the reaction: 3Si+2N2 -> Si3N4 at 1400ºC. No sintering additives are used, and no volume change occurs during the reaction. The resulting material is generally 99% pure with about 25% porosity. Sintered Silicon Nitride (SSN). Starting raw material is silicon nitride powder. Sintering additives such as yttrium oxide and aluminum oxide are used. Sintering takes place at about 1800ºC, depending on the amount of additives employed and 1 atmosphere of pressure. Densities are generally in the 98% range with strengths in the 600-700 MPa range. Sintered Reaction Bonded Silicon Nitride (SRBSN). The starting raw material is silicon. Sintering additives such as yttrium oxide and aluminum oxide are used. The firing process is done in two stages. First is the reaction bonding process: 3Si+2N2 -> Si3N4 at 1400ºC, and then sintering at >1800ºC at 1 atmosphere. Properties are similar to SSN. The advantages are low-cost raw materials and lower sintering shrinkages that help in dimensional control. Gas Pressure Sintered Silicon Nitride (GPS-SIN). Similar to SSN, except the sintering is performed at 20 to 100 atmospheres. The densities are generally over 99%, and the mechanical properties are superior. Lower amounts of sintering additives can be used. Gas Pressure Sintered Reaction Bonded Silicon Nitride (GPS-SRBSN). A combination of SRBSN and GPS-SIN. This fabrication process offers the best combination of mechanical properties and low-cost processing. Hot Pressed Silicon Nitride (HPSN). Silicon nitride powder is used as the starting raw material. Densification aids are generally magnesium or yttrium oxide plus aluminum oxide. Densification occurs by a simultaneous application of mechanical pressure and temperature inside a graphite die cavity. The shapes are simple plates, and low amounts of sintering aids can be used. Mechanical properties of hot pressed materials are used as the baseline against which other processes are compared. Hot Isostatic Pressed Silicon Nitride (HIPSN). Similar to GPS-SIN, except that the pressures are higher—1000 to 2000 atmospheres. The sintering aids are similar to HPSN. Ultimate mechanical properties are achieved. This is the highest-cost near-net-shape processing route. Source: Ceradyne Inc., Costa Mesa, Calif., www.ceradyne.com. Note: The above information is for general reference only and is not intended to represent the processes used by all Si3N4 suppliers. Consult your supplier for specific Si3N4 processing information. Ceradyne and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

20

WWW.CERAMICINDUSTRY.COM/CCD

Typical Steatite L-5* Properties This material has applications where insulating and temperature resistance are a concern. Many insulators and other standoffs are made of steatite. The cost of this material is relatively low when compared with other ceramic materials.

Properties Physical Chemical Formula Density, l Color Crystal Structure Water Absorption Hardness Hardness Mechanical Compressive Strength Tensile Strength Modulus of Elasticity (Young’s Modulus) Flexural Strength (MOR) Poisson’s Ratio, p Fracture Toughness, KIc Thermal Max. Use Temperature (in air) Thermal Shock Resistance Thermal Conductivity Coefficient of Linear Thermal Expansion, _l Specific Heat, cp Electrical Dielectric Constant Dielectric Strength Electrical Resistivity

Units

Test

g/cm3

ASTM C20

% @ room temperature (R.T.) Mohs Knoop (kg/mm2)

ASTM C373 Knoop 100 g

H2Mg3(SiO3)4 2.71 buff hexagonal 0.0-0.2 7.5 —

MPa @ R.T. MPa @ R.T.

ASTM C773 ACMA Test #4

621 62

GPa MPa @ R.T.

ASTM C848 ASTM F417 ASTM C818 Notched Beam Test

138 140 — —

MPa x m1/2

Value

ºC 6T (ºC) W/m-K @ R.T. +m/m-ºC (~25ºC through ±1000ºC) cal/g-ºC @ R.T.

No load cond. Quenching ASTM C408 ASTM C372

1425 190 2.9 7.0

ASTM C351

0.22

1 MHz @ R.T. kV/mm 1cm @ R.T.

ASTM D150 ASTM D116 ASTM D1829

6.3 9.3 104

Source: Ferro-Ceramic Grinding, Inc., Wakefield, Mass., www.ferroceramic.com. *Two common steatite grades are L-3, used for general applications, and L-5, typically used for applications in which low electrical loss is critical. A third grade, L-4, can also be obtained from some suppliers. For specific material properties, contact your steatite supplier. Note: Although we have no reason to doubt the accuracy of the data presented, this information is offered for comparison only. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ferro-Ceramic Grinding and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

CERAMIC COMPONENTS DIRECTORY ³ 2011

21

Typical Titanium Diboride (TiB2) Properties The values presented here are trend values derived for polycrystalline TiB2 specimens with a purity (mass fraction of TiB2) of at least 98 %, a density of (4.5±0.1) g/cm3, and a mean grain size of (9±1) μm. Estimated combined relative standard uncertainties of the property values are listed in the last column. For example, a value of 3.0 with ur = 5% is equivalent to 3.0±0.15. A question mark (?) for ur means the uncertainty could not be determined with the available data.

Property [unit]

20°C

500°C

1000°C 1200°C 1500°C 2000°C ur [%]a

Bulk Modulus [GPa] Compressive Strength [GPa] Creep Rateb [10-9 s-1] Densityc [g/cm3] Elastic Modulus [GPa] Flexural Strength [MPa] Fracture Toughness [MPa m1/2] Friction Coefficientd Hardnesse [GPa] Lattice Parameterf a [Å] Lattice Parameterf c [Å] Poisson’s Ratio Shear Modulus [GPa] Sound Velocity, longitudinal [km/s] Sound Velocity, shear [km/s] Specific Heat [J/kg·K] Thermal Conductivity [W/m·K] Thermal Diffusivity [cm2/s] Thermal Expansiong, a axis [10-6K-1] Thermal Expansiong, c axis [10-6K-1] Thermal Expansionh, average [10-6K-1] Wear Coefficientd [10-3] Weibull Modulus

240 1.8

234

228

4.500 565 400 6.2 0.9 25 3.029 3.229 0.108 255 11.4 7.53 617 96 0.30 6.4 9.2 7.4 1.7 11i

4.449 550 429

4.389 534 459

0.9 11 3.039 3.244 0.108 248 11.3 7.47 1073 81 0.17 7.0 9.8 7.9

0.6 4.6 3.052 3.262 0.108 241 11.2 7.40 1186 78.1 0.149 7.7 10.4 8.6

4.363

0.005 4.322

3.1 4.248

471

489

3.057 3.269

3.066 3.281

3.082 3.303

1228 77.8 0.147 7.9 10.6 8.8

1291

1396

8.3 11.0 9.2

8.9 11.6 9.8

24 ? 20 0.07 5 25 15 15 12 0.03 0.04 70 5 5 3 1.5 6 6 7 5 6 24 ?

a) Estimated combined relative standard uncertainty expressed as a percentage; b) Flexure creep rate at 100 MPa for density = 4.29 g/cm3, grain size = 18 μm; c) Single crystal density; d) Density = 4.32 g/cm3, grain size = 2 μm, vslide/Pload = 0.2 m s-1 MPa-1; e) Vickers indentation, load = 5 N; f) Single crystal, hexagonal unit cell; g) Single crystal, for cumulative expansion from 293 K (20ºC), CTE = (1/x293)(x-x293)/(T/K - 293), x = a or c; h) Bulk average, for cumulative expansion from 20ºC; i) Three values have been reported in the literature: 8, 11 and 29. Source: NIST, www.ceramics.nist.gov/srd/summary/scdtib2.htm. Note: The data presented here were derived from reported values for a narrowly defined material specification. Using trend analysis, property relations, and interpolation methods, the self-consistent trend values for the properties of polycrystalline TiB2 were determined for a mass fraction of TiB2 of at least 98%, a density of (4.5±0.1) g/cm3, and a mean grain size of (9±1) μm. Ceramic Industry disclaims any and all liability from error, omissions or inaccuracies in the above chart.

22

WWW.CERAMICINDUSTRY.COM/CCD

Typical Tungsten Carbide (WC) Properties Tungsten carbide is generally made with high percentages of either cobalt or nickel as a second, metallic phase. These ceramic metals, or “cermets,” have wide use as cutting tools and other metals-forming tools. Pure tungsten carbide can be made as an advanced technical ceramic using a high-temperature hot isostatic pressing process. This material has very high hardness and wear resistance, and is used for abrasive water jet nozzles; however, its weight limits its use in many applications.*

Properties Physical Chemical Formula Density, l Color Crystal Structure Water Absorption Hardness Hardness Mechanical Compressive Strength Tensile Strength Modulus of Elasticity Flexural Strength (MOR) Poisson’s Ratio, p Fracture Toughness, KIc Thermal Max. Use Temperature (melting point temperature) Thermal Shock Resistance Thermal Conductivity Coefficient of Linear Thermal Expansion, _l Specific Heat, cp Electrical Dielectric Constant Dielectric Strength Electrical Resistivity

Units

Value

% @ room temperature (R.T.) Vickers @ R.T. (GPa) Knoop (kg/mm2)

WC 13.0-15.3 metallic gray* ng ng ng 1307-2105*

GPa @ R.T. MPa @ 980ÞC GPa @ R.T. MPa @ R.T. @ R.T. MPa x m1/2

3.10-5.86 ng 483-641 ng ng ng

ºC 6T (ºC) W/m-K @ R.T. 10-6 K-1 (~25ºC through ±1000ºC) J kg-1 K-1 @ R.T.

ng ng 71-121 5.9

1 MHz @ R.T. kV/mm 1cm @ R.T.

ng ng ng

g/cm3

945

Source: NIST, www.ceramics.nist.gov/srd/scd/Z00093.htm#M3P1. Note: Typical values usually are representative of trends of values commonly found for a general class of WC materials and are not necessarily the best or most appropriate values for any particular material. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ceramic Industry disclaims any and all liability from error, omissions or inaccuracies in the above chart. * = information added by the editors; ng = not given in the original source

CERAMIC COMPONENTS DIRECTORY ³ 2011

23

Typical Zirconia (ZrO2) Properties Zirconia ceramics have a martensite-type transformation mechanism of stress induction, which provides the ability to absorb great amounts of stress relative to other ceramic materials. It exhibits the highest mechanical strength and toughness at room temperature. Zirconia has excellent wear, chemical and corrosion resistance, and low thermal conductivity. Common applications include extrusion dies, wire and pipe extension, guide and other wear rollers, pressure valves, and bearing materials.

Properties Physical Chemical Formula Density, l Color Crystal Structure Water Absorption Hardness Hardness Mechanical Compressive Strength Tensile Strength Modulus of Elasticity (Young’s Modulus) Flexural Strength (MOR) Poisson’s Ratio, p Fracture Toughness, KIc Thermal Max. Use Temperature (in air) Thermal Shock Resistance Thermal Conductivity Coefficient of Linear Thermal Expansion, _l Specific Heat, cp Electrical Dielectric Constant Dielectric Strength Electrical Resistivity

Units

Test

g/cm3

ASTM C20

% @ room temperature (R.T.) Mohs Knoop (kg/mm2)

ASTM C373 Knoop 100 g

ZrO2 6.04 white tetragonal 0.0 6.5 1600

MPa @ R.T. MPa @ R.T.

ASTM C773 ACMA Test #4

2500 248

GPa MPa @ R.T.

ASTM C848 ASTM F417 ASTM C818 Notched Beam Test

207 900 0.32 13.0

MPa x m1/2

Value

ºC 6T (ºC) W/m-K @ R.T. +m/m-ºC (~25ºC through ±1000ºC) cal/g-ºC @ R.T.

No load cond. Quenching ASTM C408 ASTM C372

500 280-360 2.7 11.0

ASTM C351

0.10

1 MHz @ R.T. kV/mm 1cm @ R.T.

ASTM D150 ASTM D116 ASTM D1829

26 @ 100kHz 9.0 >104

Source: Ferro-Ceramic Grinding, Inc., Wakefield, Mass., www.ferroceramic.com. Note: Although we have no reason to doubt the accuracy of the data presented, this information is offered for comparison only. Exact properties will vary depending on the manufacturing method and part configuration, and can sometimes be tailored to meet specific requirements. Contact your component supplier for more detailed information. Ferro-Ceramic Grinding and Ceramic Industry disclaim any and all liability from error, omissions or inaccuracies in the above chart.

24

WWW.CERAMICINDUSTRY.COM/CCD

Master Component Index Acoustical Product . . . . . . . . . . . 30 Actuator . . . . . . . . . . . . . . . . . . . 30 Aggregate, Insulating . . . . . . . . 30 Alumina Component. . . . . . . . . . 30 Aluminum Nitride Component . . 30 Aluminum Oxide Component . . . 30 Anode . . . . . . . . . . . . . . . . . . . . . 30 Antenna . . . . . . . . . . . . . . . . . . . 30 Chip Dielectric . . . . . . . . . . . 30 Dielectric . . . . . . . . . . . . . . . . 30 Antenna Strain Insulator . . . . . . 30 Attenuator . . . . . . . . . . . . . . . . . 30 Automotive Component . . . . . . . 30 Ball . . . . . . . . . . . . . . . . . . . . . . 30 Ball and Seat Check Valve . . . . . 30 Ball and Seat Check Valve Assembly . . . . . . . . . . . . . . . . 31 Ball and Socket Bead . . . . . . . . . 31 Ball Valve Component . . . . . . . . 31 Bead. . . . . . . . . . . . . . . . . . . . . . 31 Bead, Fishspine . . . . . . . . . . . . . 31 Bearing . . . . . . . . . . . . . . . . . . . 31 Bearing Component . . . . . . . . . . 31 Bell Jar . . . . . . . . . . . . . . . . . . . . 31 Beryllia Component . . . . . . . . . . 31 Bioceramic, Dental. . . . . . . . . . . 31 Bioceramic, Medical. . . . . . . . . . 31 Blank . . . . . . . . . . . . . . . . . . . . . 31 Bolt . . . . . . . . . . . . . . . . . . . . . . 31 Boride Component . . . . . . . . . . . 31 Boron Carbide Component . . . . . 31 Boron Nitride Component . . . . . 31 Brick. . . . . . . . . . . . . . . . . . . . . . 31 Acid Resisting . . . . . . . . . . . . 31 Basic . . . . . . . . . . . . . . . . . . . 31 Fireclay . . . . . . . . . . . . . . . . . 32 High-Alumina . . . . . . . . . . . . 32 Load-Bearing . . . . . . . . . . . . 32 Shape . . . . . . . . . . . . . . . . . . 32 Silica . . . . . . . . . . . . . . . . . . . 32 Burner Barrel Liner. . . . . . . . . . . 32 Burner Port. . . . . . . . . . . . . . . . . 32 Bushing . . . . . . . . . . . . . . . . . . . 32 Cup . . . . . . . . . . . . . . . . . . . . 32 Shoulder . . . . . . . . . . . . . . . . 32 Cam Roller . . . . . . . . . . . . . . . . . 32 Capacitor . . . . . . . . . . . . . . . . . . 32 High Energy Density . . . . . . . 32 High-Voltage . . . . . . . . . . . . . 32

Carbide Component . . . . . . . . . . 32 Carbon Component . . . . . . . . . . 32 Casting . . . . . . . . . . . . . . . . . . . 32 Refractory . . . . . . . . . . . . . . . 32 Wear Resistant . . . . . . . . . . . 32 Catalyst . . . . . . . . . . . . . . . . . . . 32 Cathode . . . . . . . . . . . . . . . . . . . 32 Cathode Assembly . . . . . . . . . . . 32 Hollow . . . . . . . . . . . . . . . . . . 32 Value-Added . . . . . . . . . . . . . 32 Cathode, Dispenser . . . . . . . . . . 32 Cellular Telephone Resonator Cavity Standoff . . . . . . . . . . . 32 Ceramic . . . . . . . . . . . . . . . . . . . 32 Armor . . . . . . . . . . . . . . . . . . 32 Armor Tile . . . . . . . . . . . . . . . 33 Castable . . . . . . . . . . . . . . . . 33 Fiber Product. . . . . . . . . . . . . 33 Flexible . . . . . . . . . . . . . . . . . 33 Foil . . . . . . . . . . . . . . . . . . . . 33 High-Temperature . . . . . . . . . 33 Machinable . . . . . . . . . . . . . . 33 Media . . . . . . . . . . . . . . . . . . 33 Plate . . . . . . . . . . . . . . . . . . . 33 Preform . . . . . . . . . . . . . . . . . 34 Cermet Component . . . . . . . . . . 34 Chamber Dome . . . . . . . . . . . . . 34 Chuck . . . . . . . . . . . . . . . . . . . . . 34 Circulator . . . . . . . . . . . . . . . . . . 34 Clamp Ring . . . . . . . . . . . . . . . . 34 Composite . . . . . . . . . . . . . . . . . 34 Carbon-Carbon . . . . . . . . . . . 34 Ceramic-Ceramic . . . . . . . . . 34 Ceramic Matrix . . . . . . . . . . . 34 Ceramic Matrix, Continuous Fiber Reinforced. . . . . . . . . 34 Ceramic Matrix, Discontinuous Whisker Reinforced . . . . . . 34 Ceramic Matrix, Whisker Reinforced . . . . . . . . . . . . . 34 Ceramic-Metal . . . . . . . . . . . 34 Intermetallic . . . . . . . . . . . . . 34 Composite Panel . . . . . . . . . . . . 34 Computer Tape Guide . . . . . . . . . 34 Controlled Resistivity Component . . . . . . . . . . . . . . 34 Conveyor Tile . . . . . . . . . . . . . . . 34 Cordierite Component . . . . . . . . 34 Core, Investment Casting. . . . . . 34

Cover Plate. . . . . . . . . . . . . . . . . 34 Crucible . . . . . . . . . . . . . . . . . . . 34 Assay . . . . . . . . . . . . . . . . . . 35 Fused Silica . . . . . . . . . . . . . 35 Quartz . . . . . . . . . . . . . . . . . . 35 Refractory . . . . . . . . . . . . . . . 35 Crucible Liner, Disposable . . . . . 35 Crystal . . . . . . . . . . . . . . . . . . . . 35 Custom Component . . . . . . . . . . 35 Cutters and Knife . . . . . . . . . . . . 36 Cutting Bit . . . . . . . . . . . . . . . . . 36 Cutting Tool . . . . . . . . . . . . . . . . 36 Cutting Tool Blank . . . . . . . . . . . 36 Cylinder . . . . . . . . . . . . . . . . . . . 36 Cylinder Liner Preform . . . . . . . . 36 Cylindrical Component, Custom . . 36 Dental Component . . . . . . . . . . . 36 Dewatering Foil . . . . . . . . . . . . . 36 Die . . . . . . . . . . . . . . . . . . . . . . . 36 Dielectric . . . . . . . . . . . . . . . . . . 36 Dielectric Resonator . . . . . . . . . . 36 Diesel Engine Exhaust Valve . . . 36 Diffusion Furnace Component . . 36 Disc . . . . . . . . . . . . . . . . . . . . . . 36 Valve . . . . . . . . . . . . . . . . . . . 36 Door Gasket . . . . . . . . . . . . . . . . 36 Door Seal . . . . . . . . . . . . . . . . . . 36 Dummy Semiconductor Wafer . . 36 Duplexer . . . . . . . . . . . . . . . . . . . 36 Electric Fuel Pump Component . . 36 Electrical Insulation . . . . . . . . . . 37 Electrical Porcelain Insulator . . . 37 Electroconductive Component . . 37 Electrode . . . . . . . . . . . . . . . . . . 37 Electrode Collar . . . . . . . . . . . . . 37 Electrodischarged Machinable (EDM) Component . . . . . . . . . 37 Electronic Circuitry Substrate . . 37 End Effector . . . . . . . . . . . . . . . . 37 Engine Component . . . . . . . . . . . 37 Erosion Sleeve . . . . . . . . . . . . . . 37 Evaporation Boat . . . . . . . . . . . . 37 Fastener . . . . . . . . . . . . . . . . . . . 37 Ferrite & Ferromagnetic . . . . . . . 37 Ferrite Core . . . . . . . . . . . . . . . . 37 Fiber Optic . . . . . . . . . . . . . . . . . 37 Ferrule . . . . . . . . . . . . . . . . . . 37 Sleeve . . . . . . . . . . . . . . . . . . 37 Splicer . . . . . . . . . . . . . . . . . . 37

CERAMIC COMPONENTS DIRECTORY ³ 2011

25

Master Component Index Filter. . . . . . . . . . . . . . . . . . . . . . 37 Ceramic Reticulated Foam . . 37 Dielectric . . . . . . . . . . . . . . . . 37 Fixture, Graphite . . . . . . . . . . . . 37 Floor Brick, Kiln . . . . . . . . . . . . . 37 Flue Liner . . . . . . . . . . . . . . . . . . 37 Fluid Meter Component . . . . . . . 37 Forming Die . . . . . . . . . . . . . . . . 37 Forming Die, Aluminum . . . . . . . 37 Forsterite Component . . . . . . . . . 37 Foundry Specialties . . . . . . . . . . 38 Fuel Cell . . . . . . . . . . . . . . . . . . . 38 Component . . . . . . . . . . . . . . 38 Insulation . . . . . . . . . . . . . . . 38 Fuel Pump Roller . . . . . . . . . . . . 38 Furnace . . . . . . . . . . . . . . . . . . . 38 Collar . . . . . . . . . . . . . . . . . . 38 Component . . . . . . . . . . . . . . 38 Disc . . . . . . . . . . . . . . . . . . . . 38 Pipe Hanger . . . . . . . . . . . . . 38 Roll . . . . . . . . . . . . . . . . . . . . 38 Fused Cast Refractory Component . .38 Fused Silica Brick . . . . . . . . . . . 38 Fused Silica Component. . . . . . . 38 Fused Silica Tool . . . . . . . . . . . . 38 Gas Distribution Plate . . . . . . . . 38 Gauge. . . . . . . . . . . . . . . . . . . . . 38 Gauge Block . . . . . . . . . . . . . . . . 38 Glass . . . . . . . . . . . . . . . . . . . . . 38 Borosilicate . . . . . . . . . . . . . . 38 Rod . . . . . . . . . . . . . . . . . . . . 38 Technical . . . . . . . . . . . . . . . . 38 Glass-Ceramic Component . . . . 38 Graphite Component . . . . . . . . . 38 Grinding Media . . . . . . . . . . . . . 40 Hearth Plate . . . . . . . . . . . . . . . . 40 Heat Exchanger . . . . . . . . . . . . . 40 Heat Shielding Component. . . . . 40 Heat Sink . . . . . . . . . . . . . . . . . . 40 Heat Treating Furnace Fan . . . . . 40 Heating Element . . . . . . . . . . . . 40 High-Temperature Ceramics . . . 40 High-Temperature Fixturing Component . . . . . . . . . . . . . . 40 High-Temperature Tubing. . . . . . 40 High-Voltage Component . . . . . . 42 Hollow Pair Lead-In . . . . . . . . . . 42 Honeycomb . . . . . . . . . . . . . . . . . 42 Hybrid Circuit . . . . . . . . . . . . . . . 42

26

IC Package . . . . . . . . . . . . . . . . . 42 Ignition Component . . . . . . . . . . 42 Inductor . . . . . . . . . . . . . . . . . . . 42 Industrial Component . . . . . . . . 42 Ingot. . . . . . . . . . . . . . . . . . . . . . 42 Ingot, Electron Beam Physical Vapor Deposition (EBPVD) . . . 42 Injection Molding . . . . . . . . . . . . 42 Injection Molding Compound, Zirconia . . . . . . . . . . . . . . . . . 42 Insulation . . . . . . . . . . . . . . . . . . 42 Custom . . . . . . . . . . . . . . . . . 42 Furnace . . . . . . . . . . . . . . . . . 42 Microporous . . . . . . . . . . . . . 42 Thermal . . . . . . . . . . . . . . . . . 43 Insulator. . . . . . . . . . . . . . . . . . . 43 Band Heater . . . . . . . . . . . . . 43 Ion Chamber Envelope . . . . . . . . 43 Isolator . . . . . . . . . . . . . . . . . . . . 43 Kiln. . . . . . . . . . . . . . . . . . . . . . . 43 Furniture . . . . . . . . . . . . . . . . 43 Shelf . . . . . . . . . . . . . . . . . . . 44 Support Beam . . . . . . . . . . . . 44 Tile . . . . . . . . . . . . . . . . . . . . 44 Labware . . . . . . . . . . . . . . . . . . . 44 Chemical Resistant. . . . . . . . 44 Fused Quartz . . . . . . . . . . . . . 44 Lamp Base . . . . . . . . . . . . . . . . . 44 Lapping Plate . . . . . . . . . . . . . . . 44 Laser Cavity Reflector . . . . . . . . 44 Laser Component . . . . . . . . . . . . 44 Laser Wave Guide. . . . . . . . . . . . 44 Lift Pin . . . . . . . . . . . . . . . . . . . . 44 Lighting Component. . . . . . . . . . 44 Light-Reflecting Component . . . 44 Lining . . . . . . . . . . . . . . . . . . . . . 44 Abrasion-Resistant . . . . . . . . 44 Furnace . . . . . . . . . . . . . . . . . 45 Protective . . . . . . . . . . . . . . . 45 Liquid Level Sensor Component . 45 Low-Temperature Cofired Ceramic (LTCC) Component . . 45 Low-Voltage Component. . . . . . . 45 Machinable Ceramic . . . . . . . . . 45 Machinable Glass Ceramic . . . . 45 Magnesia Partially Stabilized Zirconia Component . . . . . . . 45 Magnesite Component . . . . . . . . 45 Magnet . . . . . . . . . . . . . . . . . . . . 45

WWW.CERAMICINDUSTRY.COM/CCD

Rare Earth. . . . . . . . . . . . . . . 45 Samarium Cobalt . . . . . . . . . 45 Mechanical Pump Seal. . . . . . . . 45 Medical Component . . . . . . . . . . 45 Membrane . . . . . . . . . . . . . . . . . 45 Battery . . . . . . . . . . . . . . . . . 45 Metal Forming Roll . . . . . . . . . . . 46 Metal Matrix Composite . . . . . . . 46 Meter Bearing . . . . . . . . . . . . . . 46 Mica Component . . . . . . . . . . . . 46 Microporous Insulation. . . . . . . . 46 Microwave Absorber . . . . . . . . . . 46 Microwave Component . . . . . . . . 46 Mill Lining Brick . . . . . . . . . . . . . 46 Monolithic Component . . . . . . . . 46 Muffle, Refractory . . . . . . . . . . . 46 Mullite Component . . . . . . . . . . . 46 Nitride Component . . . . . . . . . . . 46 Nozzle . . . . . . . . . . . . . . . . . . . . . 46 Nozzle Assembly . . . . . . . . . . . . . 46 Nozzle Component . . . . . . . . . . . 46 Nuclear Waste Container . . . . . . 47 Nut . . . . . . . . . . . . . . . . . . . . . . . 47 Open-Celled Foam Component . . 47 Optical Components. . . . . . . . . . 47 Orifice . . . . . . . . . . . . . . . . . . . . 47 Orthodontic Bracket . . . . . . . . . . 47 Orthodontic Component . . . . . . . 47 Oxide Product . . . . . . . . . . . . . . . 47 Paper Processing Element . . . . . 47 Particulate Composite . . . . . . . . 47 Pellet . . . . . . . . . . . . . . . . . . . . . 47 Perlite Brick and Block Insulation . .47 Photovoltaic Casting Crucible . . 47 Piezoelectric . . . . . . . . . . . . . . . . 47 Actuator . . . . . . . . . . . . . . . . 47 Knock Sensor. . . . . . . . . . . . . 47 Sound Component . . . . . . . . . 47 Pipe . . . . . . . . . . . . . . . . . . . . . . 47 Ceramic-Lined . . . . . . . . . . . 47 Insulation . . . . . . . . . . . . . . . 47 Slip-Lining . . . . . . . . . . . . . . 47 Wrap . . . . . . . . . . . . . . . . . . . 47 Piston . . . . . . . . . . . . . . . . . . . . . 47 Plate. . . . . . . . . . . . . . . . . . . . . . 47 Element . . . . . . . . . . . . . . . . . 47 Pusher . . . . . . . . . . . . . . . . . . 47 Plunger. . . . . . . . . . . . . . . . . . . . 48 Porous Ceramic . . . . . . . . . . . . . 48

Master Component Index Porous Plate & Tube . . . . . . . . . . 48 Post . . . . . . . . . . . . . . . . . . . . . . 48 Pouring Cup . . . . . . . . . . . . . . . . 48 Power Supply . . . . . . . . . . . . . . . 48 Power Tube . . . . . . . . . . . . . . . . . 48 Pressure Transducer Component . . 48 Process Crucible . . . . . . . . . . . . 48 Puck, Ring and Assembly . . . . . . 48 Pump Component. . . . . . . . . . . . 48 Quartz and Quartzware . . . . . . . 48 Beaker . . . . . . . . . . . . . . . . . . 48 Flask . . . . . . . . . . . . . . . . . . . 48 Labware . . . . . . . . . . . . . . . . 48 Petrie Dish . . . . . . . . . . . . . . 48 Rod . . . . . . . . . . . . . . . . . . . . 48 Sheet . . . . . . . . . . . . . . . . . . . 48 Test Tube . . . . . . . . . . . . . . . . 49 Tube . . . . . . . . . . . . . . . . . . . 49 Radio Frequency/ Microwave Window . . . . . . . . 49 Radome . . . . . . . . . . . . . . . . . . . 49 Rare Earth Magnet . . . . . . . . . . . 49 Refractories . . . . . . . . . . . . . . . . 49 Alumina . . . . . . . . . . . . . . . . 49 Basic . . . . . . . . . . . . . . . . . . . 49 Cordierite . . . . . . . . . . . . . . . 49 Forehearth . . . . . . . . . . . . . . . 49 High-Alumina . . . . . . . . . . . . 49 Insulating . . . . . . . . . . . . . . . 49 Insulating Firebrick . . . . . . . . 49 Mullite . . . . . . . . . . . . . . . . . . 49 Preformed . . . . . . . . . . . . . . . 49 Silica . . . . . . . . . . . . . . . . . . . 49 Silicon Carbide . . . . . . . . . . . 49 Zircon . . . . . . . . . . . . . . . . . . 50 Zirconia . . . . . . . . . . . . . . . . . 50 Refractory Shape . . . . . . . . . . . . 50 Reinforcement . . . . . . . . . . . . . . 50 Fiber . . . . . . . . . . . . . . . . . . . 50 Particulate/Platelet . . . . . . . . 50 Whisker . . . . . . . . . . . . . . . . . 50 Resistor Carrier for Electronic Assemblies . . . . . . . . . . . . . . 50 Resistor . . . . . . . . . . . . . . . . . . . 50 Thick-Film . . . . . . . . . . . . . . . 50 Resonator . . . . . . . . . . . . . . . . . . 50 Coaxial . . . . . . . . . . . . . . . . . 50 Puck . . . . . . . . . . . . . . . . . . . 50 Ring . . . . . . . . . . . . . . . . . . . . . . 50

Riser Tube . . . . . . . . . . . . . . . . . 50 Rocket Launch System Insulation . . 50 Rocket Thrust Chamber . . . . . . . 50 Rod. . . . . . . . . . . . . . . . . . . . . . . 50 Quartz . . . . . . . . . . . . . . . . . . 50 Roller . . . . . . . . . . . . . . . . . . . . . 50 Sagger . . . . . . . . . . . . . . . . . . . . 50 Sample Holder . . . . . . . . . . . . . . 51 Sand Blast Nozzle Liner . . . . . . . 51 Sapphire Components . . . . . . . . 51 Screen Tile . . . . . . . . . . . . . . . . . 51 Seal . . . . . . . . . . . . . . . . . . . . . . 51 Seal, Ceramic-to-Metal . . . . . . . 51 Seal Face . . . . . . . . . . . . . . . . . . 51 Seal Ring, Rotating . . . . . . . . . . 51 Seat . . . . . . . . . . . . . . . . . . . . . . 51 Semiconductor . . . . . . . . . . . . . . 51 Semiconductor Wafer . . . . . . . . . 51 Carrier . . . . . . . . . . . . . . . . . . 51 Contact Pin . . . . . . . . . . . . . . 51 End Effector . . . . . . . . . . . . . 51 Handler Arm . . . . . . . . . . . . . 51 Polishing Block . . . . . . . . . . . 51 Wafer Rack . . . . . . . . . . . . . . 51 Sensor . . . . . . . . . . . . . . . . . . . . 51 Piezoelectric . . . . . . . . . . . . . 51 Ultrasonic . . . . . . . . . . . . . . . 52 Sensors/Sensor Module, Pyroelectric Infrared . . . . . . . 52 Setter . . . . . . . . . . . . . . . . . . . . . 52 Setter, Ware . . . . . . . . . . . . . . . . 52 Shaft . . . . . . . . . . . . . . . . . . . . . 52 Sheet, Flexible Ceramic . . . . . . . 52 Shelf. . . . . . . . . . . . . . . . . . . . . . 52 Shelf, Kiln . . . . . . . . . . . . . . . . . 52 Sialon . . . . . . . . . . . . . . . . . . . . . 52 Silicide Component . . . . . . . . . . 52 Silicon Carbide . . . . . . . . . . . . . . 52 Component . . . . . . . . . . . . . . 52 Foam Shape . . . . . . . . . . . . . 52 Specialty Shape . . . . . . . . . . 52 Silicon Nitride Component . . . . . 52 Single Crystal Lead Magnesium Niobate/Leat Titanate (PMN-PT) . . . . . . . . . 53 Sleeve. . . . . . . . . . . . . . . . . . . . . 53 Solid Oxide Fuel Cell Component . 53 Spacer . . . . . . . . . . . . . . . . . . . . 53 Spark Plug Boot Insulator . . . . . 53

Sphere, Ceramic. . . . . . . . . . . . . 53 Sputtering Target . . . . . . . . . . . . 53 Standoff Insulator . . . . . . . . . . . 53 Heavy-Duty . . . . . . . . . . . . . . 53 Light-Duty . . . . . . . . . . . . . . . 53 Steatite Component . . . . . . . . . . 53 Stone, Baking . . . . . . . . . . . . . . . 54 Strainer Core . . . . . . . . . . . . . . . 54 Substrate . . . . . . . . . . . . . . . . . . 54 Alumina . . . . . . . . . . . . . . . . 54 Aluminum Nitride . . . . . . . . . 54 Boron Carbide . . . . . . . . . . . . 54 Cryogenic . . . . . . . . . . . . . . . 54 Heater . . . . . . . . . . . . . . . . . . 54 Silicon Carbide . . . . . . . . . . . 54 Superconductor . . . . . . . . . . . 54 Zirconia . . . . . . . . . . . . . . . . . 54 Superconductor Device. . . . . . . . 54 Superconductor Wire . . . . . . . . . 54 Super-Duty Refractory Brick . . . . 54 Susceptor . . . . . . . . . . . . . . . . . . 54 Suspension Insulator . . . . . . . . . 54 Suspension Insulator, Heavy-Duty . . . . . . . . . . . . . . 54 Tank Lining, Ceramic . . . . . . . . . 54 Tape . . . . . . . . . . . . . . . . . . . . . . 54 Tape, Insulating . . . . . . . . . . . . . 54 Target . . . . . . . . . . . . . . . . . . . . . 54 Terminal . . . . . . . . . . . . . . . . . . . 54 Ceramic . . . . . . . . . . . . . . . . 54 Textile . . . . . . . . . . . . . . . . . . . . . 54 Feed Dog . . . . . . . . . . . . . . . . 54 Guide . . . . . . . . . . . . . . . . . . 54 Presser Feet . . . . . . . . . . . . . 54 Thermal Barrier . . . . . . . . . . . . . 54 Thermal Insulation . . . . . . . . . . . 54 Thermal Management System . . 55 Thermal Protection Component . 55 Thermistor . . . . . . . . . . . . . . . . . 55 Thermocouple Block . . . . . . . . . . 55 Thermocouple Protection Tube . . 55 Thick Film Heater . . . . . . . . . . . . 55 Thread Guide . . . . . . . . . . . . . . . 55 Tile . . . . . . . . . . . . . . . . . . . . . . . 55 Tile Setter . . . . . . . . . . . . . . . . . . 55 Titanium Diboride Component . . 55 Tongue-and-Groove Shape . . . . . 55 Transducer . . . . . . . . . . . . . . . . . 55 Piezoelectric . . . . . . . . . . . . . 55

CERAMIC COMPONENTS DIRECTORY ³ 2011

27

Master Component Index Ultrasonic . . . . . . . . . . . . . . . 55 Transfer Ladle . . . . . . . . . . . . . . 55 Transformer . . . . . . . . . . . . . . . . 55 Tube . . . . . . . . . . . . . . . . . . . . . . 55 Lamp . . . . . . . . . . . . . . . . . . . 55 Plasma . . . . . . . . . . . . . . . . . 55 Porous . . . . . . . . . . . . . . . . . . 55 Power . . . . . . . . . . . . . . . . . . 55 Pyrometer Protection . . . . . . . 56 Quartz . . . . . . . . . . . . . . . . . . 56 Radiant . . . . . . . . . . . . . . . . . 56 Refractory . . . . . . . . . . . . . . . 56 Tile Setter . . . . . . . . . . . . . . . 56 Tube Mill Roll . . . . . . . . . . . . . . . 56 Tube Sheet Boiler Ferrule . . . . . . 56 Tubing . . . . . . . . . . . . . . . . . . . . 56 Nuclear . . . . . . . . . . . . . . . . . 56 Thin-Wall. . . . . . . . . . . . . . . . 56 Tundish . . . . . . . . . . . . . . . . . . . 56 Tungsten Carbide Component . . 56 Ultrasonic Component . . . . . . . . 56 Vacuum Chuck . . . . . . . . . . . . . . 56 Valve . . . . . . . . . . . . . . . . . . . . . 56 Chemical . . . . . . . . . . . . . . . . 56 Medical . . . . . . . . . . . . . . . . . 56 Valve Seat . . . . . . . . . . . . . . . . . 56 Valve Stem . . . . . . . . . . . . . . . . . 56 Wafer, Diffusion Source; Boron Nitride . . . . . . . . . . . . . 56 Ware Tray . . . . . . . . . . . . . . . . . . 56 Washer . . . . . . . . . . . . . . . . . . . . 56 Water Filtration Component . . . . 57 Wear Pad . . . . . . . . . . . . . . . . . . 57 Wear Plate . . . . . . . . . . . . . . . . . 57 Wear-Resistant Component . . . . 57 Weld Location Pin. . . . . . . . . . . . 57 Wire Nut . . . . . . . . . . . . . . . . . . . 57 Yttria-Stabilized Zirconia Component . . . . . . . . . . . . . . 57 Yttrium Oxide Component . . . . . 57 YTZP Blank . . . . . . . . . . . . . . . . . 57 Zirconia Component . . . . . . . . . . 57

28

Zirconia Oxide Component . . . . . 58 Zirconia-Toughened Alumina Component . . . . . . . . . . . . . . 58

PROFESSIONAL SERVICES Advanced Ceramics . . . . . . . . . . 58 Aluminum Oxide Machining . . . . 58 Assembly . . . . . . . . . . . . . . . . . . 58 Assembly, Clean-Room. . . . . . . . 58 Bonding . . . . . . . . . . . . . . . . . . . 58 Boron Nitride Machining . . . . . . 58 Brazing. . . . . . . . . . . . . . . . . . . . 59 Cleaning/Surface Preparation . . 59 CNC . . . . . . . . . . . . . . . . . . . . . . 59 Milling . . . . . . . . . . . . . . . . . . 59 Swiss Screw Machining. . . . . 59 Turning . . . . . . . . . . . . . . . . . 59 Coating . . . . . . . . . . . . . . . . . . . 59 Coating Services . . . . . . . . . . . . 59 Consultants . . . . . . . . . . . . . . . . 59 Contractual . . . . . . . . . . . . . . . . 59 Curing . . . . . . . . . . . . . . . . . . . . 59 Design . . . . . . . . . . . . . . . . . . . . 59 Education . . . . . . . . . . . . . . . . . . 59 Engineering, Custom Fabrication. . . . . . . . 59 Extrusion . . . . . . . . . . . . . . . . . . 59 Feasibility Studies . . . . . . . . . . . 59 Fixturing . . . . . . . . . . . . . . . . . . . 59 Formulation Development, Ceramic Coatings . . . . . . . . . 59 Glassblowing, Technical. . . . . . . 59 Grinding . . . . . . . . . . . . . . . . . . . 60 Centerless . . . . . . . . . . . . . . . 60 Custom . . . . . . . . . . . . . . . . . 60 Cylindrical . . . . . . . . . . . . . . . 60 Fine . . . . . . . . . . . . . . . . . . . . 60 Heat Treating . . . . . . . . . . . . . . . 60 Honing . . . . . . . . . . . . . . . . . . . . 60 Honing, Flat . . . . . . . . . . . . . . . . 60 Injection Molding . . . . . . . . . . . . 60 Laboratory Testing . . . . . . . . . . . 60

WWW.CERAMICINDUSTRY.COM/CCD

Lapping . . . . . . . . . . . . . . . . . . . 61 Flat . . . . . . . . . . . . . . . . . . . . 61 Production . . . . . . . . . . . . . . . 61 Lapping and Polishing . . . . . . . . 61 Lasering . . . . . . . . . . . . . . . . . . . 61 Laser Cutting . . . . . . . . . . . . 61 Laser Drilling . . . . . . . . . . . . 62 Laser Engraving . . . . . . . . . . 62 Laser Machining . . . . . . . . . . 62 Laser Marking . . . . . . . . . . . . 62 Laser Micromachining. . . . . . 62 Laser Scribing . . . . . . . . . . . . 62 Lead/Cadmium Testing . . . . . . . 62 Machining . . . . . . . . . . . . . . . . . 62 Market Research . . . . . . . . . . . . 62 Materials Analysis . . . . . . . . . . . 62 Metallization . . . . . . . . . . . . . . . 62 Packaging, Ceramic . . . . . . . . . . 62 Plasma Surface Treatment . . . . . 62 Plating . . . . . . . . . . . . . . . . . . . . 62 Prototyping . . . . . . . . . . . . . . . . . 62 Quartz Engineering, Custom . . . 62 Quartz Fabrication, Custom . . . . 62 Rapid Prototyping . . . . . . . . . . . 62 Research and Development . . . . 63 Sealing . . . . . . . . . . . . . . . . . . . . 63 Sealing, Ceramic-to-Metal . . . . . 63 Silicon Carbide Machining . . . . . 63 Silicon Nitride Machining . . . . . . 63 Standards for Materials . . . . . . . 63 Tape Casting . . . . . . . . . . . . . . . 63 Technology Transfer & Licensing . . . . . . . . . . . . . . . 63 Testing . . . . . . . . . . . . . . . . . . . . 63 Tooling . . . . . . . . . . . . . . . . . . . . 63 Tube Grinding . . . . . . . . . . . . . . . 63 Tube Polishing . . . . . . . . . . . . . . 63 Tumble Coating . . . . . . . . . . . . . 63 Ultrasonic Machining . . . . . . . . . 63 Wearproofing . . . . . . . . . . . . . . . 63 Wearproofing, Tungsten Carbide . . . 63 Website . . . . . . . . . . . . . . . . . . . 63

Trade Names A9468—Ceramco Inc.

Lightning Lube—Boca Bearing Company

A96—Ceramco Inc.

Macor®—Astro-Met Inc.

A9968—Ceramco Inc.

MoxoSurface™—MemPro Ceramics Corporation

A998—Ceramco Inc.

MRI®—Metsch Refractories Inc.

Accuflect—Accuratus Ceramic Corporation

MUL6—Ceramco Inc.

ADVANCER®—Saint-Gobain Ceramic Materials

N-DURANCE™—Saint-Gobain Ceramic Materials

ALTRON®—Blasch Precision Ceramics

NanOxide®—TPL Inc.

ALUNDEX™—Saint-Gobain Ceramic Materials

nCATfiber™—MemPro Ceramics Corporation

ALUNDUM®—Saint-Gobain Ceramic Materials

nCeramic™—MemPro Ceramics Corporation

Amalox 68®—Astro-Met Inc.

NITRON®—Blasch Precision Ceramics

Amalox 87®—Astro-Met Inc.

NoxFox™—MemPro Ceramics Corporation

Amzirox 86®—Astro-Met Inc.

NSL Analytical—NSL Analytical Services

ARtuff Fracture Resistant Ceramics—

OXYTRON®—Blasch Precision Ceramics

Advanced Composite Materials LLC

Poly Max—Heatron Inc.

Axner Pottery Supply—Thorley Refractories Inc.

PROTECT TILES™—Superior Graphite

Black Widow—Crystallume Eng. Diamond Prod.

Purebide—Morgan AM&T

Bluestone Lighting—Heatron Inc.

Purebon—Morgan AM&T

Boca Bearing Company—Boca Bearing Company

Pyro-Bloc®—Morgan Thermal Ceramics

Cerablanket®—Morgan Thermal Ceramics

READE—Reade Advanced Materials

CERAMtuff Fracture and Wear Resistant Ceramics and Ceramic Blends—Advanced Composite Materials LLC

SCProbond C®—Silicon Carbide Products SCProbond N®—Silicon Carbide Products

Cerox®—Morgan Thermal Ceramics

SCProbond R®—Silicon Carbide Products

CRYSTAR® 2000—Saint-Gobain Ceramic Materials

Silar Microwave Heatable Ceramic Products—

DCC—Crystallume Eng. Diamond Prod.

Advanced Composite Materials LLC

Durox—Materion Ceramics Inc.

Silar Silicon Carbide Whiskers—Advanced Composite

Elpor—Heatron Inc.

Materials LLC SootGrabber™—MemPro Ceramics Corporation

Heatflex Flexible heaters—Heatron Inc. Heatrod—Heatron Inc.

Superwool®—Morgan Thermal Ceramics

HEXIM™—ENrG Incorporated

TaoFibre—Intersource USA Inc.

HexWall—Blasch Precision Ceramics

Therma Guard—Heatron Inc.

InVinCer by Blasch®—Blasch Precision Ceramics

Therma Mold—Heatron Inc.

ISAboard—Insulation Specialties of America

Thermolox 995—Materion Ceramics Inc.

ISAform—Insulation Specialties of America

Thin E-Strate™—ENrG Incorporated

ISAglue—Insulation Specialties of America

ThinESC™—ENrG Incorporated

K-IFB®—Morgan Thermal Ceramics

Thorley Refractories®—Thorley Refractories Inc.

Kaocrete®—Morgan Thermal Ceramics

ThunderBolt—Crystallume Eng. Diamond Prod.

Kaolite®—Morgan Thermal Ceramics

Tri-Mor®—Morgan Thermal Ceramics

Kaowool®—Morgan Thermal Ceramics

Trust-Technology-Turnaround—NSL Analytical Services

Laguna Clay Company—Thorley Refractories Inc.

Valcor®—Morgan Thermal Ceramics

Lightning—Crystallume Eng. Diamond Prod.

ZTA - 96®—Astro-Met Inc.

Lightning Bearing Technology—Boca Bearing Company CERAMIC COMPONENTS DIRECTORY ³ 2011

29

Component Listings ACOUSTICAL PRODUCT APC International Ltd., American Piezo Ceramics HAI Advanced Material Specialists Inc.

ACTUATOR APC International Ltd., American Piezo Ceramics

AGGREGATE, INSULATING Reade Advanced Materials

ALUMINA COMPONENT ¨ ¨

¨ ¨ ¨ ¨

¨

¨ ¨

Accuratus Ceramic Corporation AdTech Ceramics AdValue Technology LLC Advanced Ceramic Technology Akron Porcelain & Plastics Co. Anderman Ceramics APC International Ltd., American Piezo Ceramics Astro-Met Inc. Blasch Precision Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics Bullen Ceradyne Inc. Ceramaterials Ceramco Inc. Ceramic Solutions Inc. Ceramic Systems Inc. CoorsTek Inc., International Headquarters Cotronics Corp. Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. Goodfellow Corp. Heatron Inc. Holland Mfg. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials O’Keefe Ceramics Pacific Technology Exchange Quartzite Processing Inc. Reade Advanced Materials SMAHT Ceramics Inc. Small Precision Tools Superior Technical Ceramics Corp. Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

ALUMINUM NITRIDE COMPONENT Accuratus Ceramic Corporation AdTech Ceramics

30

Advanced Ceramic Technology ¨ Bullen ¨ Ceradyne Inc. Ferro-Ceramic Grinding Inc. Goodfellow Corp. Heatron Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components MemPro Ceramics Corporation ¨ O’Keefe Ceramics Reade Advanced Materials ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

ANODE

ALUMINUM OXIDE COMPONENT

Dielectric

¨ ¨

¨ ¨ ¨ ¨

¨

¨ ¨

Accuratus Ceramic Corporation AdTech Ceramics AdValue Technology LLC Advanced Ceramic Technology Akron Porcelain & Plastics Co. APC International Ltd., American Piezo Ceramics Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics Bullen Ceradyne Inc. Ceramaterials Ceramco Inc. Ceramic Solutions Inc. Ceramic Systems Inc. CoorsTek Inc., International Headquarters Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. Goodfellow Corp. HAI Advanced Material Specialists Inc. Hoover Precision Products Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components MemPro Ceramics Corporation Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials O’Keefe Ceramics Reade Advanced Materials Refractron Technologies Corp. SMAHT Ceramics Inc. Small Precision Tools Superior Technical Ceramics Corp. Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

WWW.CERAMICINDUSTRY.COM/CCD

Anderman Ceramics HAI Advanced Material Specialists Inc. ¨ O’Keefe Ceramics Reade Advanced Materials ¨ Technical Products Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

ANTENNA ¨ CoorsTek Inc., International Headquarters TPL Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

Chip Dielectric TPL Inc. Quartzite Processing Inc. TPL Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

ANTENNA STRAIN INSULATOR ¨ Akron Porcelain & Plastics Co. Brim Electronics Inc.

ATTENUATOR Accuratus Ceramic Corporation Quartzite Processing Inc.

AUTOMOTIVE COMPONENT ¨ Akron Porcelain & Plastics Co. APC International Ltd., American Piezo Ceramics ¨ Bullen ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. Heatron Inc.

BALL ¨ Akron Porcelain & Plastics Co. ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Hoover Precision Products Machined Ceramics Inc. Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials Zircoa Inc.

BALL AND SEAT CHECK VALVE ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters

Component Listings BALL AND SEAT CHECK VALVE ASSEMBLY ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division

BALL AND SOCKET BEAD Anderman Ceramics Brim Electronics Inc. Du-Co Ceramics Co. International Ceramic Engineering, Advanced Ceramics Division

BALL VALVE COMPONENT Accuratus Ceramic Corporation Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. Hoover Precision Products International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Zircoa Inc.

BEAD ¨ Ceramic Solutions Inc. Du-Co Ceramics Co. Esprix Technologies ¨ Glen Mills Inc. Hoover Precision Products International Ceramic Engineering, Advanced Ceramics Division Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials Superior Quartz Products Inc., Ceramics & Glass Machinery Division Zircoa Inc.

BEAD, FISHSPINE Anderman Ceramics ¨ Ceramic Solutions Inc. Du-Co Ceramics Co. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Keith Company Machined Ceramics Inc. Recco Furnaces Superior Technical Ceramics Corp.

BEARING ¨ AdValue Technology LLC Astro-Met Inc. Boca Bearing Company ¨ Ceradyne Inc.

Hoover Precision Products International Ceramic Engineering, Advanced Ceramics Division Morgan AM&T ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

Superior Technical Ceramics Corp. Zircoa Inc.

BOLT Ceramco Inc. Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components Superior Technical Ceramics Corp.

BEARING COMPONENT Astro-Met Inc. Boca Bearing Company ¨ Ceradyne Inc. Hoover Precision Products International Ceramic Engineering, Advanced Ceramics Division ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Superior Technical Ceramics Corp. Zircoa Inc.

BELL JAR Goodfellow Corp.

BERYLLIA COMPONENT Accuratus Ceramic Corporation MarkeTech International Inc., Engineered Ceramic Components Materion Ceramics Inc. Reade Advanced Materials

BIOCERAMIC, DENTAL Astro-Met Inc. ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. Insaco ¨ O’Keefe Ceramics ¨ Small Precision Tools

BORIDE COMPONENT International Ceramic Engineering, Advanced Ceramics Division Reade Advanced Materials

BORON CARBIDE COMPONENT Advanced Ceramic Technology ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. HAI Advanced Material Specialists Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics Reade Advanced Materials ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products ¨ Technical Products Inc.

BORON NITRIDE COMPONENT ¨ ¨

BIOCERAMIC, MEDICAL Astro-Met Inc. ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco ¨ O’Keefe Ceramics ¨ Small Precision Tools ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

¨ ¨

Accuratus Ceramic Corporation Advanced Ceramic Technology Ceradyne Inc. CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. Heatron Inc. International Ceramic Engineering, Advanced Ceramics Division MemPro Ceramics Corporation O’Keefe Ceramics Reade Advanced Materials Superior Technical Ceramics Corp. Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

BRICK

BLANK Anderman Ceramics Astro-Met Inc. ¨ Ceradyne Inc. Ceramco Inc. Ceramic Systems Inc. Ferro-Ceramic Grinding Inc. Refractron Technologies Corp. SMAHT Ceramics Inc.

Acid Resisting Intersource USA Inc.

Basic Intersource USA Inc. Keith Company Recco Furnaces

CERAMIC COMPONENTS DIRECTORY ³ 2011

31

Component Listings Fireclay Intersource USA Inc. Keith Company Morgan Thermal Ceramics Recco Furnaces

High-Alumina Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Intersource USA Inc. Keith Company Machined Ceramics Inc. Morgan Thermal Ceramics Recco Furnaces ¨ Saint-Gobain Ceramic Materials, High Performance Refractories ¨ Technical Products Inc.

Load-Bearing Intersource USA Inc.

Shape ¨ CoorsTek Inc., International Headquarters Intersource USA Inc. Keith Company Recco Furnaces

Cup Accuratus Ceramic Corporation Du-Co Ceramics Co. ¨ Technical Products Inc.

Shoulder Accuratus Ceramic Corporation Astro-Met Inc. Brim Electronics Inc. Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. Superior Technical Ceramics Corp. ¨ Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

CAM ROLLER Accuratus Ceramic Corporation ¨ Ceradyne Inc. Superior Technical Ceramics Corp. Zircoa Inc.

CAPACITOR ¨ AdValue Technology LLC TPL Inc.

High Energy Density

Silica Ceramic Systems Inc. Intersource USA Inc. Morgan Thermal Ceramics

BURNER BARREL LINER Ceramic Systems Inc. Silicon Carbide Products

BURNER PORT Ceramic Systems Inc. Thorley Refractories Inc., A Division of Laguna Clay Co.

BUSHING Anderman Ceramics Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics Brim Electronics Inc. ¨ Ceradyne Inc. Ceramco Inc. Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components Morgan AM&T Refractron Technologies Corp. Superior Quartz Products Inc., Ceramics & Glass Machinery Division

32

Wesgo/Duramic Products, Morgan Technical Ceramics Zircoa Inc.

TPL Inc.

High-Voltage TPL Inc.

CARBIDE COMPONENT Accuratus Ceramic Corporation ¨ Ceradyne Inc. Ceramaterials Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Elizabeth Carbide Components Ferro-Ceramic Grinding Inc. HAI Advanced Material Specialists Inc. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components MemPro Ceramics Corporation Reade Advanced Materials ¨ Small Precision Tools

CARBON COMPONENT Ceramaterials ¨ CoorsTek Inc., International Headquarters Morgan AM&T Reade Advanced Materials

WWW.CERAMICINDUSTRY.COM/CCD

CASTING Refractory ¨ AdValue Technology LLC Anderman Ceramics Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Holland Mfg. Intersource USA Inc. Morgan Thermal Ceramics Silicon Carbide Products Thorley Refractories Inc., A Division of Laguna Clay Co.

Wear Resistant ¨ AdValue Technology LLC Advanced Ceramic Technology Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Silicon Carbide Products ¨ Technical Products Inc.

CATALYST MemPro Ceramics Corporation

CATHODE ¨ Ceradyne Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

CATHODE ASSEMBLY ¨ Ceradyne Inc.

Hollow ¨ Ceradyne Inc.

Value-Added ¨ Ceradyne Inc.

CATHODE, DISPENSER ¨ Ceradyne Inc.

CELLULAR TELEPHONE RESONATOR CAVITY STANDOFF Superior Technical Ceramics Corp.

CERAMIC Armor ¨ Akron Porcelain & Plastics Co. Astro-Met Inc. Cancarb Ltd. ¨ Ceradyne Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Morgan AM&T ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products ¨ Superior Graphite, Advanced Materials

Component Listings Superior Technical Ceramics Corp.

Armor Tile ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. ¨ Superior Graphite, Advanced Materials

Castable Cancarb Ltd. Ceramic Systems Inc. International Ceramic Engineering, Advanced Ceramics Division Keith Company Recco Furnaces Silicon Carbide Products Thorley Refractories Inc., A Division of Laguna Clay Co. TPL Inc.

Fiber Product Cancarb Ltd. Ceramaterials Cotronics Corp. Goodfellow Corp. Insulation Specialties of America Intersource USA Inc. Keith Company KMI Refractories MemPro Ceramics Corporation Reade Advanced Materials Recco Furnaces

Flexible ENrG Incorporated MemPro Ceramics Corporation

Foil ENrG Incorporated

High-Temperature Accuratus Ceramic Corporation AdTech Ceramics ¨ AdValue Technology LLC Advanced Ceramic Technology ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics Cancarb Ltd. ¨ Ceradyne Inc. Ceramaterials

Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Cotronics Corp. ENrG Incorporated Ferro-Ceramic Grinding Inc. Goodfellow Corp. Heatron Inc. Holland Mfg. Hoover Precision Products Industrial Ceramic Products Inc. Insulation Specialties of America International Ceramic Engineering, Advanced Ceramics Division Keith Company Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components Materion Ceramics Inc. MemPro Ceramics Corporation Metsch Refractories Inc. Morgan Thermal Ceramics ¨ O’Keefe Ceramics Pacific Technology Exchange Recco Furnaces ¨ Saint-Gobain Ceramic Materials, High Performance Refractories ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Silicon Carbide Products SMAHT Ceramics Inc. ¨ Small Precision Tools ¨ Superior Graphite, Advanced Materials Superior Technical Ceramics Corp. ¨ Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics Zircoa Inc.

Machinable Accuratus Ceramic Corporation Advanced Ceramic Technology ¨ Akron Porcelain & Plastics Co. Astro-Met Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters

Cotronics Corp. Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. Goodfellow Corp. Hoover Precision Products International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics SMAHT Ceramics Inc. ¨ Superior Graphite, Advanced Materials Superior Quartz Products Inc., Ceramics & Glass Machinery Division Superior Technical Ceramics Corp. ¨ Technical Products Inc. TPL Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

Media ¨ Akron Porcelain & Plastics Co. ¨ CoorsTek Inc., International Headquarters ¨ Glen Mills Inc. MemPro Ceramics Corporation Reade Advanced Materials ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

Plate Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. ¨ Ceradyne Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters ENrG Incorporated Ferro-Ceramic Grinding Inc. Goodfellow Corp. Holland Mfg. International Ceramic Engineering, Advanced Ceramics Division Keith Company Machined Ceramics Inc.

SiC Armor Tiles for Lightweight Solutions Various sizes & shapes www.superiorgraphite.com CERAMIC COMPONENTS DIRECTORY ³ 2011

33

Component Listings ¨ ¨

¨

¨

MarkeTech International Inc., Engineered Ceramic Components Metsch Refractories Inc. O’Keefe Ceramics Recco Furnaces Refractron Technologies Corp. Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Sunrock Ceramics Co. Superior Graphite, Advanced Materials Superior Quartz Products Inc., Ceramics & Glass Machinery Division Superior Technical Ceramics Corp. Technical Products Inc. TPL Inc. Zircoa Inc.

Preform Advanced Ceramic Technology Astro-Met Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. Holland Mfg. Metsch Refractories Inc. Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials ¨ Technical Products Inc. Zircoa Inc.

CERMET COMPONENT Reade Advanced Materials ¨ Small Precision Tools

CHAMBER DOME MarkeTech International Inc., Engineered Ceramic Components

CHUCK Astro-Met Inc. ¨ Bullen Ceramaterials Ferro-Ceramic Grinding Inc. ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products SMAHT Ceramics Inc. Superior Technical Ceramics Corp. ¨ Technical Products Inc.

CIRCULATOR Advanced Ceramic Technology ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

CLAMP RING Goodfellow Corp.

34

¨ Technical Products Inc.

COMPOSITE Carbon-Carbon Cancarb Ltd. Ceramaterials Goodfellow Corp.

Ceramic-Ceramic Advanced Composite Materials LLC Ceramaterials Ceramic Systems Inc. Ferro-Ceramic Grinding Inc. Goodfellow Corp. ¨ Technical Products Inc.

Ceramic Matrix Advanced Composite Materials LLC ¨ Bullen Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco MemPro Ceramics Corporation ¨ Superior Graphite, Advanced Materials

Ceramic Matrix, Continuous Fiber Reinforced Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco

Ceramic Matrix, Discontinuous Whisker Reinforced Advanced Composite Materials LLC Cancarb Ltd. Ceramaterials Goodfellow Corp. Insaco

Ceramic Matrix, Whisker Reinforced Advanced Composite Materials LLC Cancarb Ltd. Goodfellow Corp. Insaco

Ceramic-Metal Anderman Ceramics ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division ¨ Superior Graphite, Advanced Materials

Intermetallic Reade Advanced Materials

COMPOSITE PANEL Goodfellow Corp. TPL Inc.

WWW.CERAMICINDUSTRY.COM/CCD

COMPUTER TAPE GUIDE Machined Ceramics Inc.

CONTROLLED RESISTIVITY COMPONENT ¨ Akron Porcelain & Plastics Co.

CONVEYOR TILE Anderman Ceramics ¨ Ceradyne Inc. Ceramic Systems Inc.

CORDIERITE COMPONENT ¨ Akron Porcelain & Plastics Co. Anderman Ceramics ¨ Ceramic Solutions Inc. Du-Co Ceramics Co. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Keith Company MemPro Ceramics Corporation Metsch Refractories Inc. Reade Advanced Materials Recco Furnaces

CORE, INVESTMENT CASTING ¨ Akron Porcelain & Plastics Co. Ceramco Inc. Ceramic Systems Inc.

COVER PLATE ¨ AdValue Technology LLC Advanced Ceramic Technology Astro-Met Inc. Industrial Ceramic Products Inc. Metsch Refractories Inc.

CRUCIBLE ¨ AdValue Technology LLC ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Astro-Met Inc. Blasch Precision Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics Cancarb Ltd. ¨ Ceradyne Inc. Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. Holland Mfg. Industrial Ceramic Products Inc. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components

Component Listings Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials Morgan Thermal Ceramics ¨ Saint-Gobain Ceramic Materials, High Performance Refractories Silicon Carbide Products Superior Technical Ceramics Corp. Zircoa Inc.

Assay ¨ AdValue Technology LLC Anderman Ceramics Holland Mfg. Morgan Thermal Ceramics

Fused Silica ¨ AdValue Technology LLC Anderman Ceramics ¨ Ceradyne Inc. Ceramic Systems Inc. Goodfellow Corp. Holland Mfg. International Ceramic Engineering, Advanced Ceramics Division Morgan Thermal Ceramics

Goodfellow Corp. Holland Mfg. Morgan Thermal Ceramics Silicon Carbide Products

CRUCIBLE LINER, DISPOSABLE Anderman Ceramics Ceramco Inc. Holland Mfg. Industrial Ceramic Products Inc. Insulation Specialties of America International Ceramic Engineering, Advanced Ceramics Division Kurt J. Lesker Company

CRYSTAL APC International Ltd., American Piezo Ceramics Holland Mfg.

MarkeTech International Inc., Engineered Ceramic Components Reade Advanced Materials

CUSTOM COMPONENT Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology ¨ Akron Porcelain & Plastics Co. Anderman Ceramics APC International Ltd., American Piezo Ceramics Astro-Met Inc. ¨ Bullen ¨ Ceradyne Inc. Ceramaterials Ceramco Inc. ¨ Ceramic Solutions Inc. ENrG Incorporated Ferro-Ceramic Grinding Inc.

Quartz ¨ AdValue Technology LLC Anderman Ceramics Ceramic Systems Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials

Refractory ¨ AdValue Technology LLC ¨ Akron Porcelain & Plastics Co. Anderman Ceramics ¨ Ceramic Solutions Inc.

Alumina xFused Quartz xZirconia Ceramic Components for high-temperature, chemical and wear-resistant applications:

Crucibles xTubes xPlates & Disks xCustom Components Sample Pans for Thermal Analysis ADVALUE TECHNOLOGY 3470 S. Dodge Blvd.,Tucson, AZ 85713 Tel: 520-514-1100 x Fax: 520-747-4024 [email protected] x www.advaluetech.com

24 hour Shipment of Many In-stock Standard Sizes Custom Fabrication for Special Requests CERAMIC COMPONENTS DIRECTORY ³ 2011

35

Component Listings Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components MemPro Ceramics Corporation Metsch Refractories Inc. Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials Quartzite Processing Inc. Refractron Technologies Corp. ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Superior Technical Ceramics Corp. Thorley Refractories Inc., A Division of Laguna Clay Co. Zircoa Inc.

CUTTERS AND KNIFE ¨ AdValue Technology LLC Advanced Ceramic Technology Astro-Met Inc. Ceramco Inc. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components ¨ Small Precision Tools

CYLINDER LINER PREFORM Astro-Met Inc. Zircoa Inc.

CYLINDRICAL COMPONENT, CUSTOM Accuratus Ceramic Corporation Advanced Ceramic Technology Anderman Ceramics APC International Ltd., American Piezo Ceramics Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics Ceramco Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics Silicon Carbide Products SMAHT Ceramics Inc. Superior Technical Ceramics Corp. Thorley Refractories Inc., A Division of Laguna Clay Co. Wesgo/Duramic Products, Morgan Technical Ceramics Zircoa Inc.

DENTAL COMPONENT CUTTING BIT Crystallume Eng. Diamond Prod.

CUTTING TOOL Advanced Composite Materials LLC Ceramic Systems Inc. Crystallume Eng. Diamond Prod. International Ceramic Engineering, Advanced Ceramics Division

CUTTING TOOL BLANK Advanced Composite Materials LLC ¨ Ceradyne Inc. Ceramic Systems Inc.

CYLINDER Accuratus Ceramic Corporation Advanced Ceramic Technology Anderman Ceramics APC International Ltd., American Piezo Ceramics Astro-Met Inc. Ceramco Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division Silicon Carbide Products Superior Technical Ceramics Corp.

36

Astro-Met Inc. ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. Refractron Technologies Corp.

DEWATERING FOIL ¨ Ceradyne Inc.

DIE

¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

DIELECTRIC RESONATOR Quartzite Processing Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

DIESEL ENGINE EXHAUST VALVE ¨ Ceradyne Inc. Refractron Technologies Corp.

DIFFUSION FURNACE COMPONENT Accuratus Ceramic Corporation Anderman Ceramics ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division

DISC ¨ AdValue Technology LLC Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. ¨ Ceramic Solutions Inc. ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division Superior Technical Ceramics Corp. Zircoa Inc.

Valve Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc.

DOOR GASKET Intersource USA Inc.

DOOR SEAL Astro-Met Inc. International Ceramic Engineering, Advanced Ceramics Division Refractron Technologies Corp. Thorley Refractories Inc., A Division of Laguna Clay Co. Zircoa Inc.

Intersource USA Inc.

DUMMY SEMICONDUCTOR WAFER ¨ Ceradyne Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division

DIELECTRIC

DUPLEXER

Accuratus Ceramic Corporation APC International Ltd., American Piezo Ceramics ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Quartzite Processing Inc. TPL Inc.

¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

WWW.CERAMICINDUSTRY.COM/CCD

ELECTRIC FUEL PUMP COMPONENT ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Heatron Inc. International Ceramic Engineering, Advanced Ceramics Division

Component Listings ELECTRICAL INSULATION Accuratus Ceramic Corporation ¨ Akron Porcelain & Plastics Co. Brim Electronics Inc. Ceramco Inc. Ceramic Systems Inc. Du-Co Ceramics Co. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Metsch Refractories Inc. Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials SMAHT Ceramics Inc. Zircoa Inc.

ELECTRICAL PORCELAIN INSULATOR ¨ Akron Porcelain & Plastics Co. Brim Electronics Inc. Ceramco Inc. Ceramic Systems Inc. Du-Co Ceramics Co. Goodfellow Corp. Heatron Inc. Metsch Refractories Inc.

ELECTROCONDUCTIVE COMPONENT Goodfellow Corp. MemPro Ceramics Corporation

ELECTRODE HAI Advanced Material Specialists Inc. International Ceramic Engineering, Advanced Ceramics Division

ELECTRODE COLLAR Ceramco Inc. International Ceramic Engineering, Advanced Ceramics Division

ELECTRODISCHARGED MACHINABLE (EDM) COMPONENT ¨ Small Precision Tools

ELECTRONIC CIRCUITRY SUBSTRATE Accuratus Ceramic Corporation

END EFFECTOR ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division

ENGINE COMPONENT Accuratus Ceramic Corporation

Astro-Met Inc. ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics UCM Advanced Ceramics GmbH, A member of IMERYS Zircoa Inc.

EROSION SLEEVE Accuratus Ceramic Corporation Astro-Met Inc. Ceramaterials Ceramco Inc. International Ceramic Engineering, Advanced Ceramics Division Refractron Technologies Corp.

EVAPORATION BOAT Anderman Ceramics ¨ Ceradyne Inc. Ceramco Inc. ¨ Ceramic Solutions Inc. Goodfellow Corp. Kurt J. Lesker Company

FASTENER Ceramco Inc. International Ceramic Engineering, Advanced Ceramics Division Superior Technical Ceramics Corp.

FERRITE & FERROMAGNETIC Advanced Ceramic Technology Ferro-Ceramic Grinding Inc. Goodfellow Corp. Quartzite Processing Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

FERRITE CORE Ferro-Ceramic Grinding Inc. Quartzite Processing Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

FIBER OPTIC Ferrule Ceramco Inc. International Ceramic Engineering, Advanced Ceramics Division

Sleeve Ceramco Inc. International Ceramic Engineering, Advanced Ceramics Division

Splicer Accuratus Ceramic Corporation Ceramco Inc.

FILTER Anderman Ceramics Ceramaterials Industrial Ceramic Products Inc. Intersource USA Inc. Quartzite Processing Inc. Refractron Technologies Corp. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

Ceramic Reticulated Foam Anderman Ceramics Blasch Precision Ceramics Ceramaterials Goodfellow Corp. Holland Mfg. Intersource USA Inc.

Dielectric Quartzite Processing Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

FIXTURE, GRAPHITE International Ceramic Engineering, Advanced Ceramics Division

FLOOR BRICK, KILN Holland Mfg. Intersource USA Inc. Keith Company Morgan Thermal Ceramics Recco Furnaces

FLUE LINER Insulation Specialties of America Keith Company KMI Refractories Recco Furnaces Silicon Carbide Products

FLUID METER COMPONENT Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Insaco ¨ Small Precision Tools Superior Technical Ceramics Corp. Wesgo/Duramic Products, Morgan Technical Ceramics

FORMING DIE Accuratus Ceramic Corporation Astro-Met Inc. Zircoa Inc.

FORMING DIE, ALUMINUM Accuratus Ceramic Corporation Astro-Met Inc.

FORSTERITE COMPONENT Advanced Ceramic Technology Du-Co Ceramics Co.

CERAMIC COMPONENTS DIRECTORY ³ 2011

37

Component Listings International Ceramic Engineering, Advanced Ceramics Division

FOUNDRY SPECIALTIES ¨ Akron Porcelain & Plastics Co. Ceramic Systems Inc. Industrial Ceramic Products Inc. Keith Company KMI Refractories Metsch Refractories Inc.

FUEL CELL International Ceramic Engineering, Advanced Ceramics Division Morgan Thermal Ceramics

Component Accuratus Ceramic Corporation Anderman Ceramics Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters ENrG Incorporated Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components MemPro Ceramics Corporation ¨ O’Keefe Ceramics Refractron Technologies Corp. UCM Advanced Ceramics GmbH, A member of IMERYS

Insulation ENrG Incorporated Morgan Thermal Ceramics

FUEL PUMP ROLLER Accuratus Ceramic Corporation ¨ Ceradyne Inc. International Ceramic Engineering, Advanced Ceramics Division

FURNACE Collar Ceramco Inc. Superior Technical Ceramics Corp.

Component ¨ AdValue Technology LLC Anderman Ceramics Ceramco Inc. ¨ Ceramic Solutions Inc. ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Keith Company

38

MarkeTech International Inc., Engineered Ceramic Components Recco Furnaces ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products SMAHT Ceramics Inc. Superior Technical Ceramics Corp. Thorley Refractories Inc., A Division of Laguna Clay Co. Zircoa Inc.

GAUGE BLOCK Astro-Met Inc. Thorley Refractories Inc., A Division of Laguna Clay Co. Zircoa Inc.

GLASS International Ceramic Engineering, Advanced Ceramics Division Quartzite Processing Inc. Superior Quartz Products Inc., Ceramics & Glass Machinery Division

Disc Anderman Ceramics Ceramco Inc. ¨ Ceramic Solutions Inc. Superior Technical Ceramics Corp.

Pipe Hanger Ceramco Inc.

Roll Bolt Technical Ceramics, Morgan Technical Ceramics ¨ Ceradyne Inc. ¨ Ceramic Solutions Inc. ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

Borosilicate Goodfellow Corp. Quartzite Processing Inc.

Rod ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Superior Quartz Products Inc., Ceramics & Glass Machinery Division

Technical

Ceramaterials ¨ Ceramic Solutions Inc. Intersource USA Inc.

Accuratus Ceramic Corporation ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division

FUSED SILICA BRICK

GLASS-CERAMIC COMPONENT

FUSED CAST REFRACTORY COMPONENT

Ceramic Systems Inc.

FUSED SILICA COMPONENT Accuratus Ceramic Corporation ¨ AdValue Technology LLC ¨ Akron Porcelain & Plastics Co. Anderman Ceramics ¨ Ceradyne Inc. Ceramic Systems Inc. Ferro-Ceramic Grinding Inc. Goodfellow Corp. Industrial Ceramic Products Inc. International Ceramic Engineering, Advanced Ceramics Division Quartzite Processing Inc. Reade Advanced Materials

FUSED SILICA TOOL ¨ Ceradyne Inc.

GAS DISTRIBUTION PLATE ¨ Ceradyne Inc.

GAUGE Astro-Met Inc. Thorley Refractories Inc., A Division of Laguna Clay Co.

WWW.CERAMICINDUSTRY.COM/CCD

Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology Astro-Met Inc. Esprix Technologies Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials Quartzite Processing Inc. Superior Quartz Products Inc., Ceramics & Glass Machinery Division Superior Technical Ceramics Corp. ¨ Technical Products Inc.

GRAPHITE COMPONENT Ceramaterials Ceramic Systems Inc. Goodfellow Corp.

CERAMICS Design • Fabrication • Prototype • Production • Distribution Vespel® Delrin® Torlon® PEEK® Ryton® UHMW® G-10 Macor® Boron Nitride Lava Aluminum Nitride high end plastics Threaded parts form Alumina, Zirconia, Silicon carbide

[email protected] www.technicalproductsinc.com

P.O. Box 189, Hubertus, WI 53003 Fax 262.335.3606

Component Listings Morgan AM&T Reade Advanced Materials ¨ Superior Graphite, Advanced Materials

GRINDING MEDIA ¨ Ceramic Solutions Inc. ¨ CoorsTek Inc., International Headquarters Esprix Technologies ¨ Glen Mills Inc. Goodfellow Corp. Metsch Refractories Inc. Reade Advanced Materials ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Tape Casting Warehouse Zircoa Inc.

HEARTH PLATE Anderman Ceramics Astro-Met Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Holland Mfg. Keith Company Recco Furnaces

HEAT SINK Accuratus Ceramic Corporation ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components

HEAT TREATING FURNACE FAN Keith Company Recco Furnaces

HEATING ELEMENT Ceramic Systems Inc. Heatron Inc. Keith Company KMI Refractories Recco Furnaces

HIGH-TEMPERATURE CERAMICS ¨ ¨

HEAT EXCHANGER ¨ CoorsTek Inc., International Headquarters HAI Advanced Material Specialists Inc. Heatron Inc. ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

HEAT SHIELDING COMPONENT Accuratus Ceramic Corporation Bolt Technical Ceramics, Morgan Technical Ceramics Brim Electronics Inc. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components MemPro Ceramics Corporation SMAHT Ceramics Inc. Zircoa Inc.

40

¨ ¨ ¨

Accuratus Ceramic Corporation AdTech Ceramics AdValue Technology LLC Advanced Ceramic Technology Akron Porcelain & Plastics Co. Anderman Ceramics Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics Ceradyne Inc. Ceramaterials Ceramco Inc. Ceramic Solutions Inc. Ceramic Systems Inc. CoorsTek Inc., International Headquarters Cotronics Corp. Du-Co Ceramics Co. ENrG Incorporated Ferro-Ceramic Grinding Inc. Goodfellow Corp. Heatron Inc. Hoover Precision Products International Ceramic Engineering, Advanced Ceramics Division Keith Company KMI Refractories MarkeTech International Inc., Engineered Ceramic Components Metsch Refractories Inc. Morgan Thermal Ceramics

WWW.CERAMICINDUSTRY.COM/CCD

¨ O’Keefe Ceramics Pacific Technology Exchange Phoenix Coating Resources Inc. Quartzite Processing Inc. Reade Advanced Materials Recco Furnaces ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Silicon Carbide Products SMAHT Ceramics Inc. ¨ Small Precision Tools ¨ Superior Graphite, Advanced Materials Superior Technical Ceramics Corp. ¨ Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics Zircoa Inc.

HIGH-TEMPERATURE FIXTURING COMPONENT Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology ¨ Akron Porcelain & Plastics Co. Astro-Met Inc. Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Metsch Refractories Inc. Quartzite Processing Inc. ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products SMAHT Ceramics Inc. ¨ Small Precision Tools Superior Technical Ceramics Corp. ¨ Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics Zircoa Inc.

HIGH-TEMPERATURE TUBING Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology

Component Listings Anderman Ceramics Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics Brim Electronics Inc. Ceramaterials Ceramco Inc. Ceramic Solutions Inc. Ceramic Systems Inc. CoorsTek Inc., International Headquarters Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. Goodfellow Corp. Heatron Inc. International Ceramic Engineering, Advanced Ceramics Division Keith Company MarkeTech International Inc., Engineered Ceramic Components Metsch Refractories Inc. Recco Furnaces Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Small Precision Tools Superior Technical Ceramics Corp. Technical Products Inc.

¨ ¨

¨ ¨ ¨

HIGH-VOLTAGE COMPONENT Accuratus Ceramic Corporation ¨ Akron Porcelain & Plastics Co. Ceramco Inc. Ferro-Ceramic Grinding Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Superior Technical Ceramics Corp. ¨ Technical Products Inc. TPL Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

HOLLOW PAIR LEAD-IN ¨ Technical Products Inc.

HONEYCOMB Holland Mfg.

HYBRID CIRCUIT Accuratus Ceramic Corporation AdTech Ceramics ¨ CoorsTek Inc., International Headquarters Heatron Inc.

IC PACKAGE AdTech Ceramics ¨ CoorsTek Inc., International Headquarters MarkeTech International Inc., Engineered Ceramic Components

IGNITION COMPONENT Accuratus Ceramic Corporation Anderman Ceramics Du-Co Ceramics Co. International Ceramic Engineering, Advanced Ceramics Division Superior Technical Ceramics Corp.

INDUCTOR Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

INDUSTRIAL COMPONENT Accuratus Ceramic Corporation Advanced Ceramic Technology ¨ Akron Porcelain & Plastics Co. Bolt Technical Ceramics, Morgan Technical Ceramics ¨ Ceradyne Inc. Ceramaterials Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Ferro-Ceramic Grinding Inc. Industrial Ceramic Products Inc. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components MemPro Ceramics Corporation Metsch Refractories Inc. Silicon Carbide Products Superior Technical Ceramics Corp. Wesgo/Duramic Products, Morgan Technical Ceramics

Leader in Ceramic Injection Molding (CIM) of high-precision micro miniature components

707-762-5880 • www.spt.net 42

WWW.CERAMICINDUSTRY.COM/CCD

Zircoa Inc.

INGOT Phoenix Coating Resources Inc. Reade Advanced Materials ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

INGOT, ELECTRON BEAM PHYSICAL VAPOR DEPOSITION (EBPVD) Phoenix Coating Resources Inc. Reade Advanced Materials ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

INJECTION MOLDING ¨ Akron Porcelain & Plastics Co. Ceramco Inc. Ceramic Systems Inc. Goodfellow Corp. Industrial Ceramic Products Inc. International Ceramic Engineering, Advanced Ceramics Division ¨ Small Precision Tools

INJECTION MOLDING COMPOUND, ZIRCONIA International Ceramic Engineering, Advanced Ceramics Division

INSULATION Custom ENrG Incorporated Insulation Specialties of America MemPro Ceramics Corporation Morgan Thermal Ceramics

Furnace Cancarb Ltd. Goodfellow Corp. Insulation Specialties of America Intersource USA Inc. Keith Company KMI Refractories Morgan Thermal Ceramics Recco Furnaces SMAHT Ceramics Inc. Zircoa Inc.

Microporous Goodfellow Corp. MarkeTech International Inc., Engineered Ceramic Components

Component Listings Morgan Thermal Ceramics

Thermal Accuratus Ceramic Corporation ENrG Incorporated Insulation Specialties of America Intersource USA Inc. Morgan Thermal Ceramics

INSULATOR Accuratus Ceramic Corporation ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics Brim Electronics Inc. ¨ Ceradyne Inc. Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. Metsch Refractories Inc. Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials Pacific Technology Exchange ¨ Technical Products Inc. TPL Inc. Wesgo/Duramic Products, Morgan Technical Ceramics Zircoa Inc.

ION CHAMBER ENVELOPE

KILN

¨ CoorsTek Inc., International Headquarters

Furniture

ISOLATOR Accuratus Ceramic Corporation Advanced Ceramic Technology Astro-Met Inc. Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division Quartzite Processing Inc. Superior Technical Ceramics Corp. ¨ Technical Products Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

Anderman Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. ENrG Incorporated Filtros Ltd. Holland Mfg. Insulation Specialties of America Keith Company MarkeTech International Inc., Engineered Ceramic Components Metsch Refractories Inc. Morgan Thermal Ceramics Recco Furnaces

Band Heater Du-Co Ceramics Co.

CERAMIC COMPONENTS DIRECTORY ³ 2011

43

Component Listings ¨ Saint-Gobain Ceramic Materials, High Performance Refractories ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Silicon Carbide Products SMAHT Ceramics Inc. Sunrock Ceramics Co. Thorley Refractories Inc., A Division of Laguna Clay Co. Zircoa Inc.

Shelf Anderman Ceramics Holland Mfg. Keith Company Recco Furnaces ¨ Saint-Gobain Ceramic Materials, High Performance Refractories ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Sunrock Ceramics Co. Thorley Refractories Inc., A Division of Laguna Clay Co.

Support Beam Anderman Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics ¨ Ceramic Solutions Inc. Holland Mfg. ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

Tile Anderman Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Holland Mfg. Keith Company MarkeTech International Inc., Engineered Ceramic Components Morgan Thermal Ceramics Recco Furnaces ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Sunrock Ceramics Co. Zircoa Inc.

LABWARE ¨ AdValue Technology LLC Anderman Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics ¨ CoorsTek Inc., International Headquarters

44

International Ceramic Engineering, Advanced Ceramics Division Quartzite Processing Inc.

Chemical Resistant ¨ AdValue Technology LLC Anderman Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Quartzite Processing Inc.

Fused Quartz ¨ AdValue Technology LLC Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Quartzite Processing Inc.

LAMP BASE Accuratus Ceramic Corporation ¨ Akron Porcelain & Plastics Co. Ceramco Inc. Du-Co Ceramics Co. Goodfellow Corp. Metsch Refractories Inc. Superior Technical Ceramics Corp. Wesgo/Duramic Products, Morgan Technical Ceramics

LAPPING PLATE Astro-Met Inc. ¨ Ceradyne Inc.

LASER CAVITY REFLECTOR Accuratus Ceramic Corporation Ceramco Inc. ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. ¨ Technical Products Inc.

LASER COMPONENT Accuratus Ceramic Corporation Advanced Ceramic Technology Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics Ceramco Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Superior Technical Ceramics Corp.

WWW.CERAMICINDUSTRY.COM/CCD

¨ Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

LASER WAVE GUIDE Accuratus Ceramic Corporation Ferro-Ceramic Grinding Inc. Superior Technical Ceramics Corp. ¨ Technical Products Inc.

LIFT PIN ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Superior Technical Ceramics Corp. ¨ Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

LIGHTING COMPONENT Accuratus Ceramic Corporation ¨ Akron Porcelain & Plastics Co. Ceramco Inc. Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division Superior Technical Ceramics Corp. ¨ Technical Products Inc.

LIGHT-REFLECTING COMPONENT Accuratus Ceramic Corporation Ceramco Inc. ¨ CoorsTek Inc., International Headquarters Goodfellow Corp.

LINING Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters Insulation Specialties of America ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Silicon Carbide Products Zircoa Inc.

Abrasion-Resistant Astro-Met Inc. Ceramaterials ¨ Ceramic Solutions Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Refractron Technologies Corp.

Component Listings ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Silicon Carbide Products Superior Technical Ceramics Corp. Zircoa Inc.

Furnace Blasch Precision Ceramics Ceramaterials ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Insulation Specialties of America Intersource USA Inc. Keith Company KMI Refractories Recco Furnaces ¨ Saint-Gobain Ceramic Materials, High Performance Refractories Zircoa Inc.

Protective Astro-Met Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Silicon Carbide Products

LIQUID LEVEL SENSOR COMPONENT Anderman Ceramics ¨ CoorsTek Inc., International Headquarters Heatron Inc. International Ceramic Engineering, Advanced Ceramics Division Morgan Technical Ceramics Superior Technical Ceramics Corp.

LOW-TEMPERATURE COFIRED CERAMIC (LTCC) COMPONENT International Ceramic Engineering, Advanced Ceramics Division

LOW-VOLTAGE COMPONENT Accuratus Ceramic Corporation ¨ Akron Porcelain & Plastics Co. Ceramco Inc. Heatron Inc. International Ceramic Engineering, Advanced Ceramics Division Metsch Refractories Inc. Superior Technical Ceramics Corp. ¨ Technical Products Inc.

MACHINABLE CERAMIC Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Astro-Met Inc.

Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Cotronics Corp. Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Quartzite Processing Inc. SMAHT Ceramics Inc. Sonic-Mill Superior Technical Ceramics Corp. ¨ Technical Products Inc. TPL Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

UCM Advanced Ceramics GmbH, A member of IMERYS Zircoa Inc.

MAGNESITE COMPONENT MarkeTech International Inc., Engineered Ceramic Components Reade Advanced Materials

MAGNET Quartzite Processing Inc.

Rare Earth ¨ Ceradyne Inc.

Samarium Cobalt ¨ Ceradyne Inc.

MECHANICAL PUMP SEAL ¨ ¨

MACHINABLE GLASS CERAMIC Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology Astro-Met Inc. Cotronics Corp. Ferro-Ceramic Grinding Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Quartzite Processing Inc. Sonic-Mill Superior Technical Ceramics Corp. ¨ Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

MAGNESIA PARTIALLY STABILIZED ZIRCONIA COMPONENT Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology Anderman Ceramics ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. ¨ O’Keefe Ceramics Reade Advanced Materials Refractron Technologies Corp. Superior Technical Ceramics Corp. ¨ Technical Products Inc.

¨ ¨

Accuratus Ceramic Corporation Astro-Met Inc. Ceradyne Inc. CoorsTek Inc., International Headquarters Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Pacific Technology Exchange Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Small Precision Tools Wesgo/Duramic Products, Morgan Technical Ceramics Zircoa Inc.

MEDICAL COMPONENT

¨ ¨

¨ ¨

Accuratus Ceramic Corporation AdTech Ceramics Anderman Ceramics Astro-Met Inc. Ceradyne Inc. CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. MarkeTech International Inc., Engineered Ceramic Components Morgan Technical Ceramics O’Keefe Ceramics Quartzite Processing Inc. Small Precision Tools Superior Technical Ceramics Corp. Wesgo/Duramic Products, Morgan Technical Ceramics

MEMBRANE ENrG Incorporated

Battery ENrG Incorporated

CERAMIC COMPONENTS DIRECTORY ³ 2011

45

Component Listings METAL FORMING ROLL Accuratus Ceramic Corporation Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics

METAL MATRIX COMPOSITE Accuratus Ceramic Corporation Ceramaterials ¨ Superior Graphite, Advanced Materials

METER BEARING Astro-Met Inc.

MICA COMPONENT Advanced Ceramic Technology Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. Reade Advanced Materials ¨ Technical Products Inc.

MICROPOROUS INSULATION Morgan Thermal Ceramics

MICROWAVE ABSORBER Accuratus Ceramic Corporation Advanced Ceramic Technology Advanced Composite Materials LLC ¨ Ceradyne Inc. Ferro-Ceramic Grinding Inc. Filtros Ltd. Quartzite Processing Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

MICROWAVE COMPONENT

¨

¨ ¨

¨

Accuratus Ceramic Corporation AdTech Ceramics Advanced Ceramic Technology Advanced Composite Materials LLC Ceradyne Inc. Ferro-Ceramic Grinding Inc. MarkeTech International Inc., Engineered Ceramic Components O’Keefe Ceramics Quartzite Processing Inc. Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products TPL Inc. Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

MILL LINING BRICK Ceramic Systems Inc.

46

¨ CoorsTek Inc., International Headquarters

MONOLITHIC COMPONENT Astro-Met Inc. Ceramco Inc. ¨ CoorsTek Inc., International Headquarters ENrG Incorporated ¨ Saint-Gobain Ceramic Materials, High Performance Refractories SMAHT Ceramics Inc. UCM Advanced Ceramics GmbH, A member of IMERYS

MUFFLE, REFRACTORY ¨ Akron Porcelain & Plastics Co. Anderman Ceramics ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Holland Mfg. ¨ Saint-Gobain Ceramic Materials, High Performance Refractories ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Reade Advanced Materials Silicon Carbide Products ¨ Technical Products Inc.

NOZZLE

¨ ¨

¨ ¨

MULLITE COMPONENT Accuratus Ceramic Corporation Advanced Ceramic Technology ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. Holland Mfg. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components Metsch Refractories Inc. Quartzite Processing Inc. Reade Advanced Materials Superior Technical Ceramics Corp. Thorley Refractories Inc., A Division of Laguna Clay Co.

¨

NOZZLE ASSEMBLY Astro-Met Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

NOZZLE COMPONENT

¨ ¨ ¨

NITRIDE COMPONENT Accuratus Ceramic Corporation Advanced Ceramic Technology ¨ Ceradyne Inc. Ceramic Systems Inc. Ferro-Ceramic Grinding Inc.

WWW.CERAMICINDUSTRY.COM/CCD

Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. Blasch Precision Ceramics Ceradyne Inc. Ceramco Inc. Ceramic Systems Inc. CoorsTek Inc., International Headquarters Du-Co Ceramics Co. HAI Advanced Material Specialists Inc. International Ceramic Engineering, Advanced Ceramics Division O’Keefe Ceramics Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Silicon Carbide Products SMAHT Ceramics Inc. Small Precision Tools Superior Technical Ceramics Corp. Zircoa Inc.

¨

Accuratus Ceramic Corporation Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. Ceradyne Inc. Ceramco Inc. Ceramic Solutions Inc. Ceramic Systems Inc. CoorsTek Inc., International Headquarters Du-Co Ceramics Co. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components O’Keefe Ceramics

Component Listings ¨ Saint-Gobain Ceramic Materials, High Performance Refractories ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Silicon Carbide Products Wesgo/Duramic Products, Morgan Technical Ceramics

NUCLEAR WASTE CONTAINER ¨ Ceradyne Inc.

NUT Ceramco Inc. Ceramic Systems Inc. International Ceramic Engineering, Advanced Ceramics Division Superior Technical Ceramics Corp.

OPEN-CELLED FOAM COMPONENT Anderman Ceramics Cotronics Corp.

OPTICAL COMPONENTS ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components

ORIFICE Astro-Met Inc. Ceramco Inc. Ceramic Systems Inc. Zircoa Inc.

ORTHODONTIC BRACKET ¨ Ceradyne Inc. Ceramco Inc. ¨ Small Precision Tools

ORTHODONTIC COMPONENT ¨ Ceradyne Inc.

OXIDE PRODUCT Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics ¨ Ceradyne Inc. Ceramic Systems Inc. Du-Co Ceramics Co. ENrG Incorporated Goodfellow Corp. HAI Advanced Material Specialists Inc.

International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Quartzite Processing Inc. Reade Advanced Materials SMAHT Ceramics Inc. ¨ Small Precision Tools Superior Technical Ceramics Corp. ¨ Technical Products Inc. TPL Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc. Wesgo/Duramic Products, Morgan Technical Ceramics Zircoa Inc.

PAPER PROCESSING ELEMENT ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Superior Technical Ceramics Corp.

PARTICULATE COMPOSITE ¨ Ceradyne Inc. Ceramaterials Reade Advanced Materials ¨ Superior Graphite, Advanced Materials

PELLET ¨ CoorsTek Inc., International Headquarters

PERLITE BRICK AND BLOCK INSULATION Intersource USA Inc.

PHOTOVOLTAIC CASTING CRUCIBLE ¨ AdValue Technology LLC ¨ Ceradyne Inc.

PIEZOELECTRIC APC International Ltd., American Piezo Ceramics ¨ CoorsTek Inc., International Headquarters Morgan Technical Ceramics Pacific Technology Exchange

Actuator APC International Ltd., American Piezo Ceramics Morgan Technical Ceramics

Knock Sensor APC International Ltd., American Piezo Ceramics

Sound Component APC International Ltd., American Piezo Ceramics

PIPE Ceramic-Lined Astro-Met Inc. Ceramaterials Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

Insulation ¨ CoorsTek Inc., International Headquarters Cotronics Corp. Goodfellow Corp. Insulation Specialties of America Morgan Thermal Ceramics

Slip-Lining Ceramic Systems Inc.

Wrap Morgan Thermal Ceramics

PISTON Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters Insaco International Ceramic Engineering, Advanced Ceramics Division Refractron Technologies Corp.

PLATE ¨ AdValue Technology LLC Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters ENrG Incorporated International Ceramic Engineering, Advanced Ceramics Division Refractron Technologies Corp. ¨ Saint-Gobain Ceramic Materials, High Performance Refractories SMAHT Ceramics Inc. Sunrock Ceramics Co. Zircoa Inc.

Element Keith Company Recco Furnaces

Pusher Holland Mfg. Keith Company Recco Furnaces

CERAMIC COMPONENTS DIRECTORY ³ 2011

47

Component Listings Sunrock Ceramics Co. Superior Technical Ceramics Corp.

PLUNGER

SMAHT Ceramics Inc.

POST

Astro-Met Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Insaco International Ceramic Engineering, Advanced Ceramics Division Refractron Technologies Corp. Superior Technical Ceramics Corp. Zircoa Inc.

Anderman Ceramics Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters Filtros Ltd. Holland Mfg. Industrial Ceramic Products Inc. ¨ Saint-Gobain Ceramic Materials, High Performance Refractories Superior Technical Ceramics Corp.

POROUS CERAMIC

POURING CUP

Accuratus Ceramic Corporation ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics Ceramaterials Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters ENrG Incorporated Ferro-Ceramic Grinding Inc. Filtros Ltd. Goodfellow Corp. Holland Mfg. MarkeTech International Inc., Engineered Ceramic Components MemPro Ceramics Corporation Phoenix Coating Resources Inc. Quartzite Processing Inc. Refractron Technologies Corp. SMAHT Ceramics Inc. Superior Technical Ceramics Corp. Wesgo/Duramic Products, Morgan Technical Ceramics

¨ Akron Porcelain & Plastics Co. Blasch Precision Ceramics ¨ CoorsTek Inc., International Headquarters Industrial Ceramic Products Inc. Insulation Specialties of America Metsch Refractories Inc.

POROUS PLATE & TUBE

¨ AdValue Technology LLC ¨ Akron Porcelain & Plastics Co. Anderman Ceramics APC International Ltd., American Piezo Ceramics Ceramco Inc. Goodfellow Corp. Holland Mfg. Insulation Specialties of America International Ceramic Engineering, Advanced Ceramics Division Superior Technical Ceramics Corp.

Anderman Ceramics Blasch Precision Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics Ceramco Inc. ¨ Ceramic Solutions Inc. ¨ CoorsTek Inc., International Headquarters ENrG Incorporated Filtros Ltd. Goodfellow Corp. Holland Mfg. MarkeTech International Inc., Engineered Ceramic Components Quartzite Processing Inc. Refractron Technologies Corp. ¨ Saint-Gobain Ceramic Materials, High Performance Refractories

48

POWER SUPPLY Kurt J. Lesker Company

PUMP COMPONENT Accuratus Ceramic Corporation Advanced Ceramic Technology Astro-Met Inc. Blasch Precision Ceramics ¨ Ceradyne Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics Refractron Technologies Corp. Silicon Carbide Products Superior Technical Ceramics Corp. Wesgo/Duramic Products, Morgan Technical Ceramics

QUARTZ AND QUARTZWARE ¨ AdValue Technology LLC International Ceramic Engineering, Advanced Ceramics Division Quartzite Processing Inc.

POWER TUBE

Beaker

Accuratus Ceramic Corporation ¨ AdValue Technology LLC ¨ CoorsTek Inc., International Headquarters Wesgo/Duramic Products, Morgan Technical Ceramics

¨ AdValue Technology LLC ¨ CoorsTek Inc., International Headquarters Goodfellow Corp.

PRESSURE TRANSDUCER COMPONENT APC International Ltd., American Piezo Ceramics International Ceramic Engineering, Advanced Ceramics Division

PROCESS CRUCIBLE

PUCK, RING AND ASSEMBLY Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters Superior Technical Ceramics Corp. Wesgo/Duramic Products, Morgan Technical Ceramics

WWW.CERAMICINDUSTRY.COM/CCD

Flask ¨ AdValue Technology LLC ¨ CoorsTek Inc., International Headquarters Goodfellow Corp.

Labware ¨ AdValue Technology LLC ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division

Petrie Dish ¨ CoorsTek Inc., International Headquarters

Rod ¨ AdValue Technology LLC ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Quartzite Processing Inc. Superior Quartz Products Inc., Ceramics & Glass Machinery Division

Sheet ¨ CoorsTek Inc., International Headquarters

Component Listings Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division

Test Tube ¨ CoorsTek Inc., International Headquarters

Tube ¨ AdValue Technology LLC ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division Quartzite Processing Inc.

RADIO FREQUENCY/MICROWAVE WINDOW Accuratus Ceramic Corporation ¨ Ceradyne Inc. Filtros Ltd. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

RADOME Accuratus Ceramic Corporation Advanced Ceramic Technology ¨ Ceradyne Inc. Ferro-Ceramic Grinding Inc. Goodfellow Corp. MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Wesgo/Duramic Products, Morgan Technical Ceramics

RARE EARTH MAGNET ¨ Ceradyne Inc.

REFRACTORIES ¨ ¨ ¨

¨

Accuratus Ceramic Corporation AdValue Technology LLC Akron Porcelain & Plastics Co. Ceramco Inc. Ceramic Solutions Inc. Ceramic Systems Inc. Goodfellow Corp. Morgan Thermal Ceramics Saint-Gobain Ceramic Materials, High Performance Refractories Sunrock Ceramics Co. Thorley Refractories Inc., A Division of Laguna Clay Co.

Alumina ¨ AdValue Technology LLC ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Blasch Precision Ceramics Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Cotronics Corp.

Goodfellow Corp. Intersource USA Inc. Keith Company Morgan Thermal Ceramics Recco Furnaces ¨ Saint-Gobain Ceramic Materials, High Performance Refractories Sunrock Ceramics Co. ¨ Technical Products Inc. Thorley Refractories Inc., A Division of Laguna Clay Co.

Basic ¨ Akron Porcelain & Plastics Co. Blasch Precision Ceramics ¨ Ceramic Solutions Inc. Intersource USA Inc. ¨ Saint-Gobain Ceramic Materials, High Performance Refractories

Cordierite ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Ceramco Inc. Du-Co Ceramics Co. Goodfellow Corp. Keith Company Metsch Refractories Inc. Recco Furnaces Thorley Refractories Inc., A Division of Laguna Clay Co.

Forehearth Anderman Ceramics Morgan Thermal Ceramics

High-Alumina

Goodfellow Corp. Intersource USA Inc. Keith Company KMI Refractories Morgan Thermal Ceramics Recco Furnaces ¨ Saint-Gobain Ceramic Materials, High Performance Refractories SMAHT Ceramics Inc.

Insulating Firebrick Goodfellow Corp. Intersource USA Inc. Keith Company KMI Refractories Morgan Thermal Ceramics Recco Furnaces

Mullite ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Goodfellow Corp. Industrial Ceramic Products Inc. Intersource USA Inc. Keith Company Metsch Refractories Inc. Recco Furnaces ¨ Saint-Gobain Ceramic Materials, High Performance Refractories Thorley Refractories Inc., A Division of Laguna Clay Co.

¨ AdValue Technology LLC ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Blasch Precision Ceramics Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Goodfellow Corp. Intersource USA Inc. Keith Company Morgan Thermal Ceramics Recco Furnaces ¨ Saint-Gobain Ceramic Materials, High Performance Refractories Sunrock Ceramics Co. ¨ Technical Products Inc. Thorley Refractories Inc., A Division of Laguna Clay Co.

Preformed

Insulating

Anderman Ceramics Blasch Precision Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics ¨ Ceramic Solutions Inc.

¨ Akron Porcelain & Plastics Co. Ceramco Inc. Ceramic Systems Inc. Cotronics Corp.

¨ Akron Porcelain & Plastics Co. Industrial Ceramic Products Inc. Intersource USA Inc. Metsch Refractories Inc. Morgan Thermal Ceramics ¨ Saint-Gobain Ceramic Materials, High Performance Refractories

Silica ¨ AdValue Technology LLC ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Goodfellow Corp. Intersource USA Inc. Metsch Refractories Inc. Morgan Thermal Ceramics

Silicon Carbide

CERAMIC COMPONENTS DIRECTORY ³ 2011

49

Component Listings Ceramic Systems Inc. Goodfellow Corp. Intersource USA Inc. Keith Company Recco Furnaces ¨ Saint-Gobain Ceramic Materials, High Performance Refractories Silicon Carbide Products Thorley Refractories Inc., A Division of Laguna Clay Co.

Whisker

Zircon

Thick-Film

Ceramic Systems Inc. Metsch Refractories Inc.

Zirconia ¨ AdValue Technology LLC Anderman Ceramics Blasch Precision Ceramics Ceramco Inc. Ceramic Systems Inc. Goodfellow Corp. Intersource USA Inc. Morgan Thermal Ceramics Phoenix Coating Resources Inc. ¨ Saint-Gobain Ceramic Materials, High Performance Refractories ¨ Technical Products Inc. Zircoa Inc.

REFRACTORY SHAPE Accuratus Ceramic Corporation ¨ AdValue Technology LLC ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Blasch Precision Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Filtros Ltd. Goodfellow Corp. Holland Mfg. Industrial Ceramic Products Inc. Metsch Refractories Inc. Morgan Thermal Ceramics Silicon Carbide Products Superior Technical Ceramics Corp. Thorley Refractories Inc., A Division of Laguna Clay Co.

REINFORCEMENT Advanced Composite Materials LLC Reade Advanced Materials

Fiber Reade Advanced Materials

Particulate/Platelet

Advanced Composite Materials LLC Reade Advanced Materials

RESISTOR CARRIER FOR ELECTRONIC ASSEMBLIES ¨ CoorsTek Inc., International Headquarters Heatron Inc.

RESISTOR ¨ CoorsTek Inc., International Headquarters Heatron Inc.

RESONATOR ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

Coaxial ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

Puck Advanced Ceramic Technology ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

RING ¨ AdValue Technology LLC Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. ¨ Ceradyne Inc. Ceramco Inc. ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics Refractron Technologies Corp. Superior Technical Ceramics Corp. Wesgo/Duramic Products, Morgan Technical Ceramics Zircoa Inc.

Accuratus Ceramic Corporation ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics ¨ Ceradyne Inc. Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. HAI Advanced Material Specialists Inc. Industrial Ceramic Products Inc. International Ceramic Engineering, Advanced Ceramics Division Metsch Refractories Inc. Refractron Technologies Corp. ¨ Saint-Gobain Ceramic Materials, High Performance Refractories Superior Technical Ceramics Corp. Zircoa Inc.

Quartz ¨ AdValue Technology LLC Ceramic Systems Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Superior Quartz Products Inc., Ceramics & Glass Machinery Division ¨ Technical Products Inc.

ROLLER

¨ ¨

RISER TUBE Advanced Ceramic Technology Blasch Precision Ceramics ¨ Ceradyne Inc. Ceramaterials Insulation Specialties of America

ROCKET LAUNCH SYSTEM INSULATION Cancarb Ltd.

ROCKET THRUST CHAMBER MarkeTech International Inc., Engineered Ceramic Components

Reade Advanced Materials

50

ROD

WWW.CERAMICINDUSTRY.COM/CCD

¨ ¨

Anderman Ceramics Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics Ceradyne Inc. Ceramic Solutions Inc. International Ceramic Engineering, Advanced Ceramics Division Saint-Gobain Ceramic Materials, High Performance Refractories Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Zircoa Inc.

SAGGER Anderman Ceramics APC International Ltd., American Piezo Ceramics Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc.

Component Listings Holland Mfg. Keith Company MarkeTech International Inc., Engineered Ceramic Components Recco Furnaces ¨ Saint-Gobain Ceramic Materials, High Performance Refractories Sunrock Ceramics Co. Thorley Refractories Inc., A Division of Laguna Clay Co. Zircoa Inc.

SAMPLE HOLDER Accuratus Ceramic Corporation Astro-Met Inc. Ceramco Inc.

SAND BLAST NOZZLE LINER Astro-Met Inc. ¨ Ceradyne Inc. Ceramco Inc. MarkeTech International Inc., Engineered Ceramic Components ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Zircoa Inc.

SAPPHIRE COMPONENTS Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division ¨ Technical Products Inc.

SCREEN TILE ¨ Ceradyne Inc.

SEAL Astro-Met Inc. ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Morgan AM&T ¨ O’Keefe Ceramics Wesgo/Duramic Products, Morgan Technical Ceramics

SEAL, CERAMIC-TO-METAL AdTech Ceramics ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Superior Technical Ceramics Corp.

SEAL FACE Accuratus Ceramic Corporation Astro-Met Inc. ¨ Ceradyne Inc.

¨ CoorsTek Inc., International Headquarters Morgan AM&T ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

SEAL RING, ROTATING Accuratus Ceramic Corporation Astro-Met Inc. ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Morgan AM&T Pacific Technology Exchange Superior Technical Ceramics Corp.

SEAT Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters Morgan AM&T Refractron Technologies Corp. Superior Technical Ceramics Corp.

SEMICONDUCTOR Accuratus Ceramic Corporation HAI Advanced Material Specialists Inc. Heatron Inc. International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics

SEMICONDUCTOR WAFER Carrier Accuratus Ceramic Corporation ¨ AdValue Technology LLC ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics SMAHT Ceramics Inc. ¨ Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

Contact Pin Accuratus Ceramic Corporation ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics

Superior Technical Ceramics Corp. ¨ Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

End Effector Accuratus Ceramic Corporation ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Wesgo/Duramic Products, Morgan Technical Ceramics

Handler Arm Accuratus Ceramic Corporation ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics ¨ Technical Products Inc.

Polishing Block ¨ Ceradyne Inc. Insaco MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics

Wafer Rack ¨ AdValue Technology LLC

SENSOR Accuratus Ceramic Corporation APC International Ltd., American Piezo Ceramics ¨ Bullen ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Superior Technical Ceramics Corp.

Piezoelectric APC International Ltd., American Piezo Ceramics ¨ Bullen ¨ CoorsTek Inc., International Headquarters Morgan Technical Ceramics Pacific Technology Exchange

CERAMIC COMPONENTS DIRECTORY ³ 2011

51

Component Listings Ultrasonic Morgan Technical Ceramics

SENSORS/SENSOR MODULE, PYROELECTRIC INFRARED ¨ CoorsTek Inc., International Headquarters

SETTER Anderman Ceramics Ceramco Inc. ¨ Ceramic Solutions Inc. ENrG Incorporated Holland Mfg. MarkeTech International Inc., Engineered Ceramic Components Sunrock Ceramics Co. Superior Technical Ceramics Corp. Thorley Refractories Inc., A Division of Laguna Clay Co. Zircoa Inc.

SETTER, WARE Anderman Ceramics Ceramco Inc. Holland Mfg. MarkeTech International Inc., Engineered Ceramic Components ¨ Saint-Gobain Ceramic Materials, High Performance Refractories SMAHT Ceramics Inc. Sunrock Ceramics Co. Thorley Refractories Inc., A Division of Laguna Clay Co. Zircoa Inc.

SHAFT Accuratus Ceramic Corporation Advanced Ceramic Technology Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division Superior Technical Ceramics Corp. Wesgo/Duramic Products, Morgan Technical Ceramics Zircoa Inc.

¨ Saint-Gobain Ceramic Materials, High Performance Refractories Sunrock Ceramics Co. Thorley Refractories Inc., A Division of Laguna Clay Co.

SHELF, KILN Anderman Ceramics ¨ Ceramic Solutions Inc. Holland Mfg. Keith Company Recco Furnaces ¨ Saint-Gobain Ceramic Materials, High Performance Refractories ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Sunrock Ceramics Co. Thorley Refractories Inc., A Division of Laguna Clay Co. Accuratus Ceramic Corporation Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Reade Advanced Materials

Ceramaterials Ceramic Systems Inc.

Specialty Shape

¨ ¨ ¨

¨

SILICIDE COMPONENT International Ceramic Engineering, Advanced Ceramics Division Reade Advanced Materials

SILICON CARBIDE

¨ ¨

Component

¨ ¨ ¨ ¨

ENrG Incorporated Goodfellow Corp.

SHELF

52

Foam Shape

SIALON

SHEET, FLEXIBLE CERAMIC

Anderman Ceramics Astro-Met Inc. Holland Mfg. Keith Company Recco Furnaces

Quartzite Processing Inc. Reade Advanced Materials ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Silicon Carbide Products ¨ Superior Graphite, Advanced Materials

¨

Accuratus Ceramic Corporation Advanced Ceramic Technology Advanced Composite Materials LLC Anderman Ceramics Blasch Precision Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics Bullen Ceradyne Inc. Ceramic Solutions Inc. Ceramic Systems Inc. CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components MemPro Ceramics Corporation Morgan AM&T O’Keefe Ceramics Pacific Technology Exchange

WWW.CERAMICINDUSTRY.COM/CCD

¨

Accuratus Ceramic Corporation Advanced Ceramic Technology Anderman Ceramics Blasch Precision Ceramics Ceradyne Inc. Ceramaterials Ceramic Solutions Inc. Ceramic Systems Inc. CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Holland Mfg. Insaco International Ceramic Engineering, Advanced Ceramics Division O’Keefe Ceramics Pacific Technology Exchange Quartzite Processing Inc. Saint-Gobain Ceramic Materials, High Performance Refractories Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Silicon Carbide Products Superior Graphite, Advanced Materials

SILICON NITRIDE COMPONENT ¨ ¨ ¨

¨

Accuratus Ceramic Corporation Advanced Ceramic Technology Bullen Ceradyne Inc. Ceramaterials Ceramic Systems Inc. CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. Hoover Precision Products Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components O’Keefe Ceramics Reade Advanced Materials

Component Listings ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Silicon Carbide Products

SINGLE CRYSTAL LEAD MAGNESIUM NIOBATE/LEAT TITANATE (PMN-PT) Reade Advanced Materials

SLEEVE Accuratus Ceramic Corporation Astro-Met Inc. ¨ Ceradyne Inc. ¨ Ceramic Solutions Inc. International Ceramic Engineering, Advanced Ceramics Division Quartzite Processing Inc. Refractron Technologies Corp. Silicon Carbide Products Superior Technical Ceramics Corp. Thorley Refractories Inc., A Division of Laguna Clay Co.

SOLID OXIDE FUEL CELL COMPONENT Accuratus Ceramic Corporation ¨ AdValue Technology LLC Anderman Ceramics Astro-Met Inc. ENrG Incorporated Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Phoenix Coating Resources Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc. UCM Advanced Ceramics GmbH, A member of IMERYS

SPACER Advanced Ceramic Technology ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics ¨ Ceradyne Inc. Ceramco Inc. ¨ Ceramic Solutions Inc.

¨ CoorsTek Inc., International Headquarters ENrG Incorporated Esprix Technologies Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials Quartzite Processing Inc. Superior Technical Ceramics Corp. Thorley Refractories Inc., A Division of Laguna Clay Co. Wesgo/Duramic Products, Morgan Technical Ceramics

SPARK PLUG BOOT INSULATOR Superior Technical Ceramics Corp.

SPHERE, CERAMIC ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Astro-Met Inc. ¨ Ceradyne Inc. Ceramco Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components Metsch Refractories Inc. ¨ O’Keefe Ceramics Reade Advanced Materials Refractron Technologies Corp. ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products ¨ Technical Products Inc.

SPUTTERING TARGET Accuratus Ceramic Corporation ¨ Ceradyne Inc. Goodfellow Corp. Kurt J. Lesker Company MarkeTech International Inc., Engineered Ceramic Components Phoenix Coating Resources Inc. Reade Advanced Materials

¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products TPL Inc.

STANDOFF INSULATOR Heavy-Duty Accuratus Ceramic Corporation ¨ Akron Porcelain & Plastics Co. Astro-Met Inc. Ceramco Inc. ¨ CoorsTek Inc., International Headquarters Du-Co Ceramics Co. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Superior Technical Ceramics Corp. Wesgo/Duramic Products, Morgan Technical Ceramics

Light-Duty Accuratus Ceramic Corporation ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Astro-Met Inc. Brim Electronics Inc. Ceramco Inc. ¨ CoorsTek Inc., International Headquarters Du-Co Ceramics Co. International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics Superior Technical Ceramics Corp. Wesgo/Duramic Products, Morgan Technical Ceramics

STEATITE COMPONENT Accuratus Ceramic Corporation Advanced Ceramic Technology Brim Electronics Inc. Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components

CERAMIC COMPONENTS DIRECTORY ³ 2011

53

Component Listings Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials Quartzite Processing Inc. Reade Advanced Materials Superior Quartz Products Inc., Ceramics & Glass Machinery Division Superior Technical Ceramics Corp.

STONE, BAKING ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Thorley Refractories Inc., A Division of Laguna Clay Co.

STRAINER CORE ¨ Akron Porcelain & Plastics Co. Industrial Ceramic Products Inc.

SUBSTRATE Alumina ¨ ¨ ¨

¨ ¨

Accuratus Ceramic Corporation AdValue Technology LLC Advanced Ceramic Technology Astro-Met Inc. Bullen Ceramic Systems Inc. CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components MemPro Ceramics Corporation O’Keefe Ceramics Quartzite Processing Inc. Refractron Technologies Corp. Technical Products Inc.

Aluminum Nitride Accuratus Ceramic Corporation Advanced Ceramic Technology Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components MemPro Ceramics Corporation

Boron Carbide Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division MemPro Ceramics Corporation

54

¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters

Cryogenic

TAPE

ENrG Incorporated

Heater ENrG Incorporated

Silicon Carbide Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components MemPro Ceramics Corporation Quartzite Processing Inc. ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

Superconductor ENrG Incorporated

Zirconia Accuratus Ceramic Corporation ENrG Incorporated Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division MemPro Ceramics Corporation

SUPERCONDUCTOR DEVICE MarkeTech International Inc., Engineered Ceramic Components

SUPERCONDUCTOR WIRE Reade Advanced Materials

SUPER-DUTY REFRACTORY BRICK Thorley Refractories Inc., A Division of Laguna Clay Co.

SUSCEPTOR ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters

SUSPENSION INSULATOR ¨ Akron Porcelain & Plastics Co. International Ceramic Engineering, Advanced Ceramics Division

SUSPENSION INSULATOR, HEAVY-DUTY ¨ Akron Porcelain & Plastics Co.

TANK LINING, CERAMIC Astro-Met Inc. Ceramaterials

WWW.CERAMICINDUSTRY.COM/CCD

¨ CoorsTek Inc., International Headquarters Cotronics Corp. Du-Co Ceramics Co. HAI Advanced Material Specialists Inc. Tape Casting Warehouse

TAPE, INSULATING ¨ CoorsTek Inc., International Headquarters Du-Co Ceramics Co. Goodfellow Corp. Intersource USA Inc.

TARGET Goodfellow Corp. Phoenix Coating Resources Inc.

TERMINAL Ceramic Ceramco Inc. ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division Palmer Electronics Inc. ¨ Technical Products Inc.

TEXTILE Feed Dog Ceramco Inc. Superior Technical Ceramics Corp.

Guide Astro-Met Inc. Ceramco Inc. Superior Technical Ceramics Corp.

Presser Feet Ceramco Inc.

THERMAL BARRIER Astro-Met Inc. Ceramaterials HAI Advanced Material Specialists Inc. International Ceramic Engineering, Advanced Ceramics Division Phoenix Coating Resources Inc. SMAHT Ceramics Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

THERMAL INSULATION ¨ AdValue Technology LLC ENrG Incorporated Goodfellow Corp.

Component Listings Insulation Specialties of America International Ceramic Engineering, Advanced Ceramics Division Intersource USA Inc. Keith Company KMI Refractories MemPro Ceramics Corporation Morgan Thermal Ceramics Recco Furnaces SMAHT Ceramics Inc. Zircoa Inc.

THERMAL MANAGEMENT SYSTEM ENrG Incorporated Heatron Inc.

THERMAL PROTECTION COMPONENT Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics ¨ Ceradyne Inc. Ceramco Inc. ¨ Ceramic Solutions Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Heatron Inc. International Ceramic Engineering, Advanced Ceramics Division ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Zircoa Inc.

THERMISTOR Ferro-Ceramic Grinding Inc. Heatron Inc.

THERMOCOUPLE BLOCK Insulation Specialties of America Palmer Electronics Inc.

THERMOCOUPLE PROTECTION TUBE Accuratus Ceramic Corporation Anderman Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics ¨ Ceradyne Inc. Ceramco Inc. ¨ Ceramic Solutions Inc. ¨ CoorsTek Inc., International Headquarters Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insulation Specialties of America Pacific Technology Exchange

¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Silicon Carbide Products

THICK FILM HEATER ¨ Ceradyne Inc.

THREAD GUIDE Advanced Ceramic Technology Astro-Met Inc. Ceramco Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Superior Technical Ceramics Corp.

TRANSDUCER APC International Ltd., American Piezo Ceramics

Piezoelectric Morgan Technical Ceramics

Ultrasonic Morgan Technical Ceramics

TRANSFER LADLE Blasch Precision Ceramics Ceramic Systems Inc. Insulation Specialties of America

TRANSFORMER APC International Ltd., American Piezo Ceramics

TUBE

TILE Astro-Met Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Sunrock Ceramics Co. ¨ Superior Graphite, Advanced Materials Superior Technical Ceramics Corp.

TILE SETTER Keith Company MarkeTech International Inc., Engineered Ceramic Components Recco Furnaces ¨ Saint-Gobain Ceramic Materials, High Performance Refractories Sunrock Ceramics Co. Thorley Refractories Inc., A Division of Laguna Clay Co.

TITANIUM DIBORIDE COMPONENT Accuratus Ceramic Corporation Advanced Ceramic Technology ¨ Ceradyne Inc. Goodfellow Corp. MemPro Ceramics Corporation Reade Advanced Materials

TONGUE-AND-GROOVE SHAPE Advanced Ceramic Technology Blasch Precision Ceramics ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Superior Technical Ceramics Corp. Zircoa Inc.

¨ AdValue Technology LLC Advanced Ceramic Technology ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics Ceramco Inc. ¨ Ceramic Solutions Inc. ¨ CoorsTek Inc., International Headquarters Du-Co Ceramics Co. Ferro-Ceramic Grinding Inc. Industrial Ceramic Products Inc. International Ceramic Engineering, Advanced Ceramics Division Metsch Refractories Inc. Refractron Technologies Corp. Silicon Carbide Products Superior Technical Ceramics Corp.

Lamp Insaco MarkeTech International Inc., Engineered Ceramic Components

Plasma Accuratus Ceramic Corporation Insaco MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics

Porous Ceramco Inc. ENrG Incorporated Goodfellow Corp.

Power Accuratus Ceramic Corporation Ceramco Inc. ¨ CoorsTek Inc., International Headquarters ¨ O’Keefe Ceramics

CERAMIC COMPONENTS DIRECTORY ³ 2011

55

Component Listings Pyrometer Protection Anderman Ceramics ¨ Ceramic Solutions Inc. Goodfellow Corp. Pacific Technology Exchange ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Thorley Refractories Inc., A Division of Laguna Clay Co.

Quartz ¨ AdValue Technology LLC Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Quartzite Processing Inc. Superior Quartz Products Inc., Ceramics & Glass Machinery Division ¨ Technical Products Inc.

Radiant ¨ Akron Porcelain & Plastics Co. Anderman Ceramics ¨ Ceramic Solutions Inc. ¨ CoorsTek Inc., International Headquarters ¨ Saint-Gobain Ceramic Materials, High Performance Refractories ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

Refractory Accuratus Ceramic Corporation ¨ AdValue Technology LLC ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Blasch Precision Ceramics Bolt Technical Ceramics, Morgan Technical Ceramics ¨ Ceramic Solutions Inc. Du-Co Ceramics Co. Holland Mfg. Industrial Ceramic Products Inc. Metsch Refractories Inc. ¨ Saint-Gobain Ceramic Materials, High Performance Refractories Zircoa Inc.

Tile Setter Holland Mfg.

TUBE MILL ROLL Accuratus Ceramic Corporation Astro-Met Inc.

TUBING Nuclear Du-Co Ceramics Co. Reade Advanced Materials

Thin-Wall Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. Brim Electronics Inc. Ceramco Inc. ¨ Ceramic Solutions Inc. ¨ CoorsTek Inc., International Headquarters Du-Co Ceramics Co. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products

TUNDISH ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Blasch Precision Ceramics Holland Mfg. Insulation Specialties of America

TUNGSTEN CARBIDE COMPONENT Elizabeth Carbide Components International Ceramic Engineering, Advanced Ceramics Division MemPro Ceramics Corporation Reade Advanced Materials

ULTRASONIC COMPONENT Accuratus Ceramic Corporation APC International Ltd., American Piezo Ceramics Morgan Technical Ceramics

VACUUM CHUCK Astro-Met Inc. ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Filtros Ltd. Goodfellow Corp. Heatron Inc. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Morgan AM&T Refractron Technologies Corp. SMAHT Ceramics Inc. Superior Technical Ceramics Corp.

TUBE SHEET BOILER FERRULE

VALVE

Blasch Precision Ceramics ¨ Ceradyne Inc. Holland Mfg.

Chemical

56

Accuratus Ceramic Corporation

WWW.CERAMICINDUSTRY.COM/CCD

Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters Insaco

Medical Accuratus Ceramic Corporation Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters Insaco ¨ O’Keefe Ceramics Wesgo/Duramic Products, Morgan Technical Ceramics

VALVE SEAT Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division

VALVE STEM Astro-Met Inc. International Ceramic Engineering, Advanced Ceramics Division

WAFER, DIFFUSION SOURCE; BORON NITRIDE ¨ Ceradyne Inc. International Ceramic Engineering, Advanced Ceramics Division ¨ Technical Products Inc.

WARE TRAY ¨ AdValue Technology LLC ¨ Ceramic Solutions Inc. Thorley Refractories Inc., A Division of Laguna Clay Co.

WASHER Accuratus Ceramic Corporation Advanced Ceramic Technology Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics Brim Electronics Inc. Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Morgan AM&T ¨ O’Keefe Ceramics Wesgo/Duramic Products, Morgan Technical Ceramics

Component Listings WATER FILTRATION COMPONENT ¨ Akron Porcelain & Plastics Co. Filtros Ltd. International Ceramic Engineering, Advanced Ceramics Division

¨

WEAR PAD

¨ ¨

¨ ¨ ¨

Accuratus Ceramic Corporation Advanced Ceramic Technology Astro-Met Inc. Ceradyne Inc. Ceramco Inc. Ceramic Systems Inc. CoorsTek Inc., International Headquarters Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Small Precision Tools Superior Technical Ceramics Corp. Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics Zircoa Inc.

WEAR PLATE Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology Astro-Met Inc. ¨ Ceradyne Inc. Ceramco Inc. ¨ Ceramic Solutions Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics ¨ Saint-Gobain Ceramic Materials, High Performance Refractories ¨ Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products ¨ Technical Products Inc. Zircoa Inc.

WEAR-RESISTANT COMPONENT Accuratus Ceramic Corporation ¨ AdValue Technology LLC

¨ ¨

¨

¨

¨

Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. Blasch Precision Ceramics Ceradyne Inc. Ceramaterials Ceramco Inc. Ceramic Solutions Inc. Ceramic Systems Inc. CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components O’Keefe Ceramics Pacific Technology Exchange Reade Advanced Materials Refractron Technologies Corp. Saint-Gobain Ceramics, Structural Ceramics, Hexoloy® Products Silicon Carbide Products Superior Technical Ceramics Corp. Technical Products Inc. UCM Advanced Ceramics GmbH, A member of IMERYS Wesgo/Duramic Products, Morgan Technical Ceramics Zircoa Inc.

MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Phoenix Coating Resources Inc. Reade Advanced Materials Refractron Technologies Corp. ¨ Small Precision Tools Superior Technical Ceramics Corp. ¨ Technical Products Inc. UCM Advanced Ceramics GmbH, A member of IMERYS Zircoa Inc.

YTTRIUM OXIDE COMPONENT Anderman Ceramics ¨ Bullen ¨ Ceradyne Inc. Ceramic Systems Inc. Ferro-Ceramic Grinding Inc. Goodfellow Corp. HAI Advanced Material Specialists Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Quartzite Processing Inc. Reade Advanced Materials UCM Advanced Ceramics GmbH, A member of IMERYS

YTZP BLANK

WELD LOCATION PIN Accuratus Ceramic Corporation Astro-Met Inc. ¨ Ceradyne Inc. Ceramco Inc.

¨

WIRE NUT Ceramco Inc.

YTTRIA-STABILIZED ZIRCONIA COMPONENT Accuratus Ceramic Corporation ¨ AdValue Technology LLC Anderman Ceramics Astro-Met Inc. Ceramco Inc. ¨ CoorsTek Inc., International Headquarters ENrG Incorporated Ferro-Ceramic Grinding Inc. Goodfellow Corp. HAI Advanced Material Specialists Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc.

¨ ¨ ¨

Anderman Ceramics Astro-Met Inc. Ceramco Inc. CoorsTek Inc., International Headquarters Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. O’Keefe Ceramics Refractron Technologies Corp. Small Precision Tools Superior Technical Ceramics Corp. Technical Products Inc.

ZIRCONIA COMPONENT Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. Blasch Precision Ceramics ¨ Ceradyne Inc. Ceramco Inc. Ceramic Systems Inc. ¨ CoorsTek Inc., International Headquarters ENrG Incorporated

CERAMIC COMPONENTS DIRECTORY ³ 2011

57

Component Listings Ferro-Ceramic Grinding Inc. Goodfellow Corp. HAI Advanced Material Specialists Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Quartzite Processing Inc. Reade Advanced Materials Refractron Technologies Corp. ¨ Small Precision Tools Superior Technical Ceramics Corp. ¨ Technical Products Inc. UCM Advanced Ceramics GmbH, A member of IMERYS Zircoa Inc.

ZIRCONIA OXIDE COMPONENT Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc.

Ceramco Inc. ENrG Incorporated Ferro-Ceramic Grinding Inc. Goodfellow Corp. HAI Advanced Material Specialists Inc. Hoover Precision Products Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components MemPro Ceramics Corporation Phoenix Coating Resources Inc. Quartzite Processing Inc. Reade Advanced Materials ¨ Small Precision Tools ¨ Technical Products Inc. UCM Advanced Ceramics GmbH, A member of IMERYS Zircoa Inc.

¨ ¨

¨

¨ ¨

Anderman Ceramics Astro-Met Inc. Ceradyne Inc. CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components O’Keefe Ceramics Quartzite Processing Inc. Reade Advanced Materials SMAHT Ceramics Inc. Small Precision Tools Superior Technical Ceramics Corp. Technical Products Inc. Zircoa Inc.

ZIRCONIA-TOUGHENED ALUMINA COMPONENT Accuratus Ceramic Corporation Advanced Ceramic Technology

Professional Services ADVANCED CERAMICS ¨

¨ ¨

¨

58

Accuratus Ceramic Corporation AdValue Technology LLC Anderman Ceramics APC International Ltd., American Piezo Ceramics Astro-Met Inc. Bolt Technical Ceramics, Morgan Technical Ceramics Bullen Ceramaterials Ceramic Solutions LLC CoorsTek Inc., International Headquarters ENrG Incorporated Ferro-Ceramic Grinding Inc. Goodfellow Corp. HAI Advanced Material Specialists Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division Kurt J. Lesker Company MarkeTech International Inc., Engineered Ceramic Components O’Keefe Ceramics Sonic-Mill

¨ Superior Graphite, Advanced Materials ¨ Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

ALUMINUM OXIDE MACHINING Accuratus Ceramic Corporation ¨ AdValue Technology LLC Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. ¨ Bullen ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Sonic-Mill Superior Technical Ceramics Corp. ¨ Technical Products Inc.

WWW.CERAMICINDUSTRY.COM/CCD

Wesgo/Duramic Products, Morgan Technical Ceramics

ASSEMBLY ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division

ASSEMBLY, CLEAN-ROOM ¨ CoorsTek Inc., International Headquarters Superior Technical Ceramics Corp.

BONDING Advanced Ceramic Technology ¨ CoorsTek Inc., International Headquarters Kurt J. Lesker Company Superior Technical Ceramics Corp.

BORON NITRIDE MACHINING Accuratus Ceramic Corporation Advanced Ceramic Technology Ferro-Ceramic Grinding Inc. Goodfellow Corp.

Professional Services International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics Sonic-Mill Superior Technical Ceramics Corp. ¨ Technical Products Inc.

BRAZING Advanced Ceramic Technology ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. MarkeTech International Inc., Engineered Ceramic Components Superior Technical Ceramics Corp.

CLEANING/SURFACE PREPARATION Advanced Ceramic Technology HAI Advanced Material Specialists Inc.

CNC Milling

¨ ¨

¨

¨

Accuratus Ceramic Corporation Advanced Ceramic Technology Astro-Met Inc. Bullen CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division O’Keefe Ceramics Sonic-Mill Superior Technical Ceramics Corp. Technical Products Inc.

¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics Superior Technical Ceramics Corp. ¨ Technical Products Inc.

COATING ¨ CoorsTek Inc., International Headquarters Crystallume Eng. Diamond Prod. Goodfellow Corp. SMAHT Ceramics Inc.

COATING SERVICES ¨ CoorsTek Inc., International Headquarters Crystallume Eng. Diamond Prod. Goodfellow Corp.

CONSULTANTS APC International Ltd., American Piezo Ceramics Ceramaterials Ceramic Solutions LLC ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. ¨ NSL Analytical Services Ruark Engineering Inc.

CONTRACTUAL Advanced Ceramic Technology APC International Ltd., American Piezo Ceramics Ceramco Inc.

CURING Advanced Ceramic Technology Holland Mfg.

Swiss Screw Machining

DESIGN

¨ CoorsTek Inc., International Headquarters ¨ Technical Products Inc.

AdTech Ceramics APC International Ltd., American Piezo Ceramics ¨ CoorsTek Inc., International Headquarters

Turning Accuratus Ceramic Corporation Advanced Ceramic Technology Astro-Met Inc.

EDUCATION Ceramic Solutions LLC

ENGINEERING, CUSTOM FABRICATION ¨ AdValue Technology LLC APC International Ltd., American Piezo Ceramics ¨ Ceradyne Inc. Ceramaterials Ceramic Solutions LLC ¨ CoorsTek Inc., International Headquarters ENrG Incorporated Ferro-Ceramic Grinding Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Keith Company Morgan Thermal Ceramics ¨ O’Keefe Ceramics Recco Furnaces SMAHT Ceramics Inc. ¨ Superior Graphite, Advanced Materials Superior Quartz Products Inc., Ceramics & Glass Machinery Division

EXTRUSION Industrial Ceramic Products Inc. Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials

FEASIBILITY STUDIES Ceramic Solutions LLC

FIXTURING ¨ O’Keefe Ceramics Wesgo/Duramic Products, Morgan Technical Ceramics

FORMULATION DEVELOPMENT, CERAMIC COATINGS Phoenix Coating Resources Inc. TPL Inc. ¨ Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc.

GLASSBLOWING, TECHNICAL Goodfellow Corp. Superior Quartz Products Inc., Ceramics & Glass Machinery Division

CERAMIC COMPONENTS DIRECTORY ³ 2011

59

Professional Services GRINDING

¨ ¨ ¨

¨

¨

Accuratus Ceramic Corporation Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. Bullen Ceradyne Inc. CoorsTek Inc., International Headquarters Elizabeth Carbide Components Ferro-Ceramic Grinding Inc. Glen Mills Inc. Goodfellow Corp. Holland Mfg. International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components O’Keefe Ceramics Powder Technology Inc. Sonic-Mill Superior Quartz Products Inc., Ceramics & Glass Machinery Division Superior Technical Ceramics Corp.

¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Elizabeth Carbide Components Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. ¨ O’Keefe Ceramics Powder Technology Inc. Sonic-Mill Superior Quartz Products Inc., Ceramics & Glass Machinery Division Superior Technical Ceramics Corp. ¨ Technical Products Inc.

Cylindrical

¨ ¨

Centerless

¨ ¨

¨

¨

Accuratus Ceramic Corporation Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. Ceradyne Inc. CoorsTek Inc., International Headquarters Elizabeth Carbide Components Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components O’Keefe Ceramics Superior Quartz Products Inc., Ceramics & Glass Machinery Division Superior Technical Ceramics Corp. Technical Products Inc.

Custom Accuratus Ceramic Corporation Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc. ¨ Bullen

60

¨

¨

Accuratus Ceramic Corporation Advanced Ceramic Technology Astro-Met Inc. Ceradyne Inc. CoorsTek Inc., International Headquarters Elizabeth Carbide Components Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components O’Keefe Ceramics Superior Quartz Products Inc., Ceramics & Glass Machinery Division Superior Technical Ceramics Corp. Technical Products Inc.

Fine Accuratus Ceramic Corporation Anderman Ceramics Astro-Met Inc. ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Elizabeth Carbide Components Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc.

WWW.CERAMICINDUSTRY.COM/CCD

MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Powder Technology Inc. Superior Technical Ceramics Corp. ¨ Technical Products Inc.

HEAT TREATING International Ceramic Engineering, Advanced Ceramics Division Keith Company Recco Furnaces SMAHT Ceramics Inc. ¨ Superior Graphite, Advanced Materials Superior Quartz Products Inc., Ceramics & Glass Machinery Division

HONING Advanced Ceramic Technology Astro-Met Inc. ¨ Ceradyne Inc. Elizabeth Carbide Components Ferro-Ceramic Grinding Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division Superior Quartz Products Inc., Ceramics & Glass Machinery Division Superior Technical Ceramics Corp.

HONING, FLAT Astro-Met Inc. International Ceramic Engineering, Advanced Ceramics Division Superior Quartz Products Inc., Ceramics & Glass Machinery Division Superior Technical Ceramics Corp.

INJECTION MOLDING ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Ceramco Inc. Goodfellow Corp. Industrial Ceramic Products Inc. International Ceramic Engineering, Advanced Ceramics Division ¨ Small Precision Tools

LABORATORY TESTING ¨ CoorsTek Inc., International Headquarters

Professional Services Micron Inc. NETZSCH Instruments NA LLC ¨ NSL Analytical Services SMAHT Ceramics Inc. TPL Inc.

LAPPING Advanced Ceramic Technology Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters Elizabeth Carbide Components Ferro-Ceramic Grinding Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Superior Technical Ceramics Corp. ¨ Technical Products Inc.

MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics

LAPPING AND POLISHING Advanced Ceramic Technology Astro-Met Inc. ¨ Bullen ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components

¨ O’Keefe Ceramics Sonic-Mill

LASERING ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division

Laser Cutting ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division


Flat Advanced Ceramic Technology Astro-Met Inc. Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Sonic-Mill ¨ Technical Products Inc.

Production Astro-Met Inc. Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division

)\TIVMIRGIHEREP]WMWSJ%HZERGIHGIVEQMG QEXIVMEPWMRGPYHMRKEPYQMREQEKRIWME^MVGSRME GEVFMHIWRMXVMHIWERHS\MHIW 7TIGMEPM^IH8IWXMRK'ETEFMPMXMIW 'SQTSWMXMSREP%REP]WMW )PIQIRXEPERH'LIQMGEP%REP]WMW 1MGVSWGST]ERH7)1 8LIVQEP%REP]WMW %REP]XMGEP)\TIVXMWI 8VEGI0IZIP%REP]WMW &YPO'SQTSWMXMSR 8LIVQEP'SRHYGXMZMX] 'SRXEQMRERXW -RGPYWMSRW *EMPYVI%REP]WMW

[[[RWPEREP]XMGEPGSQ 270%REP]XMGEP7IVZMGIW-RG 'VER[SSH4EVO[E]'PIZIPERH3, 8VERWTSVXEXMSR&PZH'PIZIPERH3, 8SPP*VIIˆXIGLWEPIW$RWPEREP]XMGEPGSQ

8VYWX ` 8IGLRSPSK]  ` 8YVREVSYRH CERAMIC COMPONENTS DIRECTORY ³ 2011

61

Professional Services ¨ Technical Products Inc.

Laser Drilling ¨ Bullen ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division ¨ Technical Products Inc.

Laser Engraving Astro-Met Inc. ¨ CoorsTek Inc., International Headquarters International Ceramic Engineering, Advanced Ceramics Division ¨ Technical Products Inc.

Laser Machining ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division ¨ Technical Products Inc.

Laser Marking ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics ¨ Technical Products Inc.

Laser Micromachining ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp.

Laser Scribing ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division ¨ Technical Products Inc.

LEAD/CADMIUM TESTING ¨ CoorsTek Inc., International Headquarters

MACHINING

Advanced Ceramic Technology ¨ Akron Porcelain & Plastics Co. Anderman Ceramics Astro-Met Inc. ¨ Bullen ¨ Ceradyne Inc. ¨ CoorsTek Inc., International Headquarters Elizabeth Carbide Components Ferro-Ceramic Grinding Inc. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components Sonic-Mill Superior Quartz Products Inc., Ceramics & Glass Machinery Division Superior Technical Ceramics Corp. ¨ Technical Products Inc.

HAI Advanced Material Specialists Inc.

PLATING ¨ CoorsTek Inc., International Headquarters MarkeTech International Inc., Engineered Ceramic Components Superior Technical Ceramics Corp.

PROTOTYPING

¨ ¨

MARKET RESEARCH Ceramaterials Insaco MarkeTech International Inc., Engineered Ceramic Components

¨ ¨

Accuratus Ceramic Corporation APC International Ltd., American Piezo Ceramics Astro-Met Inc. Ceradyne Inc. Ceramic Solutions LLC CoorsTek Inc., International Headquarters ENrG Incorporated Ferro-Ceramic Grinding Inc. Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division O’Keefe Ceramics Technical Products Inc. Wesgo/Duramic Products, Morgan Technical Ceramics

MATERIALS ANALYSIS

QUARTZ ENGINEERING, CUSTOM

Anderman Ceramics Ceramic Solutions LLC ¨ CoorsTek Inc., International Headquarters HAI Advanced Material Specialists Inc. Micron Inc. ¨ NSL Analytical Services SMAHT Ceramics Inc.

¨ AdValue Technology LLC Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Superior Quartz Products Inc., Ceramics & Glass Machinery Division ¨ Technical Products Inc.

METALLIZATION

QUARTZ FABRICATION, CUSTOM

¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. Goodfellow Corp. HAI Advanced Material Specialists Inc. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Superior Technical Ceramics Corp.

¨ AdValue Technology LLC Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division Superior Quartz Products Inc., Ceramics & Glass Machinery Division ¨ Technical Products Inc.

PACKAGING, CERAMIC ENrG Incorporated

Accuratus Ceramic Corporation

62

PLASMA SURFACE TREATMENT

WWW.CERAMICINDUSTRY.COM/CCD

RAPID PROTOTYPING ¨ Bullen ¨ CoorsTek Inc., International Headquarters Ferro-Ceramic Grinding Inc. International Ceramic Engineering, Advanced Ceramics Division

Professional Services MarkeTech International Inc., Engineered Ceramic Components Silicon Carbide Products

RESEARCH AND DEVELOPMENT ¨ Ceradyne Inc. Ceramaterials Ceramic Solutions LLC ENrG Incorporated ¨ NSL Analytical Services ¨ O’Keefe Ceramics SMAHT Ceramics Inc. TPL Inc.

SEALING ¨ CoorsTek Inc., International Headquarters Superior Quartz Products Inc., Ceramics & Glass Machinery Division

SEALING, CERAMIC-TO-METAL AdTech Ceramics ¨ CoorsTek Inc., International Headquarters Goodfellow Corp. International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Superior Technical Ceramics Corp.

SILICON CARBIDE MACHINING Accuratus Ceramic Corporation Advanced Ceramic Technology ¨ Bullen ¨ Ceradyne Inc. Ceramaterials ¨ CoorsTek Inc., International Headquarters Elizabeth Carbide Components Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division

Machined Ceramics Inc. MarkeTech International Inc., Engineered Ceramic Components ¨ O’Keefe Ceramics Sonic-Mill ¨ Superior Graphite, Advanced Materials

SILICON NITRIDE MACHINING Accuratus Ceramic Corporation Advanced Ceramic Technology ¨ Bullen ¨ Ceradyne Inc. Ceramaterials Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division MarkeTech International Inc., Engineered Ceramic Components Sonic-Mill

STANDARDS FOR MATERIALS ¨ NSL Analytical Services

TAPE CASTING ¨ CoorsTek Inc., International Headquarters Du-Co Ceramics Co.

TECHNOLOGY TRANSFER & LICENSING Ceramaterials Ceramic Solutions LLC

TESTING Micron Inc. NETZSCH Instruments NA LLC ¨ NSL Analytical Services

TOOLING

Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics Superior Quartz Products Inc., Ceramics & Glass Machinery Division

TUBE POLISHING Advanced Ceramic Technology Astro-Met Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division ¨ O’Keefe Ceramics

TUMBLE COATING Insaco

ULTRASONIC MACHINING Accuratus Ceramic Corporation Astro-Met Inc. ¨ Bullen Ferro-Ceramic Grinding Inc. Goodfellow Corp. Insaco International Ceramic Engineering, Advanced Ceramics Division Machined Ceramics Inc. Sonic-Mill

WEARPROOFING ¨ CoorsTek Inc., International Headquarters Crystallume Eng. Diamond Prod.

WEARPROOFING, TUNGSTEN CARBIDE Cancarb Ltd.

Elizabeth Carbide Components

TUBE GRINDING

WEBSITE Anderman Ceramics

Accuratus Ceramic Corporation Advanced Ceramic Technology Anderman Ceramics Astro-Met Inc.

List your company in the 2012-2013 Ceramic Components Directory! Contact Amy Vallance at (281) 550-5855 or [email protected] for pricing and additional details. CERAMIC COMPONENTS DIRECTORY ³ 2011

63

Address Index Accuratus Ceramic Corporation 35 Howard St., Phillipsburg, NJ 08865 (908) 213-7070 Fax: (908) 213-7069 [email protected] www.accuratus.com Bruce Cunningham, Mktg. Mgr.; Larry Treusch, Ceramic Engr.; Lorraine Simonof, Cust. Serv. Mgr. Precision ceramic and glass component supplier. Distributes Macor machinable glass-ceramic. Manufactures Accuflect light-reflecting ceramic.

AdTech Ceramics 511 Manufacturers Rd., Chattanooga, TN 37405-3203 (423) 755-5400 Fax: (423) 755-5438 [email protected] www.adtechceramics.com Brian Bukovitz, Sales Mgr. Custom multilayer HTCC and AlN for high-reliability applications. Microwave modeling, injection molding and chemical milling products also available.

AdValue Technology LLC 3470 S. Dodge Blvd., Tucson, AZ 85713 (520) 514-1100 Fax: (520) 747-4024 [email protected] www.advaluetech.com Jenny Wang, Mktg./Sales Mgr. A leading supplier of alumina, zirconia, and fused quartz products, including crucibles, tubes, plates, thermal analysis sample pans, and other customfabricated components. SEE OUR AD ON PAGE 35

64

WWW.CERAMICINDUSTRY.COM/CCD

Advanced Ceramic Technology 803 W. Angus Ave., Orange, CA 92868 (714) 538-2524 Fax: (714) 538-2589 [email protected] www.advancedceramictech.com Eric A. Roberts, Pres.; William W. Roberts, V.P. Manufactures and machines precision ceramic components for aerospace, laser, semiconductor, and other industrial applications. Advanced Composite Materials LLC 1446 S. Buncombe Rd., Greer, SC 29651 (864) 877-0123 Fax: (864) 879-6615 [email protected] www.acm-usa.com or www.silarwave.com Kevin Fox, Acct. Rep. Produces silicon carbide whisker and reinforced ceramics. Products include cutting tools and fracture- and wear-resistant, electrically conductive, microwave, RF ceramics. In addition, now marketing ceramic additives into other markets such as polymers.

Akron Porcelain & Plastics Co. 2739 Cory Ave., Akron, OH 44314-1308 (330) 745-2159 Fax: (330) 745-6688 [email protected] or [email protected] www.akronporcelain.com Ken Burkins, V.P.-Sales/Mktg.; Craig Gohlke, Sales Admin. Mgr. Custom molder and assembler of industrial ceramics specializing in electrical, refractory, and foundry applications. SEE OUR AD ON PAGE 43

Get the free app at http://gettag.mobi to view mobile tags.

Address Index Anderman Ceramics 600 Industrial Park Dr., Saint Albans, VT 05478 (303) 772-0975 Fax: (303) 558-3821 [email protected] or [email protected] www.earthwaterfire.com Dick Ranney, North American Sales; Dr. John Verrier, CEO; Michael Jackson, Sales Mgr. Offers a comprehensive variety of ceramic materials and shapes in alumina, mullite, cordierite, zirconia, silicon carbide, corundum, porous mullite, and refractory grades. APC International Ltd., American Piezo Ceramics P.O. Box 180, Duck Run, Mackeyville, PA 17750 (570) 726-6961 Fax: (570) 726-7466 [email protected] www.americanpiezo.com Ron Staut, V.P.-Tech.; Richard M. Brooks, Tech Sales Manufacturer of high-quality custom shape and size piezoelectric ceramics of PZT compositions, engineering and transducer design services, piezo products.

!STRO-ET )NC Astro-Met Inc. 9974 Springfield Pike, Cincinnati, OH 45215 (513) 772-1242; (800) 706-8849 Fax: (513) 772-9080 [email protected] www.astromet.com Frank Gorman Manufacturer specializing in prototype and production quantities of alumina, zirconia, ZTA, and machinable ceramic components to customer specifications.

Boca Bearing Company 755 N.W. 17th Ave. #107, Delray Beach, FL 33445 (800) 332-3256; (561) 998-0004 [email protected] www.bocabearings.com Jason Flanzbaum, V.P.-Mktg.; Allen Baum, Pres. An industry leader in ceramic hybrid and full ceramic bearings since 1987.

Bolt Technical Ceramics, Morgan Technical Ceramics 26 Madison Rd., Fairfield, NJ 07004 (973) 227-8877 Fax: (973) 227-7135 [email protected] www.morgantechnicalceramics.com Kevin McAloon, A.E. Mgr.; Jerry McConvery, Gen. Mgr. Distributor of both standard and custom ceramic rollers, tubes and insulators. Materials include alumina, mullite, fused silica and silicon carbide. Brim Electronics Inc. 120 Home Pl., Lodi, NJ 07644 (201) 796-2886 Fax: (973) 778-2792 [email protected] www.brimelectronics.com B. Brown, Sales Mgr.; M. Aaron, Sales Ceramic insulators (porcelain and steatite), including stand-off, feed-thru, antenna, bead, airplane, strain, knob, suspension strain lead-in, bowl, cone and corrugated types.

Blasch Precision Ceramics 580 Broadway, Albany, NY 12204 (800) 550-5768; (518) 436-1263 Fax: (518) 436-0098 [email protected] www.blaschceramics.com Ted Collins, V.P.-Sales/Mktg.; Mickey Lavicska, Dir.-Mktg.-Global Spec. Prod. Designs and produces net shape refractory and ceramic components/systems for a variety of manufacturing and processing industries, including mining, power generation, molten metal, and petrochemical. Specializes in solving applications concerning the wear, erosion, thermal shock and wetting (non-wetting) of molten metals.

-View expanded online listings for these companies at www.ceramicindustry.com/CCD

CERAMIC COMPONENTS DIRECTORY ³ 2011

65

Address Index ®

-Bullen 1301 Miller Williams Rd., Eaton, OH 45320 (937) 456-7133 Fax: (937) 456-2779 [email protected] or [email protected] www.bullentech.com Greg Fitch, Dir.-Bus. Devel.; Jim Vidic, Sales Engr.; Tom Fote, Dir.-Bus. Devel.; Tom Fraga, Sales Engr. Precision micro-machining and finishing of hard, brittle materials, including glass, quartz, sapphire and technical ceramics. Double-sided polished glass blanks. Prototype through production capabilities. Technical expertise to support material and machining process selection. SEE OUR AD ON PAGE 3 Cancarb Ltd. 1702 Brier Park Cres. N.W. Medicine Hat, AB T1C 1T8 CANADA (403) 527-1121 Fax: (403) 529-6093 www.cancarb.com Randy LeClair, Mgr.-Mktg. High-purity carbon for use in the production of metal carbides, ceramics and refractories, and as hightemperature furnace insulation.

Ceradyne Inc. 3169 Red Hill Ave., Costa Mesa, CA 92626 (714) 549-0421 Fax: (714) 549-5787 [email protected] www.ceradyne.com Cheryl Brayman, Sr. Sales Mgr. Develops, manufactures, and markets advanced technical ceramic products and components for defense, industrial, automotive, oil and gas, nuclear power, and solar energy applications. SEE OUR AD ON PAGE 5 Ceramaterials 226 Rte. 209, Port Jervis, NY 12771 (518) 701-6722 Fax: (718) 569-6475 [email protected] www.ceramaterials.com Jerry Weinstein, Pres. Markets and stocks high-quality graphite and carbon insulation, ceramic insulation, moly and tungsten products, machined graphite, sintered ceramics, and furnace-related supplies. Ceramco Inc. P.O. Box 300, Center Conway, NH 03813-0300 (603) 447-2090 Fax: (603) 447-3906 [email protected] www.ceramcoceramics.com Ruth Hamilton, Admin. Asst.; Sherry Madore, Office Mgr.; Thomas Henriksen, Pres.; Mike Leathem, Production Mgr. Has been injection molding (CIM) technical ceramics for 30 years using alumina, zirconia, mullite, and refractory type ceramics. Prototyping and low-volume CIM work is done with low-pressure molding and precision diamond grinding. Production and high-volume work is done in a vertically integrated high-pressure molding technology unit.

66

WWW.CERAMICINDUSTRY.COM/CCD

Get the free app at http://gettag.mobi to view mobile tags.

Address Index

Ceramic Solutions Inc. 12621 Hwy. 105 W., Ste. 301, Conroe, TX 77304 (936) 588-2646 Fax: (936) 588-2688 [email protected] or [email protected] www.ceramicsolutionsconroe.com Bill Bolt, Pres. Utilizes decades of experience as a quick turnaround, customer-oriented, technical ceramic distributor. A large inventory at competitive pricing eliminates long lead times for standard stock items. Custom parts are also available. SEE OUR AD ON THE IFC Ceramic Solutions LLC 76 Brentwood Rd., Fremont, NH 03044-3587 (719) 433-2282 [email protected] www.ceramicsolutionsusa.com Gary D. Millsap, Ceramic Engr.-MBA/Principal Utilizing 25 years of experience to service the advanced ceramic industry’s needs for consulting, fabrication, feasibility, research and development, and technology transfer. Ceramic Systems Inc. 2185 E. Wells Rd., Caro, MI 48723-9561 (989) 673-7338 Fax: (989) 673-7349 [email protected] ceramicsystems.com Specializes in custom-made ceramic components in both large and small quantities.

-View expanded online listings for these companies at www.ceramicindustry.com/CCD

- CoorsTek Inc., International Headquarters 16000 Table Mountain Pkwy., Golden, CO 80403 (303) 271-7000 Fax: (303) 271-7009 www.coorstek.com Harrison Hartman, Mktg. Mgr.; Jim Scheinle, Prod. Mgr. The largest technical ceramics manufacturer in North America. Designs, manufactures, assembles and delivers critical components for technology-leading OEMs worldwide. SEE OUR AD ON THE OBC

Cotronics Corp. 131-47th St., Brooklyn, NY 11232 (718) 788-5533 Fax: (718) 788-5538 [email protected] www.cotronics.com Beth Adams; Alan Marks Manufactures high-temp adhesives, ceramics and specialty materials, including castables, potting compounds, and conductive and insulating compounds. Crystallume Eng. Diamond Prod. 3397 De La Cruz Blvd., Santa Clara, CA 95054-2607 (800) 789-4322; (408) 653-1700 Fax: (408) 653-1710 www.crystallume.com Manuel Guevara, Mgr. Provides diamond-coated carbide tools for green machining of ceramic materials. Also provides diamond, DLC and PVD coatings for increased wear and corrosion resistance.

CERAMIC COMPONENTS DIRECTORY ³ 2011

67

Address Index

Du-Co Ceramics Co. 155 S. Rebecca St., P.O. Box 568, Saxonburg, PA 16056 (724) 352-1511 Fax: (724) 352-1266 www.du-co.com Thomas W. Arbanas Manufacturer of dry pressed and extruded forms with secondary machining operations. Steatite, cordierite, alumina, porcelain, MGO and forsterite material. Elizabeth Carbide Components 200 Monastery Dr., Latrobe, PA 15650 (724) 539-3574 Fax: (724) 537-4732 [email protected] www.ecarbco.com Kenneth Plunko, Sales Mgr. Custom manufactures various types of precision tooling, wear parts and specialty components from tungsten carbide, ceramic, and tool steel. ENrG Incorporated 155 Rano St., Ste. 300, Buffalo, NY 14207 (716) 873-2939 x210 Fax: (716) 873-3196 [email protected] www.enrg-inc.com Kathy Olenick, Sales/Mktg.; Dr. Venkat Venkateswaran, R&D Develops and manufactures critical ceramic components for diverse energy applications. Thin, strong, flexible ceramic membranes, with and without coatings, ensure durability. Integrated packaging and thermal management solution enables system management of heat transfer, insulation and air manifolding with one component. Porous ceramic substrates with high flux function as separation membranes or filters for improved environmental control. Esprix Technologies 7680 Matoaka Rd., Sarasota, FL 34243 (941) 355-5100; (800) 237-7748 Fax: (941) 358-1339 [email protected] or [email protected] www.esprixtech.com Marianne Cowger, Admin.; Philip W. Nace, Jr., Pres.; Brian Roberts, Sr. V.P. A global provider of high-performance chemistries to the following industries: toner, ink, coating, pharmaceutical and automotive.

68

WWW.CERAMICINDUSTRY.COM/CCD

Ferro-Ceramic Grinding Inc. 247 Water St., Wakefield, MA 01880 (800) 282-1833 Fax: (781) 246-1429 [email protected] or [email protected] www.ferroceramic.com Mark Belanger, Sales Mgr.; Keith Costello, Bus. Dev. Established 1966. AS9100-ISO9002, provides ceramic component/machining inventory of materials, including BN, Macor, alumina, SiC, silicon nitride, sapphire, quartz, AIN and more.

Filtros Ltd. 603 W. Commercial St., P.O. Box 389 East Rochester, NY 14445 (800) 633-2143 Fax: (585) 586-7154 www.filtrosltd.com Ceramic manufacturer of adaptable products, including filtration, diffusion, conveying, fluidizing, venting, electropolytic, diaphragms, vacuum chuck, porous plugs, kiln furniture and specialty refractory shapes.

Glen Mills Inc. 220 Delawanna Ave., Clifton, NJ 07014-1550 (973) 777-0777 Fax: (973) 777-0070 [email protected] www.glenmills.com Stanley Goldberg, Dir.; Douglas Ahrens, Sales Exec. Markets laboratory and pilot-sized grinding mills, the TURBULA Shaker-Mixer, sieves, sample dividers and grinding media in all materials. SEE OUR AD ON PAGE 40

Get the free app at http://gettag.mobi to view mobile tags.

Address Index

- Goodfellow Corp.

Hoover Precision Products P.O. Box 899, 2200 Pendley Rd., Cumming, GA 30041 (770) 889-9223 Fax: (770) 889-0828 [email protected] www.hooverprecision.com Manufacturer of silicon nitride, alumina and zirconia ceramic balls for various applications.

305 High Tech Dr., Oakdale, PA 15071-3911 (800) 821-2870; (724) 695-7060 Fax: (800) 283-2020; (724) 695-7063 [email protected] www.goodfellowusa.com or www.technicalglass.co.uk Global supplier of metals and materials for research, product design and prototyping offers ceramic components, ceramic materials, and specialist glass through its acquisition of UK-based The Technical Glass Co.

Industrial Ceramic Products Inc. 14401 Suntra Way, Marysville, OH 43040 (800) 427-2278; (937) 642-3897 Fax: (937) 644-2646 www.industrialceramic.com R. C. Oberst, Pres.; John Odenthal, Oper. Mgr. Manufactures technical refractories primarily for use in metal casting applications. Capabilities include extrusion, compression molding and injection molding.

Advanced Material Specialists, Inc.

HAI Advanced Material Specialists Inc. 1688 Sierra Madre Cir., Placentia, CA 92870 (877) 411-8971 Fax: (877) 411-8778 [email protected] or [email protected] www.haiams.com Daren Gansert, Pres.; Dale Gilbert, Natl. Sales Mgr. Supplier of thermal spray powders, wires, equipment and systems. Heatron Inc. 3000 Wilson Ave., Leavenworth, KS 66048 (913) 651-4420 Fax: (913) 651-5252 [email protected] or [email protected] www.heatron.com Brent Goss, Inside Sales; Brad Collard, Inside Sales International designer and manufacturer of custom heating element components for OEM applications such as medical devices, lab equipment, semiconductor processing, thermal management, and LED lighting design and assembly.

Insaco P.O. Box 9006, Quakertown, PA 18951-9006 (215) 536-3500 Fax: (215) 536-7750 www.insaco.com Scott Mittl, Sales Engr.; Klaus Burckhardt, Sales Engr. A precision machining company that fabricates parts from all technical ceramics, sapphire and quartz to meet customer specifications. Insulation Specialties of America 1095 Kabert Dr., Wanatah, IN 46390 (219) 733-2502 Fax: (219) 733-2300 [email protected] www.insulationspecialties.com Mike Misch Manufacturer of vacuum-formed ceramic fiber boards and shapes.

Holland Mfg. P.O. Box 261, South Holland, IL 60473-0261 (708) 849-1000 Fax: (708) 849-1199 [email protected]

-View expanded online listings for these companies at www.ceramicindustry.com/CCD

CERAMIC COMPONENTS DIRECTORY ³ 2011

69

Address Index

International Ceramic Engineering, Advanced Ceramics Division 235 Brooks St., Worcester, MA 01606 (800) 779-3321; (508) 853-4700 Fax: (508) 852-4101 [email protected] www.intlceramics.com Christine Murphy, Exec. V.P./Techl. Sales; Meg Mulhern, Sr. Acct. Mgr./Engrg. Sales Solving the advanced ceramics needs of today's evolving industries. Specializes in the manufacture and fabrication of advanced ceramics and performance plastics. Intersource USA Inc. 25 Kimberly Rd., East Brunswick, NJ 08816 (732) 257-5002 Fax: (732) 257-5003 [email protected] www.intersourceusa.com or www.ceramicfiber.com Importer of ceramic fiber products including blanket, textiles, board and paper. Also imports brick and other high-temperature products. Keith Company 8323 Loch Lomond Dr., Pico Rivera, CA 90660 (562) 948-3636; (800) 545-4567 Fax: (562) 949-3696 [email protected] www.keithcompany.com Reto Fehr, Owner Manufacturer of furnaces, kilns and lehrs for the traditional ceramics, decorating, advanced materials, and electronic ceramics industries. KMI Refractories 8323 Loch Lomond Dr., Pico Rivera, CA 90660 (562) 948-3636; (800) 545-4567 Fax: (562) 949-3696 www.kmirefractories.com Reto Rehr, Owner Supplier and installer of refractory materials to the ceramic, decorating, metal casting and metal heat treating industries.

Kurt J. Lesker Company 1925 Route 51, P.O. Box 10, Clairton, PA 15025 (412) 387-9200; (800) 245-1656 Fax: (412) 384-2745 [email protected] www.lesker.com John Ross, Exec. V.P.; Dennis Sollon, V.P.-Global Sales/Mktg. Manufacturer of advanced oxide sputter targets used in applications such as battery storage, TCOs, photovoltaics, and non-volatile memory. Machined Ceramics Inc. N. Industrial Park, 629 N. Graham St. Bowling Green, KY 42101 (270) 781-0512 Fax: (270) 781-9361 www.machinedceramics.com Ken A. Mashall, Jr. Ceramic machining specialists. Prototype development and production quantities. Fast response with quotes. Expediting services available.

MarkeTech International Inc., Engineered Ceramic Components 192 N. Otto St., Port Townsend, WA 98368 (877) 452-4910; (360) 379-6707 Fax: (360) 379-6907 [email protected] www.mkt-intl.comceramicindex.html Bill Juran, V.P.; Colleen Myers, Techl. Sales; John Osborne, Gen. Mgr./Techl. Sales Precision ceramic components from alumina and oxides, including prototype parts as well as high-volume injection molded and pressed production quantities. Materion Ceramics Inc. 6100 S. Tucson Blvd., Tucson, AZ 85706 (520) 746-0251 Fax: (520) 573-9077 [email protected] www.materion.com/ceramics Lee Vandermark; Debbie Handley, Sales/Mktg. Rep A leading manufacturer of customized beryllia (BeO) ceramics serving the commercial, defense and aerospace markets. MemPro Ceramics Corporation P.O. Box 3806, Copper Mountain, CO 80443 (330) 867-2222; (888) 868-9222 Fax: (330) 867-2230 [email protected] Seth Finley, COO Manufactures fibrous materials with fiber diameters in the range of 70-150 nanometers. Also available are fibers holding catalyst particles.

70

WWW.CERAMICINDUSTRY.COM/CCD

Get the free app at http://gettag.mobi to view mobile tags.

Address Index

Metsch Refractories Inc. 12413 Ohio River Blvd., P.O. Box 268, Chester, WV 26034 (304) 387-1067 Fax: (304) 387-0555 [email protected] www.metschinc.com Timothy B. Hays, Dir.-Mktg.; Mellise H. Osterman, Dir.-Adm. Custom designs and manufactures technical and refractory ceramic components for equipment, appliances and molten metal processing. Fifty years in business and worldwide in scope. Micron Inc. 3815 Lancaster Pike, Wilmington, DE 19805 (302) 998-1184 Fax: (302) 998-1836 www.micronanalytical.com James F. Ficca, Pres.; James M. Ficca Sr., V.P. Analytical service lab offering material testing for morphology, chemistry and structure.

Morgan AM&T 441 Hall Ave., Saint Marys, PA 15857 (814) 781-1573 Fax: (814) 781-9249 www.morganamt.com J. P. Boylan, Bus. Mgr. A full-service materials company specializing in mechanical carbon and a full range of silicon carbide materials, including graphite composites. Morgan Technical Ceramics 232 Forbes Rd., Bedford, OH 44146 (440) 232-8600 Fax: (440) 232-8731 [email protected] www.morgantechnicalceramics.com Al Metcalfe, Gen. Mgr.; John Barber, Bus. Unit Mgr. Manufactures piezoelectric ceramics and added-value products, such as transducers, sensors, actuators and medical components.

-View expanded online listings for these companies at www.ceramicindustry.com/CCD

Morgan Technical Ceramics, Morgan Advanced Ceramics GBC Materials 580 Monastery Dr., Latrobe, PA 15650 (724) 537-7791 Fax: (724) 537-4910 [email protected] www.gbcmaterials.com or www.morgantechnicalceramics.com Sharon Johnson, Gen. Mgr.; Eric Larson, Mgr.-Ceramics/Glass Tech. Dry-pressed glass and alumina ceramic components in outer dimensions ranging from .020 to 2 in., designed for electronics and other applications.

Morgan Thermal Ceramics P.O. Box 923, Augusta, GA 30903 (706) 796-4200 Fax: (706) 796-4328 [email protected] www.morganthermalceramics.com or www.morganceramics.com Wendy Evans, Mktg. Comm.; Gary Recktenwald, Appl. Engr.; Jay Flynn, Mktg. Mgr. Designs, manufactures and installs a variety of engineering solutions using world-renowned insulation products. A world leader in the production of fiber, insulating firebricks (IFBs), and monolithics. Operates in over 30 countries around the world, employing more than 3000 people.

NETZSCH Instruments NA LLC 37 North Ave., Burlington, MA 01803 (781) 272-5353 Fax: (781) 272-5225 [email protected] www.netzsch-thermal-analysis.com Dave Shepard, Sales Mgr.; Rob Campbell, Lab Mgr. Testing services and instruments for thermal analysis and thermal properties measurements, including thermal conductivity, dilatometry and specific heat.

CERAMIC COMPONENTS DIRECTORY ³ 2011

71

Address Index Pacific Technology Exchange 255 Via Linda Vis, Redondo Beach, CA 90277-6409 (310) 375-0122 Fax: (310) 375-7222 [email protected] www.pacifictechex.com Dr. Harry Yeh, V.P.-Intl. Sales; Eric Walecki, Appl. Engr.; Ron Walecki, V.P.-Sales Represents ceramic manufacturers with facilities in Asia and Europe. Established in 1968.

NSL Analytical Services 4450 Cranwood Pkwy., Cleveland, OH 44128 (216) 438-5200 Fax: (216) 438-5050 [email protected] www.nslanalytical.com Dave Kluk, Techl. Mgr.; Larry Somrack, Pres.; Joan Corniuk, Techl. Serv. Rep Analytical testing of ceramics using ICP-AES, X-ray florescence, ICP-MS, trace element analysis, grain size, evaluations, wet chemistry, photo emission analysis, SEM/EDS/XRD. SEE OUR AD ON PAGE 61

-O’Keefe Ceramics 845 Research Dr., Woodland Park, CO 80863 (719) 687-0888 Fax: (719) 687-0889 [email protected] www.okeefeceramics.com Brian O’Keefe, Pres.; Kary Langer, Tech. Sales Precision fabrication of advanced ceramics; machining and grinding specialist. SEE OUR AD ON PAGE 59

72

WWW.CERAMICINDUSTRY.COM/CCD

Palmer Electronics Inc. 156 Belmont Ave., Garfield, NJ 07026-2395 (973) 772-5900 Fax: (973) 772-6054 www.palmer-electronics.com Victor R. Palmeri, Tech Dir. Manufacturer of components for the thermocouple industry. Porcelain terminal blocks and wire connectors. Cast iron heads. Phoenix Coating Resources Inc. P.O. Box 1439, 2377 State Rd. 37 S. Mulberry, FL 33860-1439 (863) 425-1430 Fax: (863) 425-1524 [email protected] www.phoenixcoatingresources.com John M. Wehrung, Pres.; Tom Nadolski, V.P. EBPVD ingots and APS powders for thermal barrier coating applications in aero-engines and gas turbines. Formulation development. ISO 9001:2008 certified.

Powder Technology Inc. 14331 Ewing Ave. S., Burnsville, MN 55306 (952) 894-8737 Fax: (952) 894-0734 www.powdertechnologyinc.com Jeff Friederichs, Sales/Mktg. Mgr. A materials processing company with expertise in the total spectrum of particle modification, specializing in air classification and jet milling. Quartzite Processing Inc. 6 Holyoke St., Malden, MA 02148-5608 (781) 322-3611 Fax: (781) 322-9623 [email protected] Brian Yanofsky, Pres. Precision grinding of ceramic materials, including ferrite, quartz, glass, aluminum oxide, silicon carbide, and load materials. Short lead times and just-in-time delivery. Custom-prototype and productions jobs.

Get the free app at http://gettag.mobi to view mobile tags.

Address Index Reade Advanced Materials P.O. Drawer 15039, Providence, RI 02915-0039 (401) 433-7000 Fax: (401) 433-7001 [email protected] www.reade.com Bethany Satterfield, Western Reg. (USA) Mgr.; Karen Ramos, Eastern Reg. (USA) Sales Mgr.; Annie Barrios, Latin America Mgr. Manufacturer, toll processor and global distributor of specialty chemical solids (ceramic, mineral, composite, metal, alloy, polymer, powder, nanoparticle, nanotube, magnetic, conductive, additives, fillers and reinforcements). Recco Furnaces 8323 Loch Lomond, Pico Rivera, CA 90660 (562) 948-3636; (800) 545-4567 Fax: (562) 949-3696 [email protected] www.reccofurnaces.com Reto Fehr Manufacturer of furnaces, kilns and lehrs for the traditional ceramics, decorating, advanced material, and electronic ceramics industries.

Saint-Gobain Ceramic Materials, High Performance Refractories M.S. 301-432, 1 New Bond St., P.O. Box 15136 Worcester, MA 01615-0136 (508) 795-5577 Fax: (508) 795-5011 [email protected] www.refractories.saint-gobain.com or www.lo-mass.com Michael Arbini, Sales/Mktg. Mgr.-N.A.; Kelleen Loewen, Comm. Dir. Manufacturer and designer of beams, batts, multi-lug posts, plates, setters, and rolls with maximum strength and low mass. ISO-9001:2000 certified. SEE OUR AD ON THE IBC

Refractron Technologies Corp. 5750 Stuart Ave., Newark, NY 14513 (315) 331-6222 Fax: (315) 331-7254 [email protected] www.refractron.com Tom Kinton, V.P.-Sales/Mktg.; Scott Bartkowski, Pres. Manufacturer of advanced engineered ceramics, including structural zirconia ceramics and porous ceramics used in severe applications. Ruark Engineering Inc. 416 Smithfield Ln., Sun City Center, FL 33573 (941) 730-2253 Fax: (941) 360-3211 [email protected] www.ruarkengineering.com Ralph Ruark, PE, Pres.; Tina Quartaroli, Ph.D., V.P. Provides kiln and dryer expertise in operation, control and analysis, as well as detailed training seminars for kiln systems operation and energy reduction.

-View expanded online listings for these companies at www.ceramicindustry.com/CCD

Saint-Gobain Ceramics, Structural Ceramics, Hexoloy ® Products 23 Acheson Dr., Niagara Falls, NY 14303-1597 (716) 278-6233 Fax: (716) 278-2373 [email protected] www.hexoloy.com Paul Faker; Steve Elliott Manufactures silicon carbide products that offer extreme hardness, high strength and excellent corrosion-resistance in a variety of shapes/sizes for a variety of applications. Other materials are also available. SEE OUR AD ON THE IBC

CERAMIC COMPONENTS DIRECTORY ³ 2011

73

Address Index

Silicon Carbide Products 361 Daniel Zenker Dr., Airport Corporate Park Horseheads, NY 14845-1008 (607) 562-8599 Fax: (607) 562-7585 [email protected] www.scprobond.com Rhett Simpson, Sr. Sales Rep.; Martin R. Metzger, Pres./Sales; Mark L. Witmer, V.P. Offers prompt quotations and on-time delivery of SCProbond custom ceramic components for demanding industrial applications. SMAHT Ceramics Inc. 181 W. 1700 South, Salt Lake City, UT 84115 (801) 483-3100 Fax: (801) 483-3101 [email protected] www.smahtceramics.com Rama Nageswaran, Pres./CEO; Brock Burke, Process Technician Specializing in exceptionally thermal-shock-resistant and machinable (NZP) ceramic products, customformed alumina, zirconia and ZTA components, and testing and consulting services.

Small Precision Tools 1330 Clegg St., Petaluma, CA 94954 (707) 762-5880 Fax: (707) 778-2271 [email protected] www.spt.net Bob Whitlock, Gen. Mgr. Leader in ceramic injection molding (CIM) of complex components with micron tolerances in small, medium, and high volume. SEE OUR AD ON PAGE 42

74

WWW.CERAMICINDUSTRY.COM/CCD

Sonic-Mill 7500 Bluewater Rd. N.W., Albuquerque, NM 87121-1962 (505) 839-3535 Fax: (505) 839-3525 [email protected] www.sonicmill.com Charlie Wilhite, Sales/Mktg. Provides machining services on ceramic and glass materials. Also manufactures and sells sinker and rotary ultrasonic machines.

sp3 Cutting Tools Inc. 3531 W. U.S. Hwy. 224, Decatur, IN 46733 (888) 547-4156; (260) 547-4150 Fax: (260) 547-4214 [email protected] www.sp3inc.com SEE OUR AD ON PAGE 41

Sunrock Ceramics Co. 2625 S. 21st Ave., Broadview, IL 60155 (708) 344-7600 Fax: (708) 344-7636 [email protected] www.sunrockceramics.com Doug Thurman, Pres. Manufacturer of pressed and cast high-alumina kiln furniture for the technical ceramics and powder metallurgy industries.

Get the free app at http://gettag.mobi to view mobile tags.

Address Index

Superior Graphite, Advanced Materials 10 S. Riverside Plz., Chicago, IL 60606 (630) 841-0099 Fax: (630) 584-5423 [email protected] www.superiorgraphite.com Dave Laughton, Prod. Mgr.-Silicon Carbide; Jorge Ayala, Bus. Devel. Mgr. Specializes in manufacturing advanced ceramic parts and lightweight SiC armor tiles in various sizes and shapes, and processing ceramic powders (unique beta SiC grain and alpha green SiC, as well as B4C, down to sub-micron sizes). SEE OUR AD ON PAGE 33

Superior Quartz Products Inc., Ceramics & Glass Machinery Division 2701 Baglyos Cir., Bethlehem, PA 18020 (610) 317-3450 Fax: (610) 317-3451 [email protected] www.sqpuv.com Dennis J. Losco, CFO/Dir.-Sales; Jeffrey W. Losco, V.P./Dir.-Engrg. Specializes in precision machining of ceramic and quartz components to customer requirements.

-View expanded online listings for these companies at www.ceramicindustry.com/CCD

Superior Technical Ceramics Corp. 600 Industrial Park Rd., Saint Albans, VT 05478 (802) 527-7726 . 27. 28 Fax: (802) 527-1181 www.ceramics.net Barbara Gleason, Sales Engr.; Brian Gold, Engrg. Mgr.; Maria Puma, Sales Engr. Custom and standard technical components, green forming, green machining, glazing and diamond grinding. Tape Casting Warehouse 1038 Lafayette Dr., Yardley, PA 19067 (215) 493-2008 Fax: (215) 321-0805 [email protected] www.drblade.com Richard E. Mistler, Pres. Consultation in technical ceramics, particularly tape casting. Supply tape casting materials and equipment.

- Technical Products Inc. P.O. Box 189, Hubertus, WI 53033 (262) 335-3635 Fax: (262) 335-3606 [email protected] www.technicalproductsinc.com One of the largest Macor distributors in the world, has been machining and distributing a wide variety of ceramics and plastics for 30 years. Focuses on attention to customer needs. SEE OUR AD ON PAGE 39

CERAMIC COMPONENTS DIRECTORY ³ 2011

75

Address Index Thorley Refractories Inc., A Division of Laguna Clay Co. 14400 Lomitas Ave., City of Industry, CA 91746 (626) 330-0631 Fax: (626) 333-7694 [email protected] www.lagunaclay.com or www.axner.com Jessie Pinedo, Sales; Jon Brooks, Pres.; Les Haworth, Sales Established in 1944, manufactures kiln furniture, including kiln shelves, posts, saggers, setters, and custom items, and custom refractory products. TPL Inc. 3921 Academy Pkwy. North N.E. Albuquerque, NM 87109-4416 (505) 342-4439 Fax: (505) 343-1797 [email protected] www.tplinc.com Trista Mosman, Dir.-Admin./Mktg.; H.M. (Hap) Stoller, Pres. Specializes in custom polymer, ceramic and composite dielectrics for advanced electrical insulation applications and capacitors.

UCM Advanced Ceramics GmbH, A member of IMERYS Ferroweg 1, Laufenburg, D79725 GERMANY 0044(0)7836 50 59 58 [email protected] www.ucm-group.com Gordon Bennett, Sales Mgr. Part of IMERYS SA of France, manufactures a range of monoclinic and stabilized zirconia grains and powders at its facility in Laufeburg, Germany. Grains and powders are manufactured by an advanced electrofusion, alloying and refining process followed by a proprietary multistage comminution and sizing process, and are available in sizes ranging from millimeters to sub-micron. Available stabilizing oxides include yttria, magnesia, scandia. ISO 9000 and TS16949 quality standards.

Wesgo/Duramic Products, Morgan Technical Ceramics 26 Madison Rd., Fairfield, NJ 07004 (973) 227-8877 Fax: (973) 227-7135 [email protected] www.morgantechnicalceramics.com Kevin McAloon, A.E. Mgr.; Jerry McConvery, Gen. Mgr. Manufacturer of custom ceramic components and fixtures. Materials include alumina, Macor, aluminum silicate, boron nitride, ZTA, aluminum titinate and silicon-converted graphite.

- Trans-Tech Inc., A Subsidiary of Skyworks Solutions Inc. 5520 Adamstown Rd., Adamstown, MD 21710 (301) 695-9400 Fax: (301) 695-7065 [email protected] www.trans-techinc.com Industry leader in the design, development and manufacture of RF ceramic products, including dielectric resonators and coaxial transmission line elements, dielectric bandpass filters, ferrites and garnet material, and ceramic-based components like isolators, circulators and coaxial filters for commercial, industrial, medical, RFIC, and homeland security markets. SEE OUR AD ON PAGE 53

76

WWW.CERAMICINDUSTRY.COM/CCD

Zircoa Inc. 31501 Solon Rd., Solon, OH 44139 (440) 248-0500 Fax: (440) 248-8864 [email protected] or [email protected] www.zircoa.com Douglas Clevenger, Bus. Mgr.; Tim Leitzel, Sales/Mktg. Mgr. Manufactures custom-engineered zirconia components with high resistance to wear and chemical attack, along with excellent thermal insulation.

Get the free app at http://gettag.mobi to view mobile tags.

Trade Associations Aerospace Industries Association 100 Wilson Blvd., Ste. 1700, Arlington, VA 22209-3901 (703) 358-1000 [email protected] www.aia-aerospace.org American Architectural Manufacturers Association 1827 Walden Office Sq., Ste. 550, Schaumburg, IL 60173 (847) 303-5664 Fax: (847) 303-5774 [email protected] www.aamanet.org American Composites Manufacturers Association 1010 North Glebe Rd., Suite 450, Arlington, VA 22201 (703) 525-0511 Fax: (703) 525-0743 [email protected] www.acmanet.org American Textile Machinery Association 201 Park Washington Ct., Falls Church, VA 22046 (703) 538-1789 [email protected] www.atmanet.org ASM Heat Treating Society/ASM International 9639 Kinsman Rd., Materials Park, OH 44073-0002 (440) 338-5151 Fax: (440) 338-4634 [email protected] www.asminternational.org Assoc. of American Ceramic Component Manufacturers (AACCM) 600 N. Cleveland Ave., Ste. 210, Westerville, OH 43082 (614) 794-5821 Fax: (614) 794-5881 [email protected] www.aaccm.org Association for the Advancement of Medical Instrumentation 4301 Fairfax Dr., Ste. 301, Arlington, VA 22203-1633 (703) 525-4890 Fax: (703) 276-0793 [email protected] www.aami.org Hydraulic Institute 6 Campus Dr., First Fr. N., Parsippany, NJ 07054 (973) 267-9700 Fax: (973) 267-9055 [email protected] www.pumps.org or www.pumplearning.org IEEE Power Engineering Society (PES) 445 Hoes Ln., Piscataway, NJ 08854-1331 (732) 562-3883 Fax: (732) 562-3881 [email protected] www.ieee.org International Frequency Sensor Association 46 Thorny Vineway, Toronto, ON M2J 4J2 CANADA (34) 659-530-601 [email protected] www.sensorsportal.com

International Microelectronics and Packaging Society (IMAPS) 611 2nd St., N.E., Washington, DC 20002 (202) 548-4001 Fax: (202) 548-6115 [email protected] www.imaps.org The International Society for Optical Engineering P.O. Box 10, Bellingham, WA 98227-0010 (360) 676-3290 Fax: (360) 647-1445 [email protected] or [email protected] www.spie.org National Association of Manufacturers (NAM) 1331 Pennsylvania Ave., N.W. Washington, DC 20004-1790 (202) 637-3000 Fax: (202) 637-3182 [email protected] www.nam.org National Defense Industrial Association (NDIA) 2111 Wilson Blvd., Ste. 400, Arlington, VA 22201 (703) 522-1820 Fax: (703) 522-1885 [email protected] www.ndia.org OSA - The Optical Society 2010 Massachusetts Ave., N.W. Washington, DC 20036-1023 (202) 223-8130 Fax: (202) 223-1096 [email protected] www.osa.org Power Sources Manufacturers Association (PSMA) P.O. Box 418, Mendham, NJ 07945-0418 (973) 543-9660 Fax: (973) 543-6207 [email protected] www.psma.com SAE International - Automotive Headquarters 755 W. Big Beaver, Ste. 1600, Troy, MI 48084 (248) 273-2455 Fax: (248) 273-2494 [email protected] www.sae.org SAE International - World Headquarters 400 Commonwealth Dr., Warrendale, PA 15096-0001 (724) 776-4841; (877) 606-7323 Fax: (724) 776-0790 [email protected] www.sae.org SEMI ® (Global Headquarters) 3081 Zanker Rd., San Jose, CA 95134 (408) 943-6900 Fax: (408) 428-9600 [email protected] www.semi.org

CERAMIC COMPONENTS DIRECTORY ³ 2011

77

Trade Associations The Society for Analytical Chemists of Pittsburgh 300 Penn Center Blvd., Ste. 332 Pittsburgh, PA 15235-5503 (412) 825-3220 Fax: (412) 825-3224 [email protected] www.sacp.org Society for Biomaterials 15000 Commerce Pkwy., Ste. C, Mount Laurel, NJ 08054 (856) 439-0826 Fax: (856) 439-0525 [email protected] www.biomaterials.org

United States Advanced Ceramics Association (USACA) 1020 19th St. N.W., Ste. 375, Washington, DC 20036 (202) 467-5459 [email protected] The Wire Association International (WAI) Inc. 1570 Boston Post Rd., P.O. Box 578, Guilford, CT 06437 (203) 453-2777 Fax: (203) 453-8384 www.wirenet.org

Know of any trade associations that should be added to this list? Please contact Susan Sutton, Editor-in-Chief, at (330) 336-4098 or [email protected]. Ad Index Advertiser

Link

Pg. No.

AdValue Technology ......................................... www.advaluetech.com ................................................. 35 Akron Porcelain & Plastics Co. ........................ www.akronporcelain.com ............................................. 43 Bullen.............................................................. www.bullentech.com...................................................... 3 Ceradyne Inc. .................................................. www.ceradyne.com ........................................................ 5 Ceramic Solutions Inc. .................................... www.ceramicsolutionsconroe.com .............................. IFC Coorstek, Inc. .................................................. www.coorstek.com .......................................................BC Glen Mills Inc. ................................................. www.glenmills.com...................................................... 40 NSL Analytical ................................................. www.nslanalytical.com ................................................ 61 O'Keefe Ceramics ............................................ www.okeefeceramics.com ............................................ 59 Saint Gobain Ceramics Structural ................... www.hexoloy.com ........................................................IBC Small Precision Tools....................................... www.spt.net................................................................. 42 SP3 Cutting Tools Inc. ..................................... www.sp3inc.com.......................................................... 41 Superior Graphite Co. ...................................... www.superiorgraphite.com .......................................... 33 Technical Products, Inc. .................................. www.technicalproductsinc.com ................................... 39 Trans-Tech Inc. ................................................ www.trans-techinc.com ............................................... 53 78

WWW.CERAMICINDUSTRY.COM/CCD

HEXOLOY SILICONCARBIDE ®

No other company in the world has more

The Name That Makes A World Of Difference

expertise with silicon carbide than Saint®

Gobain Ceramics. Our Hexoloy sintered alpha silicon carbide is the material of choice for high temperature furnace components in applications throughout the worldwide market. They include kiln support beams and tiles, thermocouple protection tubes, burner nozzles, ceramic belts, rollers for roller hearth furnaces, wear tile and liners, and custom components and special shapes. Wherever you’re located in the global market, specify Hexoloy silicon carbide, the name that delivers performance you can count on.

www.hexoloy.com

Saint-Gobain Ceramics 23 Acheson Drive Niagara Falls, NY 14303

Telephone: 716-278-6233 Fax: 716-278-2373 [email protected]

PURITY

RELIABILITY

DURABILITY

medical

automotive

advanced

technical ceramics semiconductor

To speak with our advanced technical ceramics experts call CoorsTek at +1.303.271.7000 CoorsTek provides advanced ceramic solutions for critical components from over 40 state-of-the-art manufacturing facilities in North America, South America, Europe, and Asia. Our ceramics experts help you choose the best material and design to ensure optimal performance and component life.

CoorsTek, Inc. 16000 Table Mountain Parkway Golden, CO 80403 USA

800.821.6110 Toll Free 303.271.7009 Tel

[email protected] www.coorstek.com

©2011 CoorsTek, Inc., Amazing Solutions and CoorsTek are registered trademarks of CoorsTek, Inc.

Technology Materials Manufacturing Assembly