Big Binos vs. Small Scopes: Which to Buy for What Use
p. 34
THE ESSENTIAL MAGAZINE OF ASTRONOMY
We Told You So: Amateurs Catch Predicted Nova Blowup p. 18
MAY 2010
Bring Back the
NIGHT Can we reverse light pollution? p.28
Hunting the Galaxy’s Heaviest Stars p. 22
Visit SkyandTelescope.com
Springtime Is Galaxy Time Dig Out Details in Your Images p. 72
p. 65
TeleVue.com ®
200+ Products for a Universe of Needs ( and we just added the longest Ethos focal length, 21mm! )
In this multifaceted hobby, the one interest amateur astronomers share is the desire to own well engineered products that work as intended, and deliver performance that stands the test of time. After all, isn’t that ultimately the true value of your purchase? It has been nearly thirty years since Tele Vue Plössls hit observing fields and we’re proud their performance is still rated “tops in the field.” Thirty years from now we expect our new Ethos eyepieces will still be as highly regarded as today. The same holds true for our current, highly acclaimed APO refractors, whose forbearers pioneered the concept of multipurpose, high performance, portable telescopes. Explore www.TeleVue.com. Discover a Universe of products engineered, manufactured and inspected to be “even better than you imagined.”
APO refractors 60-127mm Paracorr Coma Corrector Naglers—82° AFoV
Powermate
Tony Hallas:NP101is
New 21mm Ethos—100° AFoV Joins the 6, 8,10, 13 & 17mm Family!
Dioptrx
Starbeam
Nagler Zooms
Tim Puckett:NP127is
“Positively revolutionary...If you like wide-field eyepieces, you really have GOT to own the Ethos - ATT Nov/Dec 2009
Tim Puckett:NP127is
Filters
Dielectric Diagonals Plössl—50° AFoV
Focusmate—6:1 reduction
CCD Imaging System Radian—60° AFoV
Jim Burnell:NP127is
Sol Searcher See us at:
NEAF NORTHEAST ASTRONOMY FORUM
Suffern, NY / April 17-18
Camera Adapters
Panoptic—68° AFoV
Tele Vue Vi s i o n a r y
Air-Chair
Bino Vue
Barlows
®
32 Elkay Drive, Chester ork 10918 Chester,, New Y York worldmags & avaxhome
845.469.4551 www Vue.com www.. Tele eleV
Beautifully photographed in 4K digital cinematography, this film is a visually stunning chronicle of the history of the telescope from the time of Galileo, its profound impact upon the science of astronomy, and how both shape the way we view ourselves in the midst of an infinite universe.
Watch
April 9, 2010 Check your local listings
WATCH FOR OUR COMPANION PLANETARIUM SHOW Playing at a theater near you
BOOK & DVD Available from shopPBS.org, iTunes Store, Amazon and Barnes & Noble
Companion Compan Com panion ion bo book ok
DVD/Download DVD/Do DDVD /Downl wnloadd
Underwriting support generously provided by 400 Years of the Telescope Production Partners
WWW.400YEARS.ORG worldmags & avaxhome
May 2010 V O L . 119, N O . 5
FE ATURE S
18 Amateurs Catch
THI S M O N TH ’ S S K Y
40 43 45
Astronomers are conducting a frenetic search for our galaxy’s most massive star. By Yaël Nazé
46 48
Spectrum By Robert Naeye
8
May’s Sky at a Glance
10
Binocular Highlight
Letters 50 & 25 Years Ago By Leif J. Robinson
Planetary Almanac
12
News Notes
Sun, Moon, and Planets
58
New Product Showcase
70
Telescope Workshop
By Fred Schaaf
51
Exploring the Moon
By Gary Seronik
By Charles A. Wood
61
76
Gallery
86
Focal Point
Celestial Calendar By Alan MacRobert
By Constance E. Walker
65
Deep-Sky Wonders By Sue French
68
22
Going Deep By Ken Hewitt-White S &T TE S T R E P O R T
55
28 Saving the Night Sky COVER STORY
6
By Gary Seronik
Two dedicated backyard astronomers alerted professional telescopes worldwide and in space to U Scorpii’s eruption. By Mike Simonsen & Alan MacRobert
Most Massive Star
Northern Hemisphere’s Sky By Fred Schaaf
a Crucial Nova
22 The Quest for the
AL S O IN THI S I S S U E
Lunar Discoverer Mac and PC users alike can use this program to aid their telescopic explorations of the Moon.
Li Light pollution is worse than ever, but a new mindset and new bu technology are poised to slow te — and perhaps reverse — this bane of astronomy. By J. Kelly Beatty
18
34 Big Binos Versus These instruments have different but overlapping capabilities. By Tony Flanders
72 Digging Out the Details Layered deconvolution adds depth to your astro-images. By Ken Crawford
BARBARA HARRIS
Small Scopes
SKY & TELESCOPE (ISSN 0037-6604) is published monthly by Sky & Telescope Media, LLC, 90 Sherman St., Cambridge, MA 02140-3264, USA. Phone: 800-253-0245 (customer service/subscriptions), 888-253-0230 (product orders), 617-864-7360 (all other calls). Fax: 617-864-6117. Website: SkyandTelescope.com. © 2010 Sky & Telescope Media, LLC. All rights reserved. Periodicals postage paid at Boston, Massachusetts, and at additional mailing offices. Canada Post Publications Mail sales agreement #40029823. Canadian return address: 2744 Edna St., Windsor, ON, Canada N8Y 1V2. Canadian GST Reg. #R128921855. POSTMASTER: Send address changes to Sky & Telescope, PO Box 171, Winterset, IA 50273. Printed in the USA.
4 May 2010 sky & telescope
worldmags & avaxhome
NASA / ESA / F. PARESCE (INAF-IASF) / R. O’CONNELL (UNIV. OF VIRGINIA) / WFC3 SCIENCE OVERSIGHT COMMITTEE
© ISTOCKPHOTO.COM/ NIKADA
On the cover: Light pollution is a serious impediment for deep-sky observers in Hong Kong and other major cities.
See Our Website For More Details WWW.SKYWATCHERUSA.COM
A LEADER IN DESIGN AND MANUFACTURE OF ED-APO SYSTEMS “...even when its images were slightly out of focus they remained free of obvious color fringing...stars that danced around in turbulent seeing remained pure in color...”
1
Sky & Telescope, October 2009
SW P80 ED-APO
SW P100 ED-APO
SW P120 ED-APO
“The Holy Grail of any refractor, and one expected of a scope carrying the apo moniker, is an in-focus star image free of false color fringes. The SW 120ED easily passed that test...” Sky & Telescope, October 2009
OPT 800-483-6287
SCOPE CITY 800-235-3344
WWW.SKYWATCHERUSA.COM
ASTRONOMICS 800-422-7876
ADORAMA 800-223-2500
SKIES UNLIMITED 888-947-2673
SKY-WATCHER PRO SERIES ED-APO HIGH PERFORMANCE OPTICAL TUBES SKY-WATCHER PRO SERIES:
SW P80 ED-APO: . . . . . . . . . . . . . . . . . $595 SW P100 ED-APO: . . . . . . . . . . . . . . . . $895 SW P120 ED-APO: . . . . . . . . . . . . . . . . $1695
HIGH POINT SCIENTIFIC 800-266-9590
WOODLAND HILLS TELESCOPES 888-427-8766
STREET s TORRANCE s CA 90503 SEE OUR WEBSITE FOR MORE DEALERS s 888.880.0485 s 2935 COLUMBIA worldmags & avaxhome
Robert Naeye Spectrum Founded in 1941 by Charles A. Federer, Jr. and Helen Spence Federer
The Fight Against Light Pollution: A Call to Arms
The Essential Magazine of Astronomy EDITORIAL
Editor in Chief Robert Naeye Senior Editors Dennis di Cicco, Alan M. MacRobert Associate Editor Tony Flanders Imaging Editor Sean Walker Editorial Assistant Katherine L. Curtis Editors Emeritus Richard T. Fienberg, Leif J. Robinson Senior Contributing Editors J. Kelly Beatty, Roger W. Sinnott
S&T: GREGG DINDERMAN
As i wrote a few months ago, amateur astronomy has entered a Golden Age. Manufacturers keep churning out better equipment and at more affordable prices. The internet, CCD cameras, and various electronic gizmos are making it easier than ever for amateurs to shoot astrophotos, conduct scientific research, share their successes with others, and enjoy the hobby. But the specter of light pollution looms over astronomy like a sword of Damocles. The problem continues to worsen, and in future decades the glare of artificial lighting might wipe out visual deep-sky observing for large stretches of the world’s landmasses. In the U.S., for example, light beamed into the sky is increasing 6% annually, four times the rate of population growth. Kelly Beatty (page 28) and Connie Walker (page 86) describe how people are waging a valiant battle against light pollution, often in conjunction with organizations such as the International Dark-Sky Association (IDA). Despite a growing awareness, an improving understanding of the problem, and new technologies, it’s not a battle we’re guaranteed to win. But it’s a battle that we must win if we want to preserve the grandeur of the heavens for later generations. The future of amateur astronomy is at stake. Light pollution takes away the same night sky we share with one another around the world, and that connects us to our ancestors. Heavily light-polluted skies fail to spark a sense of awe and wonder, making it less likely that people (especially children) will develop an interest in astronomy. There’s a lot that concerned astronomers can do about light pollution. First, remember that the problem is not light in general, it’s unnecessary light. Educate yourself about the issues and become knowledgeable about light fi xtures. Tell friends and neighbors that their night sky is disappearing, and that local governments are wasting huge sums of taxpayer money lighting up the sky. Tell them about how excessive glare can contribute to auto accidents and harm nocturnal wildlife. Join or support the IDA (www.darksky.org). Contact your local, state, or provincial government officials. We can’t afford to sit around and wish the problem away. Only sustained, concerted action will save our precious night sky.
Contributing Editors Greg Bryant, Paul Deans, Thomas A. Dobbins, David W. Dunham, Alan Dyer, Sue French, Paul J. Heafner, Ken Hewitt-White, Johnny Horne, E. C. Krupp, Emily Lakdawalla, David H. Levy, Jonathan McDowell, Fred Schaaf, Govert Schilling, Ivan Semeniuk, Gary Seronik, William Sheehan, Mike Simmons, Charles A. Wood, Robert Zimmerman Contributing Photographers P. K. Chen, Akira Fujii, Robert Gendler, Tony & Daphne Hallas ART & DESIGN
Design Director Patricia Gillis-Coppola Illustration Director Gregg Dinderman Illustrator Casey Reed PUBLISHING
VP / Publishing Director Joel Toner Advertising Sales Director Peter D. Hardy, Jr. Advertising Services Manager Lester J. Stockman VP, Production & Technology Derek W. Corson Production Manager Michael J. Rueckwald Production Coordinator Kristin N. Beaudoin IT Manager Denise Donnarumma VP / Consumer Marketing Dennis O’Brien Consumer Marketing Nekeya Dancy, Hannah di Cicco, Beth Dunham, Christine Fadden, Jodi Lee, Adriana Maldonado, T.J. Montilli, Mike Valanzola Credit Manager Beatrice Kastner NEW TRACK MEDIA LLC
Chief Executive Officer Stephen J. Kent Executive Vice President / CFO Mark F. Arnett Corporate Controller Jordan Bohrer Office Administrator Laura Riggs Editorial Correspondence: Sky & Telescope, 90 Sherman St., Cambridge, MA 02140-3264, USA. Phone: 617-864-7360. Fax: 617-864-6117. E-mail: editors@ SkyandTelescope.com. Website: SkyandTelescope.com. Unsolicited proposals, manuscripts, photographs, and electronic images are welcome, but a stamped, self-addressed envelope must be provided to guarantee their return; see our guidelines for contributors at SkyandTelescope.com. Advertising Information: Peter D. Hardy, Jr., 617-864-7360, ext. 2133.
Fax: 617-864-6117. E-mail:
[email protected] Web: SkyandTelescope.com/advertising Customer Service: Magazine customer service and change-of-address notices:
[email protected] Phone toll free U.S. and Canada: 800-253-0245. Outside the U.S. and Canada: 515-462-9286. Product customer service:
[email protected] Phone toll free: 888-253-0230. Subscription Rates: U.S. and possessions: $42.95 per year (12 issues);
Canada: $49.95 (including GST); all other countries: $61.95, by expedited delivery. All prices are in U.S. dollars. Newsstand and Retail Distribution: Curtis Circulation Co., 730 River Rd., New Milford, NJ 07646-3048, USA. Phone: 201-634-7400. No part of this publication may be reproduced by any mechanical, photographic, or electronic process, nor may it be stored in a retrieval system, transmitted, or otherwise copied (with the exception of one-time, noncommercial, personal use) without written permission from the publisher. For permission to make multiple photocopies of the same page or pages, contact the Copyright Clearance Center, 222 Rosewood Dr., Danvers, MA 01923, USA. Phone: 978-750-8400. Fax: 978-750-4470 Web: www.copyright.com. Specify ISSN 0037-6604. The following are registered trademarks of Sky & Telescope Media, LLC: Sky & Telescope and logo, Sky and Telescope, The Essential Magazine of Astronomy, Skyline, Sky Publications, SkyandTelescope.com, http://www.skypub.com/, SkyWatch, Scanning the Skies, Night Sky, and ESSCO.
Editor in Chief
6 May 2010 sky & telescope
worldmags & avaxhome
¹ J^[IkdYWdX[gk_[j ed[cehd_d]WdZ j^[dW\[m^ekhibWj[h"
^eboicea[i " iec[j^_d] h[Wbboif[YjWYkbWh _i]e_d]ed$º F$I$J$>#Wbf^W
ÎG^`h Kbtqlk
7F;HJKH;
*&C C
<E97BB;D=J>
*&&C C \%'&
87D: M?: J>
2'$&7
8BE9A?D=
FH?9;
*//
Enter to win the ultimate cosmic experience! Visit www.imax.com/entertowin by April 30th for a chance to win a Meade LS-6 ACF Telescope and a private screening of the newest IMAX® 3D documentary, HUBBLE 3D!* Now playing exclusively in select IMAX and IMAX 3D theatres. *
Pli^o ^pqolkljv fp Ûiiba tfqe ^`qflk+ Ci^obp bormq+ Moljfkbk`bp ^mmb^o qe^q ^ob clro qfjbp i^odbo qe^k b^oqe+ Prkpmlqp l``ro ^ka olq^qb clo a^vp+ >ka qeb bkqfob Prk illhp ifhb ^ i^`b q^_ib`ilqe tfqe jfiiflkp lc qeob^a*ifhb Ûi^jbkqp+ Lc `lropb) ^ii lc qefp ^pprjbp vlr ^ob tfqkbppfkd qebpb mebkljbk^ qeolrde ^ @lolk^al Evaoldbk >ime^ %E*^& qbibp`lmb+ Vlr `^k ib^ok jlob ^_lrq E*^ ^q lro tb_pfqb+ Bsbk ^q qeb bkqov ibsbi) sfbtp qeolrde qeb ^loa^_ib MPQ¥ E*^ ^ob klqefkd peloq lc _ob^qeq^hfkd+ Qe^qÒp tev qeb p`lmb ob`bkqiv tlk ^ Mlmri^o P`fbk`b ?bpq lc Te^qÒp Kbt ^t^oa+ Fc vlr ilsb ^pqolkljv) ^ @lolk^al MPQ tfii ibq vlr bkglv vlro m^ppflk kfdeq ^ka a^v+ M E L Q L D O > M E V Î G > @ H K B T Q L K
9EHED7:E
¦/-.- jb^ab fkpqorjbkqp `lom+ ^ii ofdeqp obpbosba+ pmb`fÛ`^qflkp ^ka mof`b pr_gb`q ql `e^kdb tfqelrq klqf`b+ 0-*.--.2 *No purchase is necessary to enter or win. A purchase will not increase your chances of winning. Odds of winning will depend on total number of entries received. Void where prohibited by law. Sweepstakes open to legal residents of the U.S. or D.C. and Canada (excluding Quebec) at least 18 years of age. Sweepstakes begins March 8, 2010. Enter by April 30, 2010. Subject to full official rules. Sponsor: IMAX Corporation. IMAX® and IMAX® 3D are registered trademarks of IMAX Corporation.
worldmags & avaxhome
Letters
The Alien Paradox Jacob Haqq-Misra and Seth D. Baum’s article (“Where Have All the Aliens Gone?” March issue, page 86) introduces a new and interesting idea about the Fermi Paradox, which says that if advanced aliens exist at all they should have reached Earth by now. The problem of sustainability may indeed explain why they haven’t. Here is another possible reason. The authors remind us of the commonly accepted equation: “A civilization that deploys colonists to 10 planets, each of which expands to another 10 planets, will quickly colonize the entire galaxy.” In my opinion this makes it look far too easy. Let’s suppose that, in a few centuries, mankind will be capable of reaching other stars. After a journey of, say, 1,000 years (which itself raises a few questions), where will we find 10 planets fully suitable for human life — with convenient gravity and pressure, temperature, breathable atmosphere, liquid water, natural cosmic-ray shielding, etc.? Probably nowhere! The chances to find strictly Earth-like planets are close to zero. Most likely our colonists will have to live indefinitely in their spacecrafts, near planets or asteroids where they would collect what they need as raw materials. Perhaps other intelligent civilizations in the Milky Way face the same problems, and therefore have little reason to travel very far. We may also find that intelligent life rarely develops technology, and therefore does not conquer and colonize far away — a typically human trait! Philippe Barraud Cully, Switzerland The Fermi Paradox is neither a paradox nor a problem. Since the universe is not infinitely old, the question of whether
a civilization should have long since expanded to fill the galaxy depends critically on how likely it is for other intelligence to evolve before us. Civilization evolved on Earth in just short of the present age of the Sun, about 1/3 the age of the universe. There is no reason to conclude that another intelligent civilization in our galaxy — especially since it is likely that such life will only evolve around young, Population I stars — has had much more time to develop on a planet possessing the necessary mix of heavy elements. Dan Purrington New Orleans, Louisiana Editor’s note: Surprisingly, stars with heavy elements — and therefore, probably, rocky planets — formed at a high rate long before the solar system. One analysis found that the average rocky world in the Milky Way should be 6 or 7 billion years old, compared to Earth’s “mere” 4.6 billion. See “Most Earths Are Old,” S&T: August 2001, page 24.
Astro Club: Alive & Well Write to Letters to the Editor, Sky & Telescope, 90 Sherman St., Cambridge, MA 02140-3264, or send e-mail to
[email protected]. Please limit your comments to 250 words.
When I finished Robert Naeye’s Spectrum in the March issue, “Bringing in More Women” (page 6), my first feeling was, “We’re doing well!” I co-founded the Camden County Library Astronomy Club (in Camdenton, Missouri) three years
8 May 2010 sky & telescope
worldmags & avaxhome
ago. ago I scanned our club roster and found 31 women, 45 men, 7 young people, and 5 w regular speakers. regu There are several reasons why I believe T our club is so diverse. We always ask the people peo attending for topics they would like to h hear more about. One of the latest came from a five-year-old girl, and at our January meeting, Jim (the other co-founder of our group) spoke on the history of how the planets plan got their names. As A a retired teacher, I saw a need for something to keep the younger ones’ som minds busy during more advanced talks. min So w we have activities to keep them busy: word wor puzzles, coloring pages, childrens’ books, boo all astronomy-related, of course. Another recent meeting was on a subA ject that our members have strongly suggested. So many of our budding amateur ges astronomers buy a telescope and find they do not know how to use it. We asked everyone who needs help to bring their scopes. After every meeting, weather permitting, we have a star party. Those who have never looked through a telescope get ample opportunity to do so. One of our greatest rewards is to see the looks on peoples’ faces, and hear the amazement in their voices, when they look through a telescope and see wonders that are hidden from the naked eye. Ginny Strogen Camdenton, Missouri
Beyond Hubble “Is the James Webb Space Telescope a Good Thing?” Robert Naeye asks in the January issue (page 8). The James Webb Space Telescope represents NASA’s next major step beyond the Hubble Space Telescope. While Webb is indeed a major facility, it is important to remember that, like Hubble, small investigator teams from universities across the United States and abroad will accomplish the vast majority of its science through individual proposals for observing time. Nearly 8,000 individual astronomers now use Hubble and its data products, and we expect the Webb to be used in the same way.
Power Pairs! ; ',,40-' +0*"#-+$/&# '*/#- / - -/4
$699
+-
$799
&# 2 -" 2'**'*% 6 #-'#.7'/-+%#* 0-%#" /#-,-++$4#,'#!#.*+/+*(4%'1#4+0.,#!/ !0( - &4,#-2'"#1'.0 (1'#2./&-+0%&4+0-/#(#.!+,# 0// -#.# (#"/+,-+/#!//&#'*/#-* (#(#)#*/. +!#(# - /#/&# ""'/'+*+$/&#*#2))4+0! *9+2#- '-:2'/& )) *" )) +- )) *" ))/+#3, *"4+0- 6#4#,'#!#!+((#!/'+* *". 1# 0*"(# +%#/4+0-+2#- '-1'.'/4+0-3,(+-# !'#*/'8!# (#-/&-+0%&0*#
1
#3,(+-#.!'#*/'8! !+)5 worldmags & avaxhome
3,(+-# !'#*/'8!
Letters
When the Great Observatories (Hubble, Chandra, and Spitzer) were being constructed serially through the 1980s to 2003, the Astrophysics Division at NASA spent, on average, 60-70% of its annual budget on those missions. Today, Webb funding represents about 40%. NASA will be operating or funding 15 satellites returning data across nearly the full electromagnetic spectrum throughout 2010. Contrast this with the Great Observatories construction period when NASA was operating only between four and nine astronomy satellites. Webb was recommended as the highest priority facility in the 2000 National Academy of Sciences decadal survey for astronomy and astrophysics. This is the science community-driven prioritization process that NASA follows. NASA does not “pit one group of scientists against another as they battle for precious resources.” Today, more satellites than ever are
75, 50 & 25 Years Ago
returning data from space, including Hubble, Chandra, and Spitzer, as well as five Explorer and five international missions; and other projects being developed, such as SOFIA, NuSTAR, Astro-H, and GEMS. Even if there is some frustration with not being able to do everything the community would like, this seems like a pretty good starting point for the next 400 years of gazing at the sky through telescopes. Eric P. Smith JWST Program Scientist NASA, Washington, DC
For the Record ✹ The labels A and B for the craters Aristarchus and Ptolemaeus were reversed on the Moon photo on page 51 of the March 2010 issue. ✹ In the February 2010 issue (page 67), Deep-Sky Wonders described a bright patch in the nebula Sharpless 2-219. In fact, the bright patch is in Sh 2-217.
Leif J. Robinson
May/June 1935 Where the Stars Are “One of the fundamental problems of modern astronomy is the determination of the distances of stars.” That problem began to go away with the publication in 1997 of the Hipparcos satellite’s high-precision parallax catalog, which contains accurate distances for tens of thousands of stars. Around 2020 we should see the results from the Gaia mission, with 100 times better accuracy and 10,000 times more stars.
the new 10-million-dollar optical observatory that is now being built on a mountaintop in southern Arizona. Already a 36inch reflector (frontcover picture) is in operation, and an 84-inch telescope of advanced design is being built.” Although Kitt Peak National Observatory is no longer the optical powerhouse it was during much of the second half of the last century, it remains a national center for the development of state-ofthe-art instruments and telescopes.
May 1960 Birth of U. S. National Observatory “Questions for the astronomy of the future were discussed by the chief speaker at the dedication exercises on March 15th of Kitt Peak National Observatory,
MAY 1985 Planetary colors “Typical planetary colors run from brownish gray (for rocky surfaces) through yellowish gray, to yellowish white (for icy surfaces). Color is an essential piece of data in determining the true nature of a planet. It tells us something about the planet’s composition.” Andrew Young described the true color of solar-system objects, in contrast to the enhanced, processed images we often see.
10 May 2010 sky & telescope
worldmags & avaxhome
worldmags & avaxhome
News Notes
What is the thing pictured here? It’s like no astronomical object ever seen. The automated LINEAR sky patrol picked it up on January 6th. It seemed like a very small, but long-tailed, 20thmagnitude comet moving across Gemini. It received the name Comet P/2010 A2 accordingly. But it was following a nearly circular orbit in the main asteroid belt. And its tail seemed to be streaming not from a comet head, but from a thread of debris extending away from a pointlike bare object. Astronomers turned the Hubble Space Telescope to it on January 25th and 29th. The images above are from the latter date. The “head” seems to be an X-shaped feature with a tiny solid body at one endpoint of the X, about 1,000 miles (1,600 km) from its center. “This is quite different from the smooth dust envelopes of normal comets,” says David Jewitt (UCLA), who led the Hubble effort. Asteroids have been known to flare up with surprise cometary activity; four previous cases are on record. But P/2010
A2 looks like none of these. Moreover, it lacks the gas usually seen in a comet’s coma and tail. What we’re looking at here is only dust. The best theory, thinks Jewitt, is that two small asteroids collided a few weeks or months earlier. That might seem astronomically unlikely, given the vast amount of empty space in even the richest part of the asteroid belt. But there are tens of millions of asteroids as small as the pointlike thing in the image, which is estimated to be 140 meters (460 feet) wide. Would a collision aftermath look like this? Maybe. Perhaps the two lines of the X are separate rubble streams from the two bodies. Another possibility is that we’re seeing a single asteroid that has been gradually spun up by interactions with sunlight to the point that it has started throwing off loose material. In either case, fine dust appears to be streaming off the rubbly X due to the Sun’s radiation pressure, to form the long, cometary tail. More Hubble observations are planned through July.
12 May 2010 sky & telescope
worldmags & avaxhome
The Smaller the Galaxy, the More Dark Matter Dwarf galaxies may not look like much, but don’t be fooled. They offer the purest pools of dark matter available anywhere. The smaller a galaxy, the larger its proportion of dark matter, finds a research group led by Stacy McGaugh (University of Maryland). In the cosmos as a whole, the mysterious dark matter outweighs all normal (“baryonic”) matter by 5 to 1. The same is true inside the largest galaxy clusters. But the ratio goes up in smaller cosmic structures — to the point that in dwarf galaxies, such as NGC 4163 pictured below, the ratio of dark matter to baryonic matter (stars, gas, and everything else) can exceed 100 to 1. Why? One theory is that small galaxies were less able to hold onto their gas when, early in cosmic history, supernovae were more common. In this view, supernova blasts cleared out most of the normal matter, putting an end to most star formation. Dark matter doesn’t interact with normal matter and therefore doesn’t feel supernova blast waves. So it was left behind.
NASA / ESA / K. MCQUINN / I. KARACHENTSEV
NASA / ESA / DAVID JEWITT (UCLA) (2)
The First Asteroid Collision?
For astronomy news as it breaks, SkyandTelescope.com/newsblog. S ky
worldmags & avaxhome
News Notes
JULIA COMERFORD
Now the numbers are filling in. A group led by Julie Comerford (University of California, Berkeley) has announced 33 galaxies with two holes. “This result is significant because it shows us that they are much more common than previously known,” she says. An example is in the Hubble image above.
GRB-Supernova Link In recent years, astronomers have connected several long-duration gamma-ray bursts to distant, relatively normal-looking Type Ib/c supernovae. These discoveries suggest that the superfast (“relativistic”) jets powering GRBs play a big role in at least one type of ordinary exploding star. But if so, who don’t we see signs of relativistic jets in more of these supernovae? We witness a GRB only when the jet happens to be aimed right at us. Radio observations should reveal relativistic jets no matter which way they’re aimed. But despite examining more than 100 supernovae, radio astronomers saw no such jets. Until now. In the January 28th Nature, separate teams reported radio observations of two supernovae that show relativistic jets. Neither produced a GRB. One possibility, says Alicia Soderberg (Harvard-Smithsonian Center for Astro-
CASSINI IMAGING TEAM / SSI / JPL / ESA / NASA
Astronomers have found that nearly every large galaxy has a supermassive black hole at its center, holding about 1 million to 20 billion times the mass of the Sun. Astronomers also know that galaxies often collide and merge. So lots of galaxies today should have two or more supermassive black holes. But it’s been hard to find clear examples.
physics), is that “perhaps the gamma rays were ‘smothered’ as they tried to escape the star. This is perhaps the more exciting possibility,” she says; it implies that we can identify supernovae that are driven by spinning black holes in their cores “even if they lack detectable gamma rays and go unseen by gamma-ray satellites.”
Hot Spot for Cosmic Rays Future astronauts who make long trips beyond Earth’s magnetosphere will face serious trouble from galactic cosmic rays: high-energy protons and heavier atomic nuclei. But would-be Mars colonizers can at least be glad our galaxy isn’t like M82. Most cosmic-ray particles near Earth come from the expanding shock fronts of supernova remnants in our galaxy, as NASA’s Fermi Gamma-ray Space Telescope is confirming. The shock waves entrain magnetic fields that accelerate charged particles to extreme energies. It happens more elsewhere. M82, 12 million light-years away in Ursa Major, is birthing so many massive stars that one goes supernova every few years. Gammaray astronomers have found a signature from M82 indicating that cosmic-ray production is 500 times more intense there than in the Milky Way. In the composite view of M82 below, visible light is shown as orange and green, infrared as red, and X-rays as blue.
Mission Updates • NASA’s spectacularly productive Cassini mission has been awarded $60 million per year to continue through 2017. Cassini arrived at Saturn in 2004 for a planned 4-year mission, but its hits just keep on coming. Above is a recent new closeup of Saturn’s moon Calypso, 19 kilometers wide. It appears to be covered with fresh flows of bright white ice dust from Saturn’s E ring. • NASA’s Solar Dynamics Observatory, featured in the January issue (page 22), got off to a fine launch February 11th on its 5year mission to study the Sun. • Less happy news comes from Mars. NASA controllers announced on January 26th that they’ve given up trying to free the Spirit rover from the sand wallow where it bogged down in May 2009. After exploring across 4.8 miles in 5 years, Spirit now becomes a stationary science platform.
NASA / ESA / CXC / JPL / CALTECH
Double Supermassive Black Holes
14 May 2010 sky & telescope
worldmags & avaxhome
worldmags & avaxhome
News Notes
ISAS / JAXA
This research also helps tie up another problem. Most meteorites have Q-type spectra, though such asteroids are unusual. The discrepancy is easy to explain in terms of fresh versus spaceweathered surfaces. During a meteoroid’s fiery plunge through Earth’s atmosphere its old surface is stripped off, exposing fresh material beneath.
120º
180º
240º
330º
NASA / ESA / MARK BUIE (6)
Small asteroids, such as 25143 Itokawa (imaged below by Japan’s Hayabusa spacecraft), seem to be loose rubble piles that can be severely shaken up by close encounters with Earth. The evidence is in their surface colors. Dark, reddish-gray “S-type” asteroids are common, and their color is thought to result from space weathering. Solar-wind particles and other radiation discolor rock surfaces exposed to space in less than a million years, giving them a sunburned appearance. Other, “Q-type” asteroids seem to lack space weathering. What freshens them up? At first, researchers thought impacts and collisions might do the job. But Qtype asteroids are not found in the main asteroid belt, where collisions should be the most frequent. A research group led by Richard Binzel (MIT) ran the orbits of 95 small asteroids — 75 of them type S, 20 of them Q — backward in time. Every one of the fresh-looking, Q-type asteroids was following an orbit that makes past close encounters with Earth very likely. This supports a suggestion by David Nesvorny (Southwest Research Institute) that a close encounter with a planet can change an asteroid from dark brown to lighter gray by tidally jostling it enough to expose fresh rubble.
60º
0º
Faces of Pluto On February 4th, the 104th birthday of the late Pluto discoverer Clyde Tombaugh, Marc Buie of the Southwest Research Institute unveiled maps of Pluto’s surface derived from Hubble Space Telescope images taken in 2002 and 2003. Massive computer processing went into eking out the highest possible resolution. When compared to a similar set from 1994, it’s clear that Pluto’s icy surface went through radical changes in less than a decade. The new views reveal a surface with three distinct coatings. The brightest areas are likely to be fresh frosts of methane and nitrogen. The darker orange and charcoalblack terrains are probably covered with old, complex carbon compounds created by long exposure of methane ice to space radiation. By contrast, no surface changes were seen on Pluto’s moon Charon. Apparently, thin traces of atmosphere are freezing out on Pluto’s surface as it edges away from the Sun in its long orbit, and nitrogen frosts are migrating as Pluto’s northern hemisphere becomes exposed to sunlight for the first time in more than a century. These images are the best look at Pluto we’ll probably have until NASA’s New Horizons probe flies by in 2015.
16 May 2010 sky & telescope
worldmags & avaxhome
New Plan for NASA In February the Obama administration unveiled a $19 billion NASA budget for fiscal year 2011 that would alter the future of human spaceflight. The plan, if enacted by Congress, would end shuttle flights by early 2011 and cancel the Constellation program for returning astronauts to the Moon. But it would increase funding to develop “game-changing technologies” that could speed up future human missions to the Moon, near-Earth asteroids, and Mars. The plan would also place greater reliance on private firms and Russia for ferrying humans to low-Earth orbit, while extending U.S. participation in the International Space Station to 2020. Despite canceling a program in which $9 billion has already been invested, the plan increases NASA’s overall funding by $6 billion over the next five years, to about $100 billion total. By developing new propulsion technologies, in-orbit fuel depots, and robotic precursor missions, the administration and NASA seem to be betting that they can lower costs for deep-space exploration in the long run. The plan also calls for more international cooperation. The proposed budget follows many recommendations set forth in a report last year by an independent committee chaired by former Lockheed Martin executive Norman Augustine. The “Augustine Report” spelled out what many have been saying for years: the Constellation Moon program was vastly underfunded for achieving its stated goal of returning astronauts to the Moon by 2020. But critics charge that the new plan fails to establish specific mission objectives and timetables. The new budget increases funding for Earth-science missions. Planetary science and solar physics receive slight increases, while astrophysics is slightly decreased. ✦ AS A
Close Encounters Turn Asteroids Pale
N
All News Note stories are presented in more depth at SkyandTelescope.com; search for the keyword SkyTelMay10.
g ei r un co m pr om is in A pp re ci at ed fo r thno vi ce as tr on om er s im ag e qu al it y by re se ar ch er s al ik e. al on si es of pr d an
ATIK
CA
ME
RA
S
best inging together the br in s ve el rs ou e id We pr cameras to use software. ATIK sy ea th wi cs ni tro ec el you to tro-imaging, allowing take the stress out of as ssly. of the night sky, effortle es ur ct pi ul tif au be te crea
Be sure your next camera is an ATIK Be sure to check out our new products! New Cameras - Atik 383L+, Atik 320E & Atik Titan. Also 2” Electric Filter Wheel & Off-Axis Guider
ATIK
CAMERAS
www.ATIK-USA.com
Designed for Astro-Imagers by Astro-Imagers 5108 Pegasus Court, Suite M, Frederick, MD 21704
worldmags & avaxhome
877-284-5226
Recurrent Nova Erupts
BARBARA HARRIS
U SCORPII:
Amateurs Catch a Crucial
DEB DVORAK
Nova
Above: Barbara Harris, the first to discover that U Scorpii had erupted to 8th magnitude, shows off her 16-inch scope in her Florida home observatory. Every clear morning before January 28th she had been measuring U Sco at around magnitude 18. Left: Co-discoverer Shawn Dvorak observes variable stars with a 10inch scope in his backyard roll-off-roof observatory. In 10 years he has logged more than 557,000 images and 8.1 million photometric measurements. Read more at his website, www.rollinghillsobs.org.
18 May 2010 sky & telescope
worldmags & avaxhome
mike simonsen & alan macrobert Barbara G. Harris, a retired ob-gyn physician in New Smyrna Beach, Florida, went to bed late on the night of January 27th and really didn’t feel like getting up before the first light of dawn. But her dog Arctic had other ideas. He barked to go out. So she reluctantly got up and let him out the door. And once on her feet, as she had done every other clear morning in January, she went out on her thirdfloor deck, fired up the 16-inch Schmidt-Cassegrain telescope and its CCD camera in her observatory, and pointed it toward U Scorpii low in the southeastern sky. When the first image appeared on Harris’s computer, blazing in its center was a huge, overexposed star. Her first thought was that something was wrong with her gear. Just 24 hours earlier she had measured U Scorpii at photoelectric V magnitude 18.2. She quickly took a much shorter exposure, double-checked the position, and, she recalls, “That’s when I started to get excited.” Harris had been monitoring the recurrent nova U Scorpii for months, in hopes of catching a rare eruption that Louisiana State University astronomer Bradley Schaefer had predicted almost a year earlier (S&T: August 2009, page 56). She and many other amateurs had joined a campaign by the American Association of Variable Star Observers (AAVSO) to keep the star under steady watch, in hopes that an early alert could make this the best-studied nova outburst in history. Astrophysicists were eager for the event. Stars like U Sco are likely to be the objects that finally explode as Type Ia supernovae. These supernovae are crucial to measuring the changing expansion rate of the universe and the “dark energy” that is speeding up the expansion. But the progenitors of Type Ia supernovae remain poorly known. “Back in December I got an email from Brad Schaefer, because I had obtained the first image of U Sco as it came out from behind the Sun” into morning visibility, says Harris. That image helped reassure astronomers that U Sco had not blown up while it was in conjunction with the Sun. “He said, ‘Keep submitting your data to AAVSO, but here’s my home phone number.’” On the morning of January 28th she rang him out of bed. “He let out a scream and said, ‘Thank you, thank you! I’ll start notifying everyone right away!’” Barbara recalls. Just to be sure, Schaefer toted his own 6-inch scope to his front yard and confirmed that U Sco was bright, then began to spread the news worldwide. Meanwhile, in Clermont, Florida, Shawn Dvorak had gotten up early to go to the gym. Years ago he had intended to become a professional astronomer, but he wound up with a job working on computer systems for FedEx. That’s during the day. On most clear nights for the last decade, Dvorak has used his “semi-automated”
10-inch Schmidt-Cassegrain scope and CCD camera to measure eclipsing binaries, RR Lyraes, and cataclysmic variable stars for the AAVSO. On the morning of January 28th his setup had been running all night. He too had been checking U Sco before dawn once it emerged from behind the Sun. It was usually his last observation before shutting down. “I almost didn’t observe it this morning since I was planning to go to the gym,” says Dvorak. He still wasn’t quite awake when the first image came up, and he thought to himself, “Whoa, I’m pointing at the wrong field, there’s no star that bright here.” But he quickly realized he was on target and sent off the news to the AAVSO. Harris and Dvorak made their discoveries before either knew of the other. Within minutes, alerts were going out to observatories and spacecraft controllers worldwide: U Sco had finally blown.
The Nova Watch U Sco is one of only 10 recurrent novae known. Recurrent novae are those that have exploded more than once in observational history. Classical novae are also presumed to explode repeatedly, but only about 1,000 to 100,000 years apart. In both cases, the underlying star is a close binary in which a white dwarf is accreting hydrogen from a relatively normal companion. Eventually, a deep enough layer builds up on the white dwarf’s hot surface — and is compressed tightly enough by the dwarf’s intense gravity — to ignite a runaway hydrogen-fusion reaction. The bottom of the hydrogen layer explodes globally as a thin-shell hydrogen bomb, blowing off a shell of ejecta and brightening the system by roughly 10,000 times. The stars remain in place, everything settles back down, and the process starts over (S&T: October 2009, page 26). Brad Schaefer tracked down everything he could find about all 37 recorded outbursts of the 10 recurrent novae, including Brad Schaefer three previously unknown eruptions of U Sco that he found by searching archives of photographic sky-patrol plates going back to 1900. Based on this work, and on the apparent rate at which mass was currently flowing onto U Sco’s white dwarf, Schaefer made a bold prediction: The star, which last blew up in 1999, would erupt at 2009.3 plus or minus one year. He was 0.8 year off, within his margin of error. After Schaefer announced his prediction, astronomers planned observing campaigns for when and if the blowup occurred. But U Scorpii is an exceptionally fast nova, rising and starting to fade in just hours. Its rise was, unfortunately, missed completely; the last observation before Sk yandTelescope.com May 2010 19
worldmags & avaxhome
Recurrent Nova Erupts
Weblinks
Background on U Sco and recurrent novae: www.aavso.org/vstar/ vsots/usco.html
Current AAVSO magnitude measurements: tinyurl.com/yfv2fzn
Brad Schaefer’s paper on all recurrent novae: tinyurl.com/ybfl9pn
BARBARA HARRIS (2)
News updates from AAVSO’s U Scorpii Campaign: www.aavso.org/news/ usco.shtml
Left: When Harris took a deep CCD image through her 16-inch on January 27th, it barely recorded U Scorpii. Right: A day later the star was an overexposed blaze even on a much shorter exposure. For skywatchers worldwide responding to the early alert, the recurrent nova was visible in binoculars.
Harris’s discovery turned out to be her own measurement of the star 24 hours earlier. True to form, U Sco lost more than a magnitude in the first 24 hours after discovery and continued declining in a way that closely mirrored its 1999 eruption (see the light curve below). A day after eruption, spectra showed that the edges of its debris shell were expanding by a remarkable 11,000 kilometers per second, 3% of the speed of light. Several days later, X-ray emission turned on; no one knows why novae wait to do this. As the debris 6
U Scorpii
8
12 14
AAVSO / MATTHEW TEMPLETON
Magnitude
2010
Visual (eye)
10
Visual (CCD)
16
Blue (CCD)
Fainter than
18 20
Jan 25
Feb 1
Feb 8
Feb 15
Feb 22
As this issue went to press in late February, U Sco was fading with the standard characteristics of a very fast nova.
shell thinned and cleared, some 7 days into the show, the characteristic “nova flickering” began — a sign that mass transfer had resumed and a new accretion disk had formed around the white dwarf. Soon the light curve was again showing the eclipses of the white dwarf and its accretion disk by the companion star every 30 hours. Luckily for researchers seeking to untangle the system’s details, U Sco is a totally eclipsing binary. Many studies are continuing on the ground and from space. So chalk up another amateur triumph. “This again shows the real advantage of the worldwide distribution of amateur astronomers for detecting transient events like this,” says AAVSO director Arne Henden. Astronomers would not have had their early alert if Shawn had decided to go to the gym, and if Arctic hadn’t barked. Hours after the find, Harris commented, “My dog has been getting cookies and anything he wants all day.” ✦ Mike Simonsen, one of the world’s leading variable star observers, is development director for the AAVSO and heads its Cataclysmic Variable Section, Chart Team, and Mentor Program. He writes the astronomy and variable-star blog Simostronomy and is a cast member of the Slacker Astronomy podcast. Sky & Telescope senior editor Alan MacRobert has his own fond memories of Nova Delphini 1967.
20 May 2010 sky & telescope
worldmags & avaxhome
Since
1975
Orion® StarBlast™ 6i IntelliScope® Reflector $399.95
Orion® LaserMate™ Pro Laser Collimation Kit $99.95 #5684
#27126
Orion® StarShoot™ Planetary Imager and AutoGuider $349.95 #52079
1 NEW PRODUCT
2010
Orion® Neutral-Density Moon Filter, 13% Transmission $19.95 #5662
Orion® SkyQuest™ XT8 Classic Dobsonian $329.95 #8943
Big-aperture performance meets easy portability
Orion® SkyScanner™ 100mm TableTop Reflector $99.95 #9541
Orion® EON ™ 80mm ED Apochromatic Refractor $599.95 #9927
Orion® SkyQuest™ XX14i IntelliScope® Truss Dobsonian $1,799.95 #9791
worldmags & avaxhome
Our Galaxy’s Biggest, Brightest Brutes
The
Astronomers are conducting a frenetic search for our galaxy’s most massive star.
yaël nazé
SUPER STAR CLUSTER R136 resides near the center of the Tarantula Nebula (NGC 2070) in the Large Magellanic Cloud. Astronomers once thought that R136 was a single super star of several thousand solar masses. But Hubble Space Telescope images such as this clearly resolve it into a cluster populated by thousands of luminous stars.
22 May 2010 sky & telescope
worldmags & avaxhome
NASA / ESA / F. PARESCE (INAF-IASF) / R. O’CONNELL (UNIV. OF VIRGINIA) / WFC3 SCIENCE OVERSIGHT COMMITTEE; AUTHOR PHOTO: YVES NEVENS
Quest for the Most Massive Star
Stars are not born equal.
Measuring a star’s mass is no easy job. After all, astronomers cannot visit a star and put it on a scale. Weighing must be done from afar. How can this be done? One strategy is to model stellar spectra. When astronomers obtain a star’s spectrum, they are measuring chemicals and conditions in the star’s photosphere. The atmosphere’s physical state depends crucially on its temperature and its pressure, which in turn are linked to the star’s gravity, which in turn depends on its radius and mass. Astronomers can use basic physics to model stellar atmospheres. For a given set of parameters (temperature, radius, mass), scientists can calculate the state of each chemical element in the atmosphere, thereby deriving its potential signature in a stellar spectrum. Astronomers can then compare a real spectrum to the modeled one, find the best fit, and then indirectly infer the stellar parameters, including the mass. To find the record holder, one can simply imagine modeling many different stars, until the most massive object is found. But models are always calibrated by observations. Searching for the most massive objects — by nature outside the tested limits of the model — implies extrapo-
lation, which is never precise, nor always correct. The modeling of stellar spectra can thus only provide an approximate mass. Another possibility is to measure a star’s luminosity. For adult (main-sequence) stars, basic stellar physics dictates that their luminosities are strongly correlated with their masses. For example, a 40-solar-mass star is five times more luminous than a 20-solar-mass star. Estimating masses now appears trivial: observe many different luminous stars, preferentially in several fi lters, measure their luminosities, and then compute their masses. But simplicity is often deceptive and many details render the task much more complicated than first thought. For example, this mass-luminosity relation is only valid for the absolute luminosity, while a direct measurement yields only an apparent brightness. To determine the former from the latter, astronomers must correct for distance, reddening by dust, and the short energy range sampled by the observations — three parameters that are not always known with precision. Astronomers also need to be certain that the measured luminosity applies to only one star. Errors can be frequent where stars are packed closely together in a cluster. One famous example is R136 in the Large Magellanic Cloud. Based on its high luminosity, it was once considered to be a single “superstar” with a whopping 1,000 to 2,500 1.4 1.2 HD 48099 spectrum
0
Model spectrum
0.8 0.6 4000
4050
4100
4150
4200
DATA: LAURENT MAHY (UNIVERSITÉ DE LIÈGE) ET AL.
Weighing Without a Scale
THE ME TAL– MA S S CONNE C TI ON In astronomy parlance, elements heavier than hydrogen and helium are called “metals.” Low-metallicity stars produce very weak stellar outflows during their formation, since the few electrons in hydrogen and helium means the infalling material is less easily driven off by radiation pressure. These stars can thus accumulate much higher mass than stars that form today in our galaxy, whose interstellar nurseries are laden with metals produced and ejected by previous generations of stars.
Relative brightness
Those with large masses dominate their surroundings; only they can simultaneously make gas shine to create beautiful nebulae, push around nearby material, and form a rich stew of heavy chemical elements. With masses tens of times that of the Sun and with light outputs millions of times solar, these stellar masters hold the power of life and death. They destroy fragile objects such as protoplanetary disks and trigger the birth of other stars. And after their brief but flamboyant lives, they die in titanic supernova explosions. sup So if you want to understand the universe, you need to understand these massive objects. Moreover, because u the most massive stars produce the greatest impact, the record holders constitute an astronomical “holy grail.” rec Astronomers have other reasons to study the most massive stars. Every stellar model needs to be tested, and ma what’s a better laboratory than extremely massive stars? wh Indeed, the lowest mass for a star is a well-known limit: Ind 8% of the Sun’s mass. Below that, stellar cores lack the necessary pressures and temperatures to sustain nuclear ne fusion. But theories are less clear-cut on the upper boundfus ary. For the moment, astronomers can only surmise that ary a li limit exists. Above a certain mass, nuclear reactions in a stellar core become so powerful that they destroy the star. Calculating this exact mass depends on our knowledge of nuclear and stellar physics, but is thought to be around 100 to 120 solar masses for stars that have formed recently in our Milky Way Galaxy. It remains to be tested if our educated guesses are correct.
Wavelength (angstroms) THE SPECTRUM METHOD Astronomers compare the actual spectrum (red line) of the HD 48099 system with a model spectrum (blue line) to infer the star’s mass. This method, however, lacks precision and can only provide approximate masses.
Sk yandTelescope.com May 2010 23
worldmags & avaxhome
NASA / ESA / J. MAÍZ APELLÁNIZ (INSTITUTO DE ASTROFÍSICA DE ANDALUCÍA) (2)
Our Galaxy’s Biggest, Brightest Brutes
SINGLE TO DOUBLE A Hubble Space Telescope image splits the extremely luminous star Pismis 24-1 into its two binary components. Instead of being one star of 200 to 300 solar masses, the two components contain about 100 solar masses each.
solar masses. But in 1991, the Hubble Space Telescope confirmed earlier results from speckle imaging that R136 was a tight cluster composed of hundreds of stars. Sure, it contained some very massive stars, but they were not as massive as previously claimed. The same error was made on a smaller scale for Pismis 24-1, when recent Hubble observations showed that it consists of two stars. The mass of the famous Pistol Star, often mentioned as the record-holder with an original mass of 200 Suns, is thus to be taken with caution: it could be off by a factor of two.
4
Theoretical range in early universe Upper limit from cluster statistics
3
1 2
100
10
2
3
4
1
Brightness
1
Number of stars
S&T: CASEY REED
150
S&T: CASEY REED
Stellar mass (solar masses)
500
If observing one star doesn’t give precise information, measuring several can yield reliable statistics. Astronomers have known for decades that the mass distribution of stars is not random: massive stars are less common that low-mass stars. When expressed mathematically, this distribution is called Salpeter’s law, after the late Cornell University astronomer Edwin Salpeter. For each star in our galaxy with a mass between 60 and 120 solar masses, there are 250 objects with 1 to 2 solar masses, and 5,600 stars with one-fifth to one-tenth of the Sun’s mass. Astronomers can observe a group of stars, estimate the
Time
SALPETER’S LAW Astronomer Edwin Salpeter (1924–2008) devised a famous law showing that low-mass stars are much more numerous in our galaxy than high-mass stars. Low-mass stars form more easily, and they live longer lives.
ECLIPSING BINARIES The most direct method for “weighing” massive stars is to study binary systems in which the two stars periodically eclipse each other. A detailed analysis can yield reliable mass determinations. The two stars here have unequal sizes.
24 May 2010 sky & telescope
worldmags & avaxhome
14
16
18
20
22
Number of stars
100
10
0 10
100
1,000
Initial mass (solar masses)
ARCHES CLUSTER Right: The Hubble Space Telescope images the Arches Cluster, a rich collection of massive stars near the galactic center. A detailed study of the cluster reveals the relationship between the initial masses and infrared luminosities of Arches members (upper left) and the number of stars per unit mass (lower left). The total lack of stars above 130 solar masses indicates that stars of this mass rarely or never form in our galaxy today, since Hubble could have spotted them.
stellar masses through the mass-luminosity relation (however imprecise that might be), and then check if Salpeter’s law correctly applies. To understand the population of the rare massive stars, one needs a very large stellar group — such as the Arches cluster, a grouping of about 100 hot, luminous stars (and thousands of cooler ones) near the galactic center. The statistical analysis clearly shows a shortage of extremely high-mass stars: 20 to 30 stars with more than 130 solar masses should be present that are not detected. This result implies that stars with more than about 130 solar masses cannot form. Similar studies based on the simultaneous analysis of several clusters have derived comparable upper limits of 150 solar masses. But if astronomers have proven that the limit exists, they do not have a precise value yet. Statistically, 130 or 170 solar masses are as acceptable as the mean value of 150.
NASA / ESA / DONALD FIGER
12
Magnitude (infrared K-band)
DATA: DONALD FIGER (ROCHESTER INSTITUTE OF TECHNOLOGY) (2)
Initial mass (solar masses)
140 120 100 80 60 40 20 0 10
these values depends mainly on the quality of the spectra. Today, it can reach 1 kilometer per second, or about 2,200 miles per hour. (Compare this to the 1-meter-per-second precision achieved in exoplanet searches of low-mass stars observed with very-high-resolution spectrographs.) But the velocity curve alone doesn’t yield the actual stellar distances and masses. These parameters have to be multiplied by a factor depending on the orbit’s
In fact, there is only one proven method for precisely determining the mass of a star: studying eclipsing spectroscopic binaries. About half of stars reside in binaries, in which two stars revolve around a common center of gravity. The spectra of such systems combine the spectrum of each star. Spectral lines, which are the signatures of chemical elements, therefore appear double. The positions of these lines change over time. This movement, linked to the Doppler effect, reflects the orbital motion. The lines of the approaching star are shifted toward the blue, whereas those of its receding companion are shifted toward the red. The shifts are reversed after half a cycle. Astronomers can then apply Kepler’s and Newton’s laws to measure the velocities and thus determine the orbital parameters: the distances of the stars to their common center of mass, the orbital eccentricity, the period, and each star’s mass. For massive stars, the precision achieved for
GAPHE / JEAN MANFROID / ERIC GOSSET (UNIVERSITÉ DE LIÈGE)
The Solution
WOLF-RAYET STAR A European 2.2-meter telescope in Chile took this optical image of WR22 (the bright star in the center), an unusual eclipsing binary Wolf-Rayet star whose primary component has a mass of 55 to 72 Suns.
Sk yandTelescope.com May 2010 25
worldmags & avaxhome
200 0 –200 –400 13.4 13.6 13.8 0
0.5
1
Cycle (period = 3.675 days)
CLUSTER IN X-RAYS Right: NASA’s Chandra X-ray Observatory turned its big eye toward another rich cluster near the galactic center, Westerlund 2. The brightest X-ray source in the field is WR20a (arrowed). Top left: Radialvelocity measurements in 2004 revealed the star to be a massive binary. Lower left: Eclipses detected in optical observations, when combined with the velocity data, show that the two stars have a whopping 82 and 83 solar masses.
inclination to our line-of-sight. The orbital plane could be tipped in any direction, so the masses determined by this method are thus only lower limits. To eliminate that uncertainty, astronomers study eclipsing binaries. The stars in these systems periodically occult each other, which means that the orbital plane is nearly perfectly aligned with our line-of-sight. The most promising targets are the rare stars of spectral type O2 and O3, which are the hottest and most luminous known. But studies of these objects have not fulfi lled our hopes. Astronomers have measured O3 stars with 50 to 60 solar masses, but this is quite far from the mean value of 150 estimated by cluster statistics.
The Birth of Massive Stars Astronomers have known for decades that low-mass stars form and grow by accreting nearby gas. Such a process has problems forming massive stars, however. Before they are completely formed, these objects begin to shine so brightly that the sheer pressure of their radiation pushes away infalling material — prohibiting further growth. This threshold occurs at about 10 solar masses. But stars much more massive than that clearly exist.
NASA / ESA / UNIV. DE LIÈGE / Y. NAZÉ ET AL.
400
DATA: GREGOR RAUW (UNIV. DE LIÈGE) ET AL (2)
Visual magnitude
Radial velocity (km per second)
Our Galaxy’s Biggest, Brightest Brutes
In fact, the most massive known stars came from an unexpected direction: Wolf-Rayet stars. In principle, these objects correspond to evolved O stars that have exhausted their hydrogen fuel and are now burning helium and heavier elements in their cores. Since hot stars possess strong stellar winds (a scaled-up version of the solar wind), they eject tens of solar masses — perhaps half their initial mass — during their lives. Indeed, WR stars are generally much less massive than O stars. The classification of WR stars relies only on the peculiar appearance of their spectra, which results from the presence of a very dense outflow. But in the past few years, astronomers have detected “false” WR stars. These
Theorists can get around the problem in one of two ways. First, they have developed models in which a star accretes gas at its equator and emits most of its light from its poles. Second, they can invoke the merger of two or more lowmass stars into a very massive star near the centers of dense clusters. These formation scenarios lack clear-cut limits, and there are no observations yet that could help constrain them since we have never witnessed the birth of a truly massive star. — Y. N. MARK KRUMHOLZ (UNIV. OF CALIFORNIA, SANTA CRUZ)
3,000 a.u.
17,500 years
25,000 years
34,000 years
41,700 years
55,900 years
SIMULATED STARBIRTH Frames from a computer simulation show how massive stars might form. Inwardly spiraling material in a disk feeds material to the growing star. But when it reaches about 17 solar masses (third frame), the outpouring of radiation can counteract gravity, pushing away inflowing gas and carving out large cavities. Disk instabilities lead to the formation of several smaller protostars and filaments, leading to sporadic accretion that allows the biggest star to continue growing in mass.
26 May 2010 sky & telescope
worldmags & avaxhome
What About Eta Carinae?
NATHAN SMITH / JON MORSE / NASA
Eta Carinae is certainly one of the most luminous and massive stars in our galaxy. Based on its extraordinarily high luminosity of about 6 million Suns, astronomers inferred that it may contain about 120 solar masses. But this guesstimate could be way off because the star is shrouded in mystery…literally. This Hubble Space Telescope image shows Eta Carinae embedded in the Homunculus Nebula, which contains many solar masses of gas and dust ejected by the star. This material makes direct observations of the star virtually impossible. There’s strong evidence for a binary companion, but astronomers have yet to ascertain its exact properties. Current estimates suggest the two stars contain about 90 and 30 solar masses. — Robert Naeye
deviant objects are still burning hydrogen in their cores: they are thus super-O stars rather than their evolved descendants. They just happen to eject large amounts of material, much more than “normal” O stars, thereby mimicking the characteristics of genuine WR stars. In 1996 a Belgian team led by Gregor Rauw studied the very massive Wolf-Rayet star WR22 and measured a minimum mass of 72 Suns. This surprising result was confirmed by a team led by Jörg Schweickhardt, but with a downward revision to 55 solar masses. This conclusion is still to be secured — the second team had more spectra but of a lesser quality. In 2004 the same Belgian team unveiled the incredible properties of the truly astonishing binary WR20a, a system little studied until then. It’s now known to contain two stars of 82 and 83 solar masses — with an uncertainty of only 7%. Each one of these objects beats the previous record by a large amount. Since then, the quest has intensified, thanks to the combined efforts of Belgian, Canadian, and Argentinean teams. The results for various eclipsing binaries are generally less precise than for WR20a, but they are all very encouraging: HD 15558 contains two objects of 152±51 and 46±11 solar masses; NGC 3603-A1 possesses two stars of 114±30 and 84±15 solar masses; WR25 consists of two stars of 75±7 and 27±3 solar masses; and R145 has two components of 140±37 and 59±26 solar masses. These values need to be confirmed, but they show that astronomers are inching closer to the symbolic figure of 100 solar masses. Theoretical work is needed to check if these observations fit the current stellar models. It’s possible that a more massive star than the ones mentioned above could
exist and have no binary companion at all. In this case, there’s no possibility to ascertain its mass precisely and so astronomers must accept defeat.
Even More? Is 100 solar masses the final record? Maybe not. Over the past decade, a new type of star has emerged at the forefront of stellar astrophysics: Population III. These were the first stars born in the universe, when the cosmos was only a few hundred million years old (S&T: May 2006, page 30). Because they formed from gas clouds consisting of pure hydrogen and helium, computer simulations strongly suggest that these objects did not follow Salpeter’s law. They could have been very massive — “very” meaning several hundred For more information about the solar masses, maybe up to a few author’s research group, visit thousand! Other researchers have www.gaphe.ulg.ac.be/index_e.html. also speculated about the early existence of dark-matter-powered stars that could have had up to 10,000 solar masses (March issue, page 26). Population III stars could be the sources of distant gamma-ray bursts. Our present telescopes cannot see far enough back in time to study such objects, but astronomers are confident that the next generation of instruments, such as NASA’s James Webb Space Telescope, the Thirty Meter Telescope, and the Extremely Large Telescope, will help confirm or deny this bold hypothesis. ✦ Yaël Nazé is an astronomer at the FNRS/Université de Liège, Belgium, who studies massive stars. As a writer and public lecturer in her free time, she tries to share her passion for these intriguing objects — and other marvels of the sky. Sk yandTelescope.com May 2010 27
worldmags & avaxhome
Your Light-Pollution Guide
Light pollution is worse than ever, but a new mindset and new technology are poised to slow — and perhaps reverse — this bane of astronomy.
j. kelly beatty
It’s difficult to pinpoint exactly when outdoor lighting began to spoil our view of the night sky. Electric streetlights made their debut in the 1880s and quickly spread to major cities. By the 1930s the alreadydeteriorating sky above Mount Wilson, which overlooks the Los Angeles Basin, caused George Ellery Hale to go elsewhere for what would become Palomar Observatory. During the 1950s, General Electric and Westinghouse helped line America’s roadways with millions of “cobrahead” streetlights that remain today. Then, around 1970, light bulbs filled with high-pressure sodium gas began to blanket the landscape with their peach-colored glare. More certain is where and when astronomers took their first stands against the spread of artificial light. Officials in Flagstaff, Arizona, passed an ordinance in 1958 that banned searchlights from spoiling the skies above Lowell Observatory. Farther south, outdoor lighting in Tucson became regulated in 1972, the first of many enactments to protect Kitt Peak National Observatory (KPNO). In 1988, KPNO astronomer David L. Crawford teamed with local amateur Tim Hunter to found the International
Dark-Sky Association (IDA), which today boasts sections in 24 states and 14 countries. The common-sense tenets of good nighttime lighting that Crawford and Hunter championed remain unchanged today: use light only where it’s needed, only when it’s needed, and no more of it than is necessary for safety and security. In the meantime, however, our 24/7 society has become ever more intent on lighting up the nighttime environment. For example, throughout the 1990s the U.S. population grew at less than 1.5% per year — yet the flood of lumens cast into the night rose annually by about 6%. This trend has made light pollution worse where it already existed and now threatens many areas that had previously been considered pristine. It’s estimated that virtually everyone living in the U.S. and Europe experiences some degree of light pollution and that two-thirds of us can no longer see the Milky Way from our homes. Even our national parks are no longer safe havens for starry skies. During the past several years a small team of astronomers has carefully documented the extent of light’s encroachment in more than 60 U.S. national parks
28 May 2010 sky & telescope
worldmags & avaxhome
The spectacular night sky above Arches National Park is diminished by the bright glow from nearby Moab, Utah. Park officials are now working with townspeople to reduce the skyglow. TYLER NORDGREN
Late 1950s
Middle 1970s
1997
2025
How bad can it get? Italian researcher Pierantonio Cinzano and others have used computer modeling to extrapolate 1997 nighttime satellite imagery of North America backward and forward
in time, assuming light pollution grows annually 6%. Dark blue indicates areas where artificial skyglow exceeds natural skyglow by 11%, white areas by 2,700%.
and other key settings. Their results are unsettling: even remote sites have been affected by the glow of towns and cities up to 100 miles away. “The superintendents are usually surprised by the amount of light pollution we find,” notes Chad Moore, who heads the National Park Service’s night-sky team. Many have undertaken aggressive steps within their parks’ boundaries and with surrounding communities to restore the natural darkness. While early efforts to control nighttime lighting focused on preserving the starry skies for professional
and amateur astronomers, a growing cadre of illumination specialists, environmental groups, and biomedical professionals has come to realize that light pollution can have far-reaching consequences in other aspects of modern society. Biologists have known for decades that bright outdoor beacons can disrupt the migrating, eating, and mating of nocturnal animals — but there’s new, urgent attention on how disrupted darkness might impair the circadian (day-night) cycles of humans as well. The big questions are whether light at night suppresses Sk yandTelescope.com May 2010 29
worldmags & avaxhome
J. KELLY BEATTY (4)
Your Light Pollution Guide
U.S. NATIONAL PARK SERVICE NIGHT SKY TEAM
NASA
Most cities and towns in North America use streetlights with incomplete shielding (example at left) that allow a some of their light to beam above horizontal and directly into the sky. When properly installed, fully-shielded fixtures (example at right) emit no light above horizontal and also create much less glare at ground level.
lish a light-cancer link. For example, good circadian function also requires exposure to bright light during daylight hours (S&T: December 2006, page 48). Shift workers might rely more on unhealthy meals high in fats and sugars. As Thomas Kantermann and Till Roenneberg (University of Chicago makes a bold statement about its outdoor lighting Munich, Germany) comment in last September’s Chrowhen seen from orbit at night. Dan Tani captured the view in 2008 while aboard the International Space Station. nobiology International, “Light-at-night may even turn out to be a good predictor for a lifestyle that supports cancer development without itself being part of the causal chain.” the body’s production of melatonin, and in turn whether Even so, notes sleep specialist Steven Lockley (Harvard a chronic melatonin shortfall leads to health problems. In Medical School), “Over the past 20 years our and others’ 1987, Richard Stevens (University of Connecticut) posited research has shown that the sleep and circadian systems that female shift workers, those typically exposed to strong are exquisitely sensitive to light, and that very dim light light at night, are more likely to develop breast cancer. The is capable of eliciting measurable effects on human research trail continues to implicate melatonin production physiology.” But how dim is dim? There’s a big differ(or the lack of it) for this increased risk, and in 2007 the ence between working in a brightly lit hospital ward and International Agency for Research on Cancer concluded, having some stray streetlight filter into your bedroom. “Shiftwork that involves circadian disruption is probably We might know the answer soon: a clinical study is under carcinogenic to humans.” way that exposes sleeping subjects to varying levels and But many researchers urge caution in trying to estabwavelengths of light. There’s also new emphasis on how harsh glare from poorly shielded lighting affects our ability to see at night. Scattering of bright light (especially blue wavelengths) within the eye causes loss of contrast and leads to unsafe driving conditions — much like struggling to see the road when sunlight streams through a dirty windshield. It’s particularly bad for older drivers. This concern led the American Medical Association to adopt, last summer, a resolution Gila National Death Valley Great Smoky Mtns. calling for reduced glare and light pollution through the Forest National Park National Park widespread use of fully shielded lighting. Mario Motta, a Boston-area cardiologist and lifelong amateur astronomer, Brighter led the AMA effort (S&T: May 2009 issue, page 8). Meanwhile, work begun by British amateur Chris False-color fisheye views show the night sky’s appearance over Baddiley and expanded more recently by Chris Luginselected U.S. national parks. At the very darkest parks, the visual buhl (U.S. Naval Observatory) could have a major impact limiting magnitude is 7.0 or slightly better. In contrast, in some on the design of future streetlight systems. They have locales the Milky Way can be glimpsed at the zenith but gets overcarefully modeled how light scatters around in the whelmed around the horizon by the “light domes” of distant cities.
30 May 2010 sky & telescope
worldmags & avaxhome
TODD CARLSON (2)
lower atmosphere and come to a dramatic and possibly game-changing conclusion. Waste light that gets beamed straight up is not doing much harm to dark skies — essentially, it escapes to space before much scattering can occur. Rather, the greatest degradation comes from light that streams out to the sides, at angles just above horizontal. As Luginbuhl and two coauthors detail in the December 2009 issue of Physics Today, even a seemingly insignificant 3% uplight directed sideways can triple the skyglow (versus a fully shielded fi xture with the same output) above an observatory more than 100 miles away. Conventional wisdom has long argued that a little uplight was a small price to pay for wider light distribution on the ground, which permits lighting poles to be spaced farther apart than if fully shielded fi xtures are used. But the work of Baddiley and Luginbuhl shows full shielding is the better bet for creating less skyglow.
Left: When a regional power failure plunged Toronto into darkness on August 14, 2003, Todd Carlson of Goodwood, Ontario, hurried to capture the summer Milky Way directly above the city. (Lights in the house are from candles and flashlights.) Right: By the next night, with power restored, his sky was again hopelessly awash with the pall of artificial skyglow.
The Promise of LEDs Beyond concerns about saving the stars or averting health issues, dark-sky proponents think their most persuasive argument to curb light pollution is the energy savings possible from well-designed fi xtures that put light on the ground instead of sending it into the sky. The timing to make this case couldn’t be better: the combination of “going green” and recession-induced budget shortfalls has everyone — from homeowners to world leaders — looking for ways to reduce energy consumption. Recent statistics from the Department of Energy show
Low-pressure sodium
CHRIS LUGINBUHL
High-pressure sodium
400
Metal halide Light-emitting diode Incandescent 500
Spectra of the most common outdoor-lighting sources. Note how low- and high-pressure sodium lamps leave much of the visual spectrum unaffected.
600
Relative sensitivity
Circadian sensitivity
DATA: PETE STRASSER / IDA
Scotopic sensitivity Photopic sensitivity Blue-rich LED
400
500
600
700
800
Wavelength (nanometers) Unfiltered, LED-powered outdoor lighting creates a blue-rich light that might prove harmful to the circadian function of animals and humans. Much of the LED emission also falls outside the scotopic (nighttime) sensitivity of human vision.
that outdoor fi xtures account for only 8% of the electricity used for lighting in the U.S. But this still amounts to an astounding 72,000 gigawatt-hours annually. Almost all of that, 93%, goes to illuminating streets and parking lots. (By one estimate, 60 million cobrahead streetlights line American roadways.) So it’s hardly surprising that many municipal managers have opted to turn off unnecessary streetlights as a means to cut costs. More good news: many utilities now install fully shielded fi xtures as a matter of course. Lumec, a major area and streetlight manufacturer based in Canada, reports that fully shielded fi xtures now account for 70% of its outdoor-lighting sales. The choice of bulb type makes a big difference too. Incandescents, which squander 90% of their electricity as heat, deliver only about 18 lumens of light per watt. Mercury-vapor lighting is more efficient, 40 to 50 lumens per watt, but these sources are rapidly disappearing due to contamination concerns and a 2005 federal law curtailing their use. The current gold standard for streetlights, highpressure sodium (HPS), can top 100 lumens per watt. What’s got everyone abuzz is the potential for solidstate lighting — particularly light-emitting diodes (LEDs) — to take energy efficiency to a new level. So-called “power” (high-output) LEDs can already crank out 100 lumens per watt and soon might top 200. Moreover, they’re compact, can last 10 years or more, and (unlike HPS and other typical streetlight bulbs) can be dimmed or turned off/on at will. Best of all, LEDs are inherently directional — they must be pointed downward at their target. “LED lighting has the potential to revolutionize outdoor lighting in a profoundly positive way,” observes Robert Parks, IDA’s interim executive director. Fueled by federal stimulus money, officials at the U.S. Department of Energy and Environmental Protection Sk yandTelescope.com May 2010 31
worldmags & avaxhome
Your Light Pollution Guide
S&T: GREGG DINDERMAN
Poor, Better, and Best Streetlamps
The ubiquitous but glary fixtures dubbed “yard blasters” (far left) by amateur astronomers use relatively inefficient and environmentally dangerous mercury-vapor bulbs. Recent and proposed U.S. federal regulations could make their manufacture illegal by 2016. Most cities and towns in North America use streetlights with incomplete shielding (center left) that allows a fraction of their light to beam above horizontal and directly up into
most-efficient LEDs have a distinctly blue cast, with a strong peak at 460 nanometers. Some photobiologists and eye doctors have expressed concern about unleashing so much blue light, however well directed, into the nighttime environment. To get “warmer” light, an LED’s output can be passed through a phosphor that reradiates it at longer wavelengths — losing up to 25% of its lumens in the process. This lumen gap is narrowing, however, as manufacturers strive to balance optimum efficiency with aesthetic appeal and environmental sensitivity.
“The Flea That Roared” As all of this research and development rises to a fever pitch, IDA’s staff and volunteers strive to gain recognition as “the light-pollution authority.” The organization’s website (www.darksky.org) boasts that 19 U.S. states and four countries have enacted outdoor-lighting regulations, with California, Connecticut, and New Mexico’s among the strictest. The IDA has come a long way since its humble begin-
BETALED (2)
Agency have initiated a hard-charging campaign to roll out a wide range of commercially viable products as soon as practicable. Right now these agencies are putting the finishing touches on the criteria that will qualify an LED fi xture for an Energy Star label. For example, a pole-mounted outdoor installation won’t be allowed to emit any of its lumens above horizontal (except for incidental reflections off the housing). Especially encouraging is the introduction of a new performance metric, fitted target efficacy, that puts a premium on illuminating a target area as efficiently and uniformly as possible without “overspill” beyond the intended boundaries. Although still relatively expensive, LEDs are likely coming to a streetlight near you. The first large-scale installations are already being tested and installed in China, North America, and Europe. Last summer Los Angeles officials inked a deal, brokered by the Clinton Climate Initiative, to install 140,000 LED streetlights over the next five years. If there’s a downside to this technology, it’s that the
the sky. When properly installed, fully-shielded fixtures (center right) emit no light above horizontal and also create much less glare at ground level. Unlike typical high-intensity-discharge (HID) luminaires, which produce light from a single dazzlingly bright bulb, solid-state lighting (SSL) uses banks of individual lightemitting diodes (far right) whose output is strongly directional.
As seen in this before and after comparison from a retrofit in Walnut Creek, California, properly installed LED streetlighting can dramatically reduce uplight and improve illumination uniformity. However, the most efficient LED sources create a much stronger bluish cast (right) than the high-pressure-sodium fixtures (left) they’re designed to replace.
32 May 2010 sky & telescope
worldmags & avaxhome
NEAF
Someday this consumer-friendly label, developed by the U.S. Department of Energy for LED fixtures, may be affixed to all lighting products sold in America. LIGHTINGFACTS.COM / LSI INDUSTRIES
Discounts For Everyone!
NATIONAL GEOGRAPHIC SOCIETY
nings in Tucson 22 years ago. The group sponsored briefings about light pollution for Congressional staffers in 2008 and 2009, opened a Washington office last year to weigh in on policy issues, and has directly aided the ongoing development off E Energy Star criteria for LED illumination. As lighting expert (and board member) James Benya quips, “IDA is the flea that roared.” Arguably IDA’s most successful initiative has been the Fixture Seal of Approval program. Manufacturers submit their lighting products for certification, and then objective, third-party testers evaluate the fi xtures’ photometric performance. Once a product proves to be dark-sky friendly, the manufacturer gets to use the FSA seal to promote and advertise its “IDA Approved” product. To date the program has certified more than 400 fi xture styles. But not all of its efforts have borne fruit. Nearly a decade ago, the association partnered with the Illuminating Engineering Society of North America to develop a model lighting ordinance that would give cities and towns easily adapted outdoorlighting regulations. While two ordinance drafts have received public airings, to mixed reviews, a consensus document will take more time to achieve. Meanwhile, other national and international groups have mounted offensives to combat light pollution. Among them are the British Astronomical Association’s Campaign for Dark Skies, which has made some headway in getting local governments to switch off unnecessary streetlights, and the Starlight Initiative, Light-pollution awareness took a big step forward when it became the cover story of National Geographic’s November 2008 issue.
More than th 100 manufacturers f t have earned the IDA’s Fixture Seal of Approval.
w which in 2007 issued a ““Declaration in Defence of the Night Sky and the o Right to Starlight.” To R cap it all off, organizers c off the just-ended International Year of h j d d Astronomy made “dark-skies awareness” one of their global cornerstone projects (see page 86). A few (but too few) professional astronomers have been active in the fight to keep their observatories safe from the advance of artificial skyglow. The International Astronomical Union and American Astronomical Society both maintain standing committees to combat light pollution, though to date their members have largely cheered from the sidelines while volunteers from the amateur community have done the heavy lifting. The “hook” of energy savings has given the light-pollution debate traction in public venues where once there was none. Major publications such as The New York Times, The Wall Street Journal, and The New Yorker have run feature articles on the subject. But none has gained more attention than the November 2008 issue of National Geographic, whose cover boldly declared “The End of Night” across the sickly orange pall of downtown Chicago. Perhaps because of that notoriety, Mayor Daley’s staff is planning a wholesale overhaul of the city’s streetlighting system. After decades of struggling to be heard, do dark-sky proponents finally find themselves in a position to effect real change? Will their efforts eventually be rewarded with a return to modestly darker skies? Backyard skygazers around the world hope the answer is “yes.” ✦
Now through April 30th receive NEAF discounts on virtually everything. Call or email for your discount. See us at:
NEAF Visit us
NORTHEAST ASTRONOMY FORUM
onlin e at:
Suffern, NY / April 17-18
www .high
poin tscie
ntifi c.
com
Explore Scientific 127mm f/7.5 ED Triplet Refractor $1999 FREE SHIPPING
Astro-Tech 10" f/8 Ritchey-Chrétien Astrograph $2,695 FREE SHIPPING
Meade LS 8” ACF f/10 Computerized Telescope $1,999 FREE SHIPPING
Senior contributing editor J. Kelly Beatty moved to a new home four years ago and can now see the Milky Way on a good night. He has served on the IDA’s Board of Directors since 2006.
worldmags & avaxhome
Montague, New Jersey (800) 266.9590
Two Eyes or One?
Big Binos Tony Flanders
These instruments have different but overlapping capabilities. When I was a child, my father bought me a very nice pair of 7×35 binoculars, which soon became one of my most cherished possessions. I used the binoculars to scan the New York City skyline from my 17th-floor window, to identify birds, to watch ballgames — and to find my first star clusters and galaxies. I dabbled in astronomy for several decades, occasionally learning a new constellation or viewing a new object with my 7x35s. Then, quite suddenly, I realized that I was long overdue to buy my first serious telescope. After considerable research and one false start, I ended up with a 70-mm refractor — a decision I’ve never regretted. I plunged into astronomy with abandon, observing for hours on every clear night. My little scope gave me my first really good views of the planets, and I used it to track down all 109 Messier objects (great galaxies, star clusters, and nebulae), and much more. I also bought a pair of 10×50 binoculars, the size most often recommended as the best compromise for hand-held astronomical binoculars. The specifications mean that they magnify 10 times and their aperture — the diameter of their main lenses — is 50 mm, or 2 inches. At powers
much higher than that, most people find that the images through casually hand-held binoculars become too wobbly, and some kind of supplemental support is needed. Although the 10×50s were a significant step up from my 7×35s, I still wasn’t satisfied. Ever since my childhood I’d been yearning for really big binoculars — ones with at least 70 mm of aperture. However, I found it hard to justify buying them when I already owned a 70-mm telescope. Could the benefits of using two 70-mm lenses rather than one really justify owning two instruments with almost identical specifications? Eventually, curiosity got the better of me; I just had to find out. Fortunately, the marketplace had changed greatly since I first contemplated such a purchase in the 1960s. Cheap was no longer synonymous with shoddy; many beginners were reporting complete satisfaction with 15×70 binoculars costing less than $100. I opted instead for the low middle range, spending $150 for a pair of lightweight 15×70 binoculars from Oberwerk. (Very similar units are available from several other vendors.) S&T photo taken by Dennis di Cicco.
34 May 2010 sky & telescope
worldmags & avaxhome
versus
Scopes
S&T: DENNIS DI CICCO (2)
Small
To see really fine details at 15×, you need to attach your instrument to a solid mount. But tripod-mounted binoculars require you to bend your neck painfully when viewing objects that are high in the sky. Most small scopes, by contrast, are equipped with star diagonals that let you view the zenith with ease. The flip side is that you lose the direct connection to the sky provided by binoculars’ straight-through viewing angle.
Meet the Contenders What does $150 buy? Quite a lot, it turns out; the Oberwerk 15×70s, are certainly worth what I paid — and then some. I have compared them to a borrowed pair of Fujinon 16×70s, which are often cited as the best binoculars in this class. There’s no question that the Fujinons are superior in many ways, as well they should be, considering that they weigh 50% more and cost four times as much. But the Oberwerks are quite sharp in the center of the field of view, they’re fairly well baffled against stray light, and their focuser is smooth and accurate — all the essentials. Most important of all, the Oberwerk 15×70s happen to fit me well. The distance between the centers of my eyes (my interpupillary distance) is 57 mm, unusually small for an adult male. Unlike many binoculars, the Oberwerks fold up just tight enough to suit me. And they have 16 mm of true eye relief (the distance between the binoculars and your eyes when properly placed), allowing me to see almost the whole field of view with glasses on. The Fujinons, by contrast, have short eye relief and unusually large eyepieces. When I fold them up tight
enough to fit my eyes, take my glasses off, and bring the binoculars close enough to see more than half the field of view, my nose jams painfully between the eyepieces. So despite the fact that the Fujinons are significantly sharper toward the edge of the field of view, and show brighter images against a darker sky background, I much prefer using the Oberwerks. However, people who don’t wear glasses and have wide-set eyes rave about the Fujinons, and wouldn’t trade them for anything else at any price. As for my telescope, it’s a Tele Vue Ranger, reviewed in the November 1995 issue (page 48). The Ranger is a 70-mm f/6.8 refractor, meaning that the focal length (the distance from the front lens to the eyepiece) is roughly 70 × 6.8 = 480 mm. The relatively short focal length makes the scope quite compact, and also allows it to operate at low magnifications, with a wide field of view. In fact the Pronto, the Ranger’s big brother, has identical optics and a 2-inch focuser, allowing it to use eyepieces that give a significant wider field of view than 15x70 binoculars. Yet the mechanical and optical quality also support high magnifications well. I routinely use my Ranger at 120×, and occasionally push it far higher. Both the Ranger and the Pronto have been discontinued, replaced by Tele Vue’s TV-76, which offers the same wide-field potential as the Pronto, has larger aperture, and is an apochromat, meaning that it shows essentially no colored fringes around bright objects, even at the highest magnifications. The Ranger cost me about $750 including accessories, which was a bargain in its day, considering the scope’s high quality and short focal length. (It’s harder to build a good, short refractor than a good, long one with equal aperture.) Today that kind of money can buy a scope of comparable quality with a 2-inch focuser, bigger aperture, and similar focal length. Bear in mind that most of my comparisons pit this fairly high-end telescope against an inexpensive pair of binoculars. In fact, like many if not most binoculars in their price range, the 15×70 Oberwerks don’t make full use of their main lenses. They have internal baffles that reduce their effective aperture to roughly 63 mm. Nonetheless, the binoculars clearly outperform the telescope
Sk yandTelescope.com May 2010 35
worldmags & avaxhome
Two Eyes or One?
S&T: TONY FLANDERS (2)
Left: A simple parallelogram mount like the Paragon-Plus (sold by Orion Telescopes & Binoculars) puts some distance between you and the tripod, and lets you fine-tune the binoculars’ height with the touch of your hand. This design is relatively simple, inexpensive, and light, but only works well when you’re standing. Right: The UniMount Light, from Universal Astronomics, is jointed so that it can suspend binoculars over a lounge chair, allowing you to observe in complete comfort. And it’s counterbalanced on every axis, so it stays wherever you push it, like a dentist’s light.
Advantage: Binoculars I first compared my 15×70 binoculars and my 70-mm scope on a clear March night at my country home. I stayed up from dusk long past midnight, observing first the nebulae and open star clusters of winter, then the galaxies of spring, and ending with the globular clusters of early summer. Since then, I have observed all 109 objects in the Messier catalog, and many other celestial showpieces, using both instruments side-by-side at my country home. I have also done extensive comparisons at parks near my city home, battling heavy light pollution. For each comparison, I start out by viewing my target through the telescope at 16× and then increase the magnification until I obtain the best possible view, which is typically anywhere from 40× to 70×, depending on the object. The view through the telescope at 16× is surprisingly different from the view through the binoculars, despite the fact that the magnification and field of view are nearly the same. Everything appears much brighter in the binoculars — both my target objects and the sky background. You can see the same effect by going outside on a dark night, looking for the faintest stars you can see, and then covering one eye with your hand. In all probability, the
faint stars will disappear. When you use both eyes, your brain merges two faint images into a single, brighter one. Using two eyes also enhances colors. The stars of the Beehive cluster (Messier 44) are nearly monochrome in my refractor, but the binoculars show several with a rich reddish tint. In addition, there’s a quality to binocular views that’s easily seen, widely shared, but hard to put into words. Some describe it as a 3-dimensional appearance. To me, it’s a matter of vividness or immediacy. With a telescope, I feel as though I’m studying my subject from a distance. Binoculars bring me into the action, making it feel as though the night sky is all around me. This sense of connection to the night sky is also aided
Messier 33, the Triangulum Galaxy, has an apparent size bigger than the full Moon. But its low surface brightness and lack of a bright core make it a challenging target for beginners, especially in bright suburban surroundings. Many people find this galaxy easier to see in binoculars — even quite small ones — than in any telescope, no matter how big.
36 May 2010 sky & telescope
worldmags & avaxhome
SHELDON FAWORSKI / SEAN WALKER
in certain regards, as we shall see below. When I repeated the same comparisons using the 16×70 Fujinons, the benefits of binocular vision proved to be even greater.
by the fact that binoculars show things right-side up, whereas telescopic views are usually mirror-imaged or inverted. Also, with conventional binoculars, you look straight through the instrument, as opposed to looking downward at right angles to the way a telescope is pointing. This cuts both ways, because looking straight at objects that are nearly overhead creates logistical problems, as shown on page 35. But it also means that you can switch back and forth between the binocular and naked-eye views just by moving your head (or the binoculars) a few inches.
I can see all of the Messier objects with my 15×70 binoculars at my country home, though a few are fairly difficult. Several of the faintest Messier galaxies, including M91 and M98 (see page 45), are completely invisible through my telescope at 16×. But when I raise the telescope’s magnification to 40×, I can see these galaxies easily — together with many others that I can’t see at all through the binoculars. Conventional binoculars operate at very low magnifications relative to their apertures. Although using two eyes helps a great deal in seeing faint objects, higher magnification usually helps even more — though there are some exceptions. For instance, the notoriously faint globular cluster NGC 5053 (in Coma Berenices, just 1° from bright Messier 53) is invisible in the Ranger at any magnification, but I can see it (barely) with my 15×70s. Some objects, such as the Beehive and Pleiades star clusters, are very large, and require wide fields of view to frame them well. Though few in number, such objects appear high on any list of celestial showpieces, and most people find them more attractive through binoculars than
ADAM BLOCK / NOAO / AURA / NSF
Advantage: Telescope
Clusters of tightly packed faint stars need plenty of magnification to do them justice. M11, shown here, is a bright blur through 15×70 binoculars, but resolves into dozens of individual stars when viewed under dark skies at 60× with a 70-mm telescope.
telescopes. But the great majority of deep-sky objects look best at magnifications higher than any normal binoculars provide. For instance, the open cluster M37 is just a bright blur at 15× or 16×, but it’s breathtaking stardust through my 70-mm scope at 70×, with dozens of faint stars shimmering through a luminous haze.
S&T ILLUSTRATION: CASEY REED
What about Bigger Scopes? It’s not really fair to compare 70mm binoculars to a 70-mm scope; after all, the binoculars gather twice as much light. A 100-mm lens has the same area as two 70mm lenses, so would a 100-mm scope be able to match 70-mm binoculars in every regard? My tests indicate that at equal magnifications, scopes are indeed a pretty close match to binoculars with the same total lens area — a little better in some ways, maybe worse in others. However, I can’t take full advantage of a 100-mm
telescope at 15×, because the exit pupil produced by such a combination is 100 ÷ 15 = 6.7 mm across. My pupils only open to 5.5 mm, so some of that light is blocked by my iris, as shown at lower left. Up to a point, you can increase the brightness of a 15× image by using a larger aperture. But once the exit pupil equals your eye’s pupil (upper left), the only way to get more light is to use two eyes. That’s why binoculars reign supreme for bright, wide-field low-power viewing.
Sk yandTelescope.com May 2010 37
worldmags & avaxhome
The planets crave high telescopic magnification. My little refractor shows Jupiter’s main cloud belts easily, and reveals substantial extra detail at 120× when the conditions are good. It’s fairly easy to see Jupiter’s moons through well-mounted binoculars, but the planet itself is just a tiny, featureless, oblate disk at 15×. So there’s no question that the ability to vary the magnification by changing eyepieces makes short-focal-length 70- or 80-mm scopes much more versatile than 15×70 binoculars. Almost everything the binoculars can do, the telescopes can do too — though not always as well. But the reverse isn’t true. For viewing planets or splitting tight double stars, all decent telescopes are far superior to any conventional binoculars, even 40×150 behemoths.
NASA / HUBBLE HERITAGE TEAM / STSCI / AURA
Two Eyes or One?
Saturn is beautiful beyond words through the author’s 70-mm scope at 120× . His 15×70 binoculars, by contrast, show barely a hint of the rings.
Why 15×70 Binoculars? So far, I’ve skirted the question of why I bought 15×70 binoculars rather than some significantly different size. In fact, binocular size involves some tricky tradeoffs, which is why I still use my 7×35s as well as my 10×50s and 15×70s — and would choose the 10×50s if I were allowed to keep just one of those. Bigger binoculars reveal fainter objects, but they’re also less convenient and have narrower fields of view. On the other hand, 15×70s offer much more spectacular views than 10×50s. Objects that are merely visible in 10×50s are impressive in 15×70s; objects that are impressive in 10×50s are jaw-dropping in 15×70s. That’s not such a huge deal to me, because I’m accustomed to squeezing every last drop of detail from things I can barely see. But many novices, especially ones who live in bright suburbs, find the views through 15×70s to be genuinely engaging, while 10×50s leave them cold. In fact, 15×70 binoculars might just be the very best possible tool for breaking into deep-sky observing. They have enough power to show many deep-sky objects with ease, yet a wide enough field of view so that you can locate those objects just by scanning the right area of the sky. At the opposite end of the spectrum, big binoculars are ideal for experienced stargazers who want to study the Milky Way under pristine dark skies. Many
worldmags & avaxhome
Milky Way features (star clouds, bright and dark nebulae) are huge; they cry out for wide fields of view. And that’s the one arena where binoculars have a big advantage over telescopes. If 15×70 binoculars are great, aren’t bigger ones greater still? Yes, really big binoculars such as 22×85s or 25x100s, and binocular telescopes that accept interchangeable eyepieces, certainly have their
For more ruminations on binoculars, see www.SkyandTelescope.com/bino_blogs.
devoted adherents — and rightly so. However, there’s a substantial jump in bulk, weight, and cost once binocular objectives exceed 70 mm. And there’s a significant loss in field of view with magnifications much higher than 15×. Hand-holding 15×70s isn’t ideal, but at least it’s an option, which isn’t true in bigger sizes. Many experienced stargazers find that 15×70 hits a sweet spot, the best possible compromise between power, convenience, and field of view. There are good reasons why this size is popular among novice and veteran stargazers alike. ✦ Associate editor Tony Flanders currently owns six telescopes, six pairs of binoculars, and one pair of special stargazing eyeglasses.
#564101/;/#&'5+/2.'
+PVJGVTCFKVKQPQH%GNGUVTQP¶UHCOQWUQTCPIG QRVKECNVWDGUVJG0GZ5VCT5'5GTKGUEQODKPGU VJGENCUUKEJGTKVCIGQHQWTQTKIKPCNQTCPIGVWDG VGNGUEQRGUYKVJUVCVGQHVJGCTVHGCVWTGUKPENWFKPI CHWNN[EQORWVGTK\GFQRGTCVKPIU[UVGOÀCUJ WRITCFGCDNGJCPFEQPVTQNQWTUWRGTKQT 5VCT$TKIJV:.6EQCVKPIUQWTTGXQNWVKQPCT[ 5M[#NKIPVGNGUEQRGCNKIPOGPVUQHVYCTGCPF OWEJOQTG/CMKPIVJGUGVGNGUQRGURQTVCDNG GCU[VQWUGCPFCPKPETGFKDNGXCNWG .GCTPOQTGCDQWVVJG5'5GTKGUCVwww.celestron.com
MODEL 0GZ5VCT5' 0GZ5VCT5' 0GZ5VCT5' 0GZ5VCT5'
0GZ5VCT 5'5GTKGU
PRICING
0 196 2 0 10
Q126%QTR±±YYYQRVEQTREQO Q5EQRG%KV[±±YYYUEQRGEKV[EQO Q*CPFU1P1RVKEU±±YYYJCPFUQPQRVKEUEQO Q#UVTQPQOKEU±±YYYCUVTQPQOKEUEQO Q*KIJ2QKPV5EKGPVK¿E±±YYYJKIJRQKPVUEKGPVK¿EEQO Q1RVKEU2NCPGV±±YYYQRVKEURNCPGVEQO 2TKEGKUUWIIGUVGFTGVCKNKP75&QNNCTU2TKEKPIUWDLGEVVQEJCPIGYKVJQWVPQVKEG&QGUPQVKPENWFGUJKRRKPIQTVCZ
worldmags & avaxhome
Q$*2JQVQ±±YYDJRJQVQXKFGQEQO Q#FQTCOC±±YYYCFQTCOCEQO Q6GNGUEQRGUEQO±±YYYVGNGUEQRGUEQO
Fred Schaaf Northern Hemisphere’s Sky
Speeding Up for Spica The evening sky changes rapidly at this time of year.
In our previous issue, I noted that the north-south meridian on the April all-sky map coincides with the 10-hour line of right ascension. That line passes just west of Regulus, the brightest star in Leo, the Lion, so I suggested that we call that time and “state of the sky” the Leo Hour. The Heavens by Hours system created by Guy Ottewell has 24 names for such states of sky — one for each of the sidereal hours. But the issues of our monthly magazine have room for only 12 of these. You might think that each new issue would advance the sidereal time by 2 hours. But if you look down near the south horizon of the all-sky chart on page 44, you will see that the central RA line is labeled as 13h, which is 3 hours ahead of last month’s sidereal time. What’s going on here? Spring forward to the Spica Hour. Has Earth radically sped up during its Northern Hemisphere’s spring?
S&T: GREGG D
IND ER M
No, but those of us at mid-northern latitudes see the Sun setting later and later. So the sky (really Earth, of course) has more time to turn before the stars come out. Our sky map must reflect this, so we advance it three hours from last month. And it brings us to a state of the sky we can call the Spica Hour. Spica is the 1st-magnitude star (magnitude 0.98, to be precise) that’s closest to the meridian at this sidereal time. As the map’s instructions tell you, the Spica Hour occurs at different clock times as the weeks and months of spring go by. If you want to experience it in late March, when this issue is received by most subscribers, you have to stay up until 2 a.m. (daylight-saving time). The Spica Hour occurs at 1 a.m. in early April, midnight in late April, 11 p.m. in early May, and at dusk in late May. The Sky at the Spica Hour. Spica is not the only star or star pattern near the meridian at this time. Sail-shaped Corvus, the Crow, is just to the west of the meridian, to the lower right of Spica. Well up to Spica’s upper left is an even brighter and somewhat orange — some say champagne-colored — star: Arcturus. And if you turn and face north rather than south, you’ll find that the handle of the Big Dipper — from which you can extend a curve out to Arcturus — is now at its highest. In May 2010, Spica is the last (leftmost or easternmost) in a long string of similarly bright gems. The line consists of Pollux, Mars, Regulus, Saturn, and Spica. The positions of the two planets are plotted on our sky map for mid-May. By the Spica Hour, Sirius and Orion, Taurus with the Hyades and Pleiades, have all set. Procyon is low in the west, Capella is somewhat higher in the northwest, and Gemini stands upright between those stars. The feet of the Twins are just above the horizon, their much higher heads marked by bright Castor and Pollux. Turning to the east, where the summer stars are rising, zero-magnitude Vega is about one-third of the way up the east-northeast sky while 1st-magnitude Deneb is much lower in the northeast. And the fire of 1st-magnitude Antares is quite low in the southeast. ✦
AN
Fred Schaaf welcomes your comments at
[email protected].
40 May 2010 sky & telescope
worldmags & avaxhome
THE MEADE LX200 -ACF . A SERIOUS TELESCOPE FOR THE SERIOUS AMATEUR. ®
®
™
Meade’s LX200 is the most widely used advanced amateur telescope on Earth. It combines the most sophisticated optical system available with rock-solid mechanical and electronic elements. With its unbelievable list of features and capabilities — the advanced amateur or researcher can load it up to perform almost any astronomical task with ease. Every LX200 comes standard with:
- Advanced Coma-Free™ Optics. ACF design produces a coma-free, flatter field of view with no
-
diffraction spikes that equals traditional Ritchey Chrétien systems at a fraction of the cost. Combine this with Meade’s patented UHTC™ coatings that increase light transmission by 20% over standard coatings, for the sharpest, brightest images you can get.
. Primary Mirror Lock. Eliminates focus and mirror shift during long exposures. Like all of the
3
features on this list, a Meade exclusive.
/ Smart Mount™ And Smart Drive™. The LX200 constantly refines pointing accuracy each time an object is centered and provides Permanent Periodic Error Correction on both axes over the course of one or more training periods. Works in both alt-az and equatorial modes. 0 Solid Fork Mount With Heavy Duty 5.75" Gears. Large, high-quality worm-gear drives provide smooth movements with low periodic error, critical for long exposures. Gives the freedom to go horizon to horizon without any meridian flip, unlike German Equatorial Mounts.
1 Autostar II Controller. Puts over 145,000 objects at your fingertips with the fastest GoTo performance available (8° per second).
2 Rock-Solid Field Tripod. LX200 comes with an adjustable Standard Field
. 4
To customize your LX200, these optional accessories are also available:
3 NEW! Series 5000 Auxiliary Equipment Mounting System. Machined aluminum dovetail plates, rings and counterweight designed specifically for the Meade LX series. Available for 8", 10", 12", 14" and 16" LX scopes.
/
*No purchase is necessary to enter or win. A purchase will not increase your chances of winning. Odds of winning will depend on total number of entries received. Void where prohibited by law. Sweepstakes open to legal residents of the U.S. or D.C. and Canada (excluding Quebec) at least 18 years of age. Sweepstakes begins March 8, 2010. Enter by April 30, 2010. Subject to full official rules. Sponsor: IMAX Corporation. IMAX® and IMAX® 3D are registered trademarks of IMAX Corporation.
©2010 Meade Instruments Corp. All rights reserved. Specifications subject to change without notice. 30-10016.
Tripod, Giant Field Tripod or Super Giant Field Tripod for a solid foundation.
0
4 Zero Image-Shift Microfocuser. Allows precise focus with no image movement at four speeds with a press of a button. Perfect for long exposures
1
5
5 Heavy-Duty Ultra Wedge. For precise polar alignment in equatorial mode, eliminates field rotation in long-exposures.
Vibration Isolation Pads. Highly desirable for sensitive imaging, these pads reduce typical vibration damping times to less than one second. Because the LX200-ACF is reliable, light weight, compact and easy to use, it is the telescope of choice for thousands of astronomers around the world.
2
Telescopes.com 800.303.5873 Astronomics 800.422.7876
For more information about the LX200-ACF line of telescopes go to meade.com.
Woodland Hills 888.427.8766
OPT Telescopes 800.483.6287
Optics Planet 800.504.5897
Scope City Canada • Khan Scopes 800.235.3344 800.580.7160
Shown with optional equipment.
worldmags & avaxhome
Enter to win the ultimate cosmic experience! Visit www.imax.com/entertowin by April 30th for a chance to win a Meade LS-6 ACF Telescope and a private screening of the newest IMAX® 3D documentary, HUBBLE 3D!* Now playing exclusively in select IMAX and IMAX 3D theatres.
Advertisement
How Has Christianity Changed over 2,000 Years? Follow the Story of Lost Christianities, an Intriguing, 24-lecture Series in Audio or DVD
I
n the first centuries after Christ, there was no New Testament. However, books of Gospels, Acts, Epistles, and Apocalypses were widely read, and were fervently followed by groups of early Christians. But they would not be among the books that formed the New Testament. From the many different scriptures then available, Christians held beliefs that today would be considered bizarre: that there were two, 12, or as many as 30 gods; that a malicious deity, rather than one true God, created the world; that Christ’s death and resurrection had nothing to do with salvation—others insisted that Christ never really died at all. What did these “other” scriptures say? Do they exist today? How could such outlandish ideas ever be considered Christian? If such beliefs were once common, why do they no longer exist? These are just a few of the many provocative questions that arise in Lost Christianities: Christian Scriptures and the Battles over Authentication. A Good Mystery Story This 24-lecture series is a richly rewarding learning opportunity for anyone interested in religion, history, or a good mystery story. Professor Bart D. Ehrman lends his expert guidance as you follow scholars’ efforts to recover knowledge of early Christian groups who lost the struggle for converts and subsequently disappeared. A major theme of this course is the struggle for orthodoxy—or right belief—among the various early Christian groups. You will witness the process by which certain Christian beliefs gained legitimacy, while others were relegated to the status of footnotes to history. You will see how Christianity developed through its early and lost writings. The struggle for orthodoxy can be seen in both the New Testament and in central Christian creeds. You will explore the development of the New Testament into an approved canon of scripture. How did the process of forming the orthodox canon take place? Who decided which books should be included? On what grounds? If so many scriptures existed, how do we know that those who selected the final books got it right? If many About Our Sale Price Policy Why is the sale price for this course so much lower than its standard price? Every course we make goes on sale at least once a year. Producing large quantities of only the sale courses keeps costs down and allows us to pass the savings on to you. This also enables us to fill your order immediately: 99% of all orders placed by 2 pm eastern time ship that same day. Order before June 4, 2010, to receive these savings.
of these writings were forgeries, how can we be sure that forgeries weren’t included in the New Testament? In these lectures you will also hear about a remarkable archaeological event: the discovery in 1945 of a treasure trove of missing Gnostic scriptures at Nag Hammadi, an Egyptian village near the city of Luxor. Consisting of 13 leather-bound volumes unearthed in an ancient grave by Bedouin camel drivers (the full story, which you will hear, resembles the plot of a bestselling adventure novel), the Nag Hammadi Library was a watershed event in the search for lost Christianities. About Your Professor Dr. Bart D. Ehrman is the James A. Gray Professor and Chair of the Department of Religious Studies at The University of North Carolina at Chapel Hill. He received his Masters of Divinity and Ph.D. from Princeton Theological Seminary. He has won several teaching awards, including the Students’ Undergraduate Teaching Award and the Bowman and Gordon Gray Award for Excellence in Teaching. Professor Ehrman has written or edited more than 15 books, including The New York Times bestseller, Misquoting Jesus, and Jesus: Apocalyptic Prophet of the New Millennium. About The Teaching Company We review hundreds of top-rated professors from America’s best colleges and universities each year. From this extraordinary group we choose only those rated highest by panels of our customers. Fewer than 10% of these world-class scholarteachers are selected to make The Great Courses®.
We’ve been doing this since 1990, producing more than 3,000 hours of material in modern and ancient history, philosophy, literature, fine arts, the sciences, and mathematics for intelligent, engaged, adult lifelong learners. If a course is ever less than completely satisfying, you may exchange it for another, or we will refund your money promptly. 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. 21. 22. 23. 24.
Lecture Titles The Diversity of Early Christianity Christians Who Would Be Jews Christians Who Refuse To Be Jews Early Gnostic Christianity— Our Sources Early Christian Gnosticism— An Overview The Gnostic Gospel of Truth Gnostics Explain Themselves The Coptic Gospel of Thomas Thomas’ Gnostic Teachings Infancy Gospels The Gospel of Peter The Secret Gospel of Mark The Acts of John The Acts of Thomas The Acts of Paul and Thecla Forgeries in the Name of Paul The Epistle of Barnabas The Apocalypse of Peter The Rise of Early Christian Orthodoxy Beginnings of the Canon Formation of the New Testament Canon Interpretation of Scripture Orthodox Corruption of Scripture Early Christian Creeds
SAVE UP TO $185! OFFER GOOD UNTIL JUNE 4, 2010 1-800-TEACH-12 (1-800-832-2412) Fax: 703-378-3819
Special offer is available online at
www.TEACH12.com/8sky Charge my credit card:
The
Great Courses
®
THE TEACHING COMPANY 4151 Lafayette Center Drive, Suite 100 Chantilly, VA 20151-1232 ®
Priority Code 40405 Please send me Lost Christianities: Christian Scriptures and the Battles over Authentication, which consists of twenty-four 30-minute lectures plus Course Guidebooks.
n DVD $69.95 (std. price $254.95) SAVE $185!
n
n
Account Number
n
n Exp. Date
Signature
Name (please print) Mailing Address
plus $10 shipping, processing, and Lifetime Satisfaction Guarantee
n Audio CD $49.95 (std. price $179.95) SAVE $130!
City/State/ZIP
plus $10 shipping, processing, and Lifetime Satisfaction Guarantee
n Check or Money Order Enclosed
Phone (If we have questions regarding your order—required for international orders)
* Non-U.S. Orders: Additional shipping charges apply. For more details, call us or visit the FAQ page on our website.
n FREE CATALOG. Please send me a free copy of
** Virginia residents please add 5% sales tax.
Special offer is available online at www.TEACH12.com/8sky
your current catalog (no purchase necessary). Offer Good Through: June 4, 2010
Advertisement
worldmags & avaxhome
Sky at a Glance
May 2010 MOON PHASES SUN
MON
TUE
WED
THU
FRI
SAT
1
DUSK: Use binoculars to spot 4th-magnitude Kappa1 Tauri about ¼° lower left of Venus (in North America). And look 5′ lower left of Kappa1 for 5th-magnitude Kappa2.
4
DUSK: The 4th-magnitude star Tau Tauri is less than ½° left of Venus. Telescopes and solidly mounted binoculars show that this star is a wide double, with a 7th-magnitude companion 63″ southwest of the primary.
1 2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
6 LAST-QUARTER MOON (12:15 a.m. EDT). 9, 10
PLANET VISIBILITY ◀ SUNSET
MIDNIGHT
SUNRISE ▶
13 NEW MOON (9:04 p.m. EDT).
Invisible to the naked eye all month
Mercury
14
Venus
W
Mars
SW
NW NW E
Jupiter Saturn
S
DAWN: The waning crescent Moon is above Jupiter on the 9th and left of Jupiter on the 10th, as shown on page 49.
SE
W
15, 16
PLANET VISIBILITY SHOWN FOR LATITUDE 40o NORTH AT MID-MONTH.
I M A G E B Y G I M M I R AT T O
DAWN: Use a telescope or tripod-mounted binoculars to look for 20 Piscium about ¼° lower right of Jupiter (in North America). This star is magnitude 5.5, about as bright as Jupiter’s Galilean satellites, only three of which are visible until Io emerges from behind Jupiter at 5:14 a.m. CDT. DUSK: The thin crescent Moon is lower right of Venus on the 15th and upper left of Venus on the 16th (see page 48). The Moon occults (hides) Venus around 10h UT on the 16th in northern Africa and southern Asia.
19
EVENING: The Moon is about 6° below Mars.
20
EVENING: The Moon is about 5° lower left of Regulus and 12° left of Mars.
20 FIRST-QUARTER MOON (7:43 p.m. EDT). 21
DUSK: Use binoculars or a telescope to view the star cluster Messier 35 less than 1° lower left of Venus.
22
EVENING: Look for Saturn about 8° above the Moon.
24
EVENING: Look for Spica about 6° upper right of the Moon.
27 FULL MOON occurs at 7:07 p.m. EDT. This evening and night, in North America, look for ruddy Antares 1° to 2° below or lower right of the Moon, as shown on page 48. The view is best in binoculars.
See SkyandTelescope.com/ataglance for details on each week’s celestial events.
For telescope owners, May is galaxy time. And the grandest galaxy field of all is Markarian’s Chain, at the heart of the Virgo Cluster.
worldmags & avaxhome
Sk yandTelescope.com May 2010 43
Facing North 1h Dou Clu ble ster
4h
PE
R
SE
US
+60°
D
B
G
CASSIOPEIA M52
E
D
c Fa
E Z
M
lla pe Ca
EUS CEPH
A
ME
DA
B K
A
Polaris
D
A
U
R
URSA MINOR +80°
X N
M82
M81
B
or t Cas
Pol
lux
A
A
Big Dipper B
G
URSA MAJOR
D
an
+60°
Mizar & Alcor
E
Z
H
M B
M51
ulu
s
A
kle G
ola
A
Z
neb De
L
SE
R D A
B
D
D
S
n Moo 24 y a M
D
US G
C
–20°
O
G
P
R
A
B
E
ER AT R C
M
CORV
P
4
IU
es
r ta
An
M
c Fa
A
A
P A
S
in
1 2 3 Star 4 magnitudes
44 May 2010 sky & telescope
H
Y
A
Spica
N
R
A
16h LU
A
H
A
Z
H
0
ard
C
U E Q
o 0 M ay 2 M
Alp h
E
IC n o
S
s
D
rn
I P
T
XT AN
turu
Arc
B
E
M5
M12
tu Sa
0°
M67
M
ar
s
D
G
LEO MI NO R
ES ÖT A BO
A
A
S EN ) RP UT SE AP (C D
B
S M10 HU UC HI OP
Virgo Galaxy Cluster
E
LE O
G
B
+20°
A
Reg
B
CORONA BOREALIS
M13
Z
D
COMA BERENICES
A
G
B
ub
A
B
O H
E
A
C
H
Th
C
M92 P
HERCU LES
M A
G
B
Sic
A
A
I
R
G
L
Y
Little Dipper
Ve ga
O
D
R E
A
B
G
SE
B
IG
A
CA
AR
E
Y LY RA
7
M5
IC4665
70
) UDA (CA
Moon May 27
LO P
G
+80°
in
A
A
LIS
C G N U
S
o
LA
ire
Al b
CU
G h S 19 S E R P E N
M3
B
IB
M44
M
De ne b
M 29 N o Cr rthe os rn s
VU LP E
SA A A
CANES VENATICI
A
G
L
g
G
A
19 h 39
g
N
E M2 7
ITT AQUIL
Facing East
B
Zenith
VIRG O
G
–1
A
Northern Hemisphere Sky Chart
PU
S
CE NT AU RU S
B
I
A
Q
–40°
13h
Facing South worldmags & avaxhome
N
IA TL
10h
N
W
Binocular Highlight:
WHEN
Diving Into Virgo 2 a.m. *
Early April
1 a.m.*
Late April
Midnight*
Early May
11 p.m.*
Late May
Dusk
*Daylight-saving time. HOW
X
E M Procyon
Facing West
G
7h
E
B
A
CANIS MINOR
CANCER
M Ma oon y1 7
I N
D
I
G
E
M
5 M3
M3
Ven u
s
M
36
Late March
7
M
38
c Fa
in
g
Q
Using the Map
Example: Hold up the map so the “Facing South” is at the bottom. About halfway from there to the map’s center is the bright star Spica. Go out, face south, and look halfway from horizontal to straight up. There’s Spica! Note: The map is plotted for 40° north latitude (for example, Denver, New York, Madrid). If you’re far south of there, stars in the southern part of the sky will be higher and stars in the north lower. Far north of 40° the reverse is true. The planets are positioned for mid-May.
M48
R
COMA BERENICES M85
g
SW
5
d
T O U A
Go outside within an hour or so of a time listed above. Hold the map out in front of you and turn it around so the yellow label for the direction you’re facing (such as west or southeast) is at the bottom, right-side up. The curved edge is the horizon, and the stars above it on the map now match the stars in front of you in the sky. The map’s center is the zenith, the point overhead.
The densest concentr ation of Messier objects lies at the intersection of Leo, Coma Berenices, and Virgo. Here we find vistas littered with small, faint galaxies. Truly, however, this is a case of quantity over quality, since all these Messiers are challenging binocular targets even under good skies. Yet it’s within this mass of galaxies that we’re able to glimpse the vastness of our universe, as we gaze directly into the heart of the Virgo Galaxy Cluster. It’s easy to be confused by galaxies in this region, so we must work methodically and carefully. Let’s begin part one of our exploration by jumping east from Denebola, Beta (β) Leonis. About two binocular fields away, you’ll find a grouping of 6th- and 7th-magnitude stars that I call the Little Pleiades. This asterism is key to locating M99 and M100, both of which I’m able to see in 10×50s. The nearby galaxy M98 is tougher though, requiring the extra power of my 15×45 image-stabilized binos. Things get easier (but not easy) when we skip north a short distance to M85, the most prominent of all the galaxies in the region. South of M85 lie M84, M86, and M87, the last being the most conspicuous. The difficult pair of M90 and tiny M89 is just to the east of this trio. I can see all six in 10×50s. Moving a little farther north brings us to the final galaxies in this month’s Messier haul: M88 and M91. M88 is visible in 10×50s, but even my 15× 70s have so far failed to show M91. It may be possible to see this galaxy under better skies though — can you ferret it out? ✦ — Gary Seronik
ci Fa
n
You can make a sky chart customized for your location at any time at SkyandTelescope .com/skychart. Galaxy Double star Variable star
°b
in o
cular view
LEO
M100 M98
M91 M88 M90 M89
L ittle Ple iade s
B
M99
M86 M87
M84
M58
Open cluster Diffuse nebula Globular cluster
VIRGO
Planetary nebula
Sk yandTelescope.com May 2010 45
worldmags & avaxhome
Planetary Almanac
Sun and Planets, May 2010
Mercury
May
11
May 1
21
Sun
31
Right Ascension
Declination
Elongation
Magnitude
Diameter
Illumination
h
m
+14° 56′
––
–26.8
31′ 45″
––
1.007
h
m
+21° 51′
––
–26.8
31′ 33″
––
1.014
1
h
2 16.8
m
+14° 02′
4° Mo
––
12.0″
1%
0.562
11
2h 04.6m
+10° 14′
18° Mo
+2.3
11.0″
12%
0.611
21
2h 17.8m
1
2 31.9
31
4 30.5
Distance
Venus Mercury
1
31
16
+10° 07′
24° Mo
+0.8
9.1″
30%
0.737
h
m
+13° 15′
24° Mo
+0.1
7.4″
48%
0.906
1
h
4 19.6
m
+22° 15′
27° Ev
–3.9
11.4″
89%
1.462
11
5h 11.6m
+24° 12′
29° Ev
–3.9
11.8″
87%
1.410
21
6h 04.4m
31
Mars
Venus
1
16
2 54.2
31
Jupiter
+25° 01′
31° Ev
–3.9
12.3″
84%
1.354
h
m
+24° 39′
34° Ev
–3.9
12.9″
81%
1.292
1
h
9 01.7
m
+19° 04′
92° Ev
+0.7
7.3″
90%
1.287
16
9h 27.4m
+16° 48′
84° Ev
+0.9
6.6″
90%
1.421
31
9h 55.5m
31 Mars
Jupiter
16
Saturn
Saturn Uranus
6 56.9
+14° 09′
77° Ev
+1.1
6.0″
90%
1.550
h
m
–3° 29′
47° Mo
–2.1
35.1″
99%
5.614
31
h
23 58.0
m
–1° 28′
70° Mo
–2.3
37.8″
99%
5.221
1
11h 58.2m
+2° 57′
138° Ev
+0.8
19.0″
100%
8.739
31
11h 55.4m
1
23 38.3
16
+3° 09′
108° Ev
+1.0
18.2″
100%
9.152
h
m
–0° 54′
55° Mo
+5.9
3.4″
100%
20.651
h
m
23 59.1
Neptune
16
22 03.2
–12° 25′
86° Mo
+7.9
2.3″
100%
30.067
Pluto
16
18h 20.5m
–18° 12′
140° Mo
+14.0
0.1″
100%
31.055
16 The table above gives each object’s right ascension and declination (equinox 2000.0) at 0 h Universal Time on selected dates, and its elongation from the Sun in the morning (Mo) or evening (Ev) sky. Next are the visual magnitude and equatorial diameter. (Saturn’s ring extent is 2.27 times its equatorial diameter.) Last are the percentage of a planet’s disk illuminated by the Sun and the distance from Earth in astronomical units. (Based on the mean Earth–Sun distance, 1 a.u. is 149,597,871 kilometers, or 92,955,807 international miles.) For other dates, see SkyandTelescope.com/almanac.
Uranus Neptune Pluto
0h
2h
+40°
Planet disks at left have south up, to match the view in many telescopes. Blue ticks indicate the pole currently tilted toward Earth.
10"
22h
16 h
18h
20 h
14 h 12h RIGHT ASCENSION BOÖTES
Vega
+30°
CYGNUS
ARIES PISCES
PEGASUS
GEMINI
Mars
+10°
Mercury 0°
9 Uranus
–10° –20° –30° –40°
DECLINATION
ERIDANUS
CETUS
OPHIUCHUS
CANCER
20
17
AURIGA
6
E
Fomalhaut
6 am
LIBRA
Pluto
SAGITTARIUS 4 am
TIC CLIP
Pleiades
TA U R U S +10°
Betelgeuse Procyon
0°
ORION Spica
CORVUS
23
Rigel
Sirius
H Y D R A
LOCAL TIME OF TRANSIT 10 pm 8 pm 6 pm
4 pm
–10° –20°
CANIS MAJOR
May 27–28 SC O RPIU S 2 am Midnight
4h +30°
Venus
AQU ILA
3
8 am
Saturn
Regulus
E Q U AT O R
Jupiter Neptune CAPRICORNU S
10 am
VIRGO
AQU ARIU S
6h
8h Castor Pollux
LEO
Arcturus
HERCULES
10 h
–30°
2 pm
–40°
The Sun and planets are positioned for mid-May; the colored arrows show the motion of each during the month. The Moon is plotted for evening dates in the Americas when it’s waxing (right side illuminated) or full, and for morning dates when it’s waning (left side). “Local time of transit” tells when (in Local Mean Time) objects cross the meridian — that is, when they appear due south and at their highest — at mid-month. Transits occur an hour later on the 1st, and an hour earlier at month’s end.
46 May 2010 sky & telescope
worldmags & avaxhome
67$1'$5' ZLWKHYHU\FDPHUD
Enjoy Our Magazine?
Adjustable Height Telescope Piers
Lowered
Raised
Check our online store for…
Books
Atlases Maps )DVW'RZQORDGV $OO )/, FDPHUDV IHDWXUH IDVW GRZQORDG VSHHGV XSWR0+] ZLWKIXOOELWUHVROXWLRQ$YLGHR PRGHLVDYDLODEOHZLWKLQWHUOLQHVHQVRUVPDNLQJ IRFXVLQJDQGFHQWHULQJDEUHH]H
Globes
…and more!
Pier-Tech 3
Pier-Tech 2
• Lifts telescope automatically • Guaranteed to keep level and polaraligned at every height • 100% corrosion resistant • Push button 20" vertical travel • Perfect ½t for any observatory • Most versatile pier available • Rechargeable battery option also available US patent number 7048238., International patents pending. Images shown with optional equipment. International shipping available.
/RZ5HDG1RLVH
Call for pricing or visit our website…
)DVW GRZQORDGV DQG ORZ UHDGQRLVH"
.Pier-Tech.com www
PIER-TECH, Inc.
&RROLQJ (YHU\)/,FDPHUDUHDFKHVWDUJHWRSHUDWLQJWHP SHUDWXUHVZLWKRXWOHQJWK\ZDLWWLPHVRUWKHUPDO UXQDZD\ 2XU EXOOHWSURRI WKHUPDO GHVLJQ FRROV GHHSO\DQGSURPSWO\ZLWKRXWWKHDGGLWLRQRIFRVW O\XSJUDGHV
Visit www.ShopatSky.com
1261C Humbracht Circle, Bartlett, IL 60103 Call: 630.841.6848 | Email:
[email protected]
)UDPH4XDOLW\ (YHU\ )/, FDPHUD LV ¿QH WXQHG WR DFKLHYH WKH ORZHVW UHDGQRLVH ZLGHVW G\QDPLF UDQJH DQG PRVWDFFXUDWHOLQHDULW\)/,DOVRVXSSRUWVRYHU VFDQV IRU TXDQWLWDWLYH DQG GLDJQRVWLF PHDVXUH PHQWVRIRXUFDPHUDV
0LNH6LGRQLR3UR/LQH3/ &):
-30
-PUNLY3HRLZ0UZ[Y\TLU[H[PVU
4XDOLW\&RROHG&DPHUDV ZZZÀLFDPHUDFRP
Sk yandTelescope.com
worldmags & avaxhome
May 2010 47
Fred Schaaf Sun, Moon, and Planets
Encounters with Venus The brightest planet traverses a starry panorama in May. At dusk this May, Venus shines in the west-northwest, Mars is high in the southwest, and Saturn is high in the south. Jupiter doesn’t rise until an hour or less before the first light of dawn. Late in the month, Mercury is visible through binoculars very low in the eastnortheast before sunrise.
EVENING Venus hangs at practically the same height moderately low in the west-northwest during twilight all May. It shines at a dazzling magnitude –3.9 but isn’t especially interesting through a telescope. It’s small and gibbous, just 12″ wide and 85% illuminated at mid-month. What’s more fascinating is the planet’s trek past stars and star clusters. On May 1st Venus blazes about ¼° from Kappa Tauri (you may need binoculars to glimpse the star so near to the planet’s mighty
glow). On May 14th Venus shines directly between the two stars that mark the ends of Taurus the Bull’s horns. Optical aid will be required to see the big Messier 35 star cluster less than 1° southwest of Venus on May 21st. On May 27th and 28th, Venus is less than ¾° from Epsilon (ε) Geminorum, also known as Mebsuta. The closest approach (17′ around 12h UT on May 28th) is visible from eastern Asia. Mars reaches eastern quadrature (90° east of the Sun) on May 4th, glowing in the south around sunset. Quadrature is when we see the largest phase effect — a shadowed edge — on an outer planet’s disk. But Mars’s 90%-illuminated disk is only 7.1″ wide then, so it may not be easy to make out that Mars is out of round. The summer solstice in Mars’s northern hemisphere occurs on May 12th, so the north polar ice cap will presumably be too small to see in most amateur telescopes.
Dusk, May 14–16
To see what the sky looks like at any given time and date, go to SkyandTelescope.com/skychart.
Naked-eye observers can have more fun with Mars, which is moving eastward through the “fi xed stars” at almost ½° per day. On May 1st the planet shines at magnitude +0.7, distinctly brighter than Pollux 20° to its west or Regulus 17° to its east. But by May 31st Mars dims to +1.1 and moves to within 4° of +1.4-magnitude Regulus. Saturn is the fourth in a long string of five 1st-magnitude objects stretching eastward along the ecliptic, from Pollux to Mars to Regulus to Saturn to Spica. Steady-shining Saturn glows about midway between twinkling Regulus and Spica. The planet barely moves with respect to the stars in May, since it’s near-
May 27 and 28
45 minutes after sunset
Around 11 pm
Capella
Moon May 16
Venus
` Tauri
Moon May 27
Antares
Moon May 15 Moon May 28
Betelgeuse
SCORPIUS Aldebaran
Looking West-Northwest
Moon May 14
Looking Southeast
48 May 2010 sky & telescope
worldmags & avaxhome
These scenes are drawn for near the middle of North America (latitude 40° north, longitude 90° west); European observers should move each Moon symbol a quarter of the way toward the one for the previous date. In the Far East, move the Moon halfway. For clarity, the Moon is shown three times its actual apparent size. The visibility of objects in bright twilight is exaggerated. The 10° scale is about the width of your fist at arm’s length.
December solstice
Venus Mars
March equinox
Sept. equinox
Sun Mercury Earth
ing the end of its retrograde (westward) motion in the head of Virgo. On May 31st Saturn halts and begins direct (eastward) motion through the stars. Saturn dims this month to magnitude +1.0, equal to Spica and nearly as faint as the planet can ever be. This is due largely to the narrowing of its rings, which reach a minimum tilt of just 1.7° from edgewise to Earth in late May. This is the last opportunity for a decade and a half to see the rings as such thin spikes, with dim moons shuttling along them as the satellites pass from one side of Saturn to the other. Planets usually appear sharpest in a telescope when they’re highest in the sky. In early May, Saturn is highest about 2½ hours after sunset, but by month’s end it’s highest at sunset and best viewed as soon as the sky is dark.
Dawn, May 9 –11 1 hour before sunrise
Great Square of PEGASUS
Moon May 9 Moon May 10 Jupiter
Moon May 11
Looking East
June solstice
Saturn
Uranus Jupiter
FPO
Neptune Pluto
ORBIT S OF THE PL ANE T S The curved arrows show each planet’s movement during May. The outer planets don’t change position enough in a month to notice at this scale.
PRE DAWN AND DAWN Jupiter, in Pisces, rises around the time Saturn sets (for viewers at mid-northern latitudes). In early May that’s around the start of morning twilight, but by month’s end it’s about 2 or 3 a.m. (daylight-saving time). The giant planet brightens slightly during May, from magnitude –2.1 to –2.3, and its disk grows from 35″ to 38″ wide. By month’s end, Jupiter pulls within 1° of 5.9-magnitude Uranus. Jupiter had three close conjunctions with Neptune last year, and it will have three with Uranus during this apparition. The first will occur on June 8th. Neptune, near the Capricornus-Aquarius border, is fairly low in the southeast before dawn’s first light. Finder charts for the two outermost major planets can be downloaded at SkyandTelescope.com/ uranusneptune. Pluto enters M24, the Small Sagittarius Star Cloud, this month. The 14thmagnitude world is highest in the south The waning crescent Moon makes a pretty pair with Jupiter in the predawn sky on May 9th and 10th. And look for the 8%-illuminated Moon well to Jupiter’s lower left on May 11th.
around 3 a.m.. See SkyandTelescope.com/ pluto for more information. Mercury has a poor apparition very low in bright dawn in late May and early June. It was at inferior conjunction on April 28th, and it glides out to a greatest elongation of 25° from the Sun on May 26th. But Mercury then shines only at magnitude +0.4, about as dim as it can ever appear at maximum elongation, because its 8.2″-wide disk is only 39% lit. Even worse, the ecliptic lies at a very shallow angle to the dawn horizon in spring. This means that Mercury is less than 5° high a half hour before sunrise on the 26th for observers at mid-northern latitudes. Mercury may be visible to the unaided eye when it brightens in early June, but you will probably need binoculars to see it in late May.
MOON PA SSAGES The Moon waxes to first quarter while passing Venus, Pollux, Mars, and Regulus from May 15th to 20th — but it gives all of them a wide berth. On the American night of May 27–28, the full Moon rises less than 2° above Antares and passes only 1° north of the star later in the night. ✦ Sk yandTelescope.com May 2010 49
worldmags & avaxhome
Hands on mptics
Join the IDA
• ANTARES • ASTROTELESCOPES • CELESTRON • CORONADO • EXPLORE SCIENTIFIC • FARPOINT LABS • LUNT
Giveaway
26437 Ridge Road, Damascus, Maryland 20872 • MEADE • PENTAX • STELLARVUE • TAKAHASHI • VIXEN And more!
See us at:
Suffern, NY / April 17-18
We love to create happy customers! Call us, or visit our retail store (in-person or online).
Photo b by D Dave Wymer
NORTHEAST ASTRONOMY FORUM
50
Visit www.darksky.org to see how you can win a set of Tele Vue Ethos Eyepieces
The eyepieces that let you see the universe
Presented at the IDA Annual General Meeting/ Astronomical League Convention 25–27 June 2010
NEAF
866-726-7371
Help us preserve the night sky
See us at NEAF booth #532
HandsonOptics.com
May 2010 sky & telescope
worldmags & avaxhome
International Dark-Sky Association
Charles A. Wood Exploring the Moon
Lunar Missions & Amateurs New lunar data reveals the Moon as never seen before. The most recent five lunar missions have returned more data about the Moon than collected by all previous spacecraft. This continuing onslaught of information is providing many new insights about our nearest neighbor. But unlike the Apollo era, when spacecraft data were available only to scientists, professionals aren’t the only ones who can explore the new information. Today, the internet brings gigabytes of data to everyone. Five spacecraft have orbited the Moon in the past seven years. The first was SMART-1, launched by the European Space Agency in 2003 to test new technologies. Sadly, only a tiny fraction of its images have been publicly released. Similarly, only a few of the thousands of images from the Chinese mission Chang’e 1 and the Indian orbiter Chandrayaan-1 have been distributed. But some data from JAXA’s Kaguya mission (February issue, page 20) and NASA’s Lunar Reconnaissance Orbiter (LRO) are now available, and ultimately all of it will be. One of the most useful datasets currently available is a digital terrain model (DTM) of lunar topography from Kaguya’s laser altimeter. Based on 6 million elevation measurements, the DTM is a computer fi le that you can manipulate with software such as the Lunar Terminator Visualization Tool (http://ltvt.wikispaces.com/ltvt), created by amateur astronomer Jim Mosher to display lifelike views of the lunar surface. You can use this program to display how the Moon will look for future (or past) observing sessions. The DTM is the fi rst accurate topographical map of the lunar surface ever produced. In addition to recreating views of the Moon as we commonly see it, you can also re-project the DTM to see the Moon as we never can, such as with illumination from
the north or the south poles. Doing this allowed Maurice Collins in New Zealand to discover a ridge that appears to radiate from the Imbrium impact basin that had never been noticed before. This ridge extends from the crater Eudoxus, past Plana and Mason near Lacus Mortis, and continues to the remnant crater Williams. This ridge is probably related to the formation of Imbrium, but for now, we aren’t quite sure how. Examining the lunar farside using the DTM also reveals an older, unknown basin partially covered by the Moscoviense basin. There are probably many more surprises awaiting detection in the Kaguya DTM.
Lacus Mortis R I D G E Eudoxus
Mason Williams
Plana
Eudoxus R I D G E
Mason Williams
Plana
Top right: Using Jim Mosher’s Lunar Terminator Visualization Tool (LTVT), New Zealand amateur Maurice Collins discovered a ridge radiating away from the Imbrium impact basin. These two simulations produced by Collins using LTVT show lunar topography as it would appear if the Sun were illuminating it from the north (top) and the south (bottom). Bottom right: An interactive Java applet on JAXA’s Kaguya website (http://wms.selene.jaxa.jp/3dmoon_e/index_e.html) allows you to explore images and data recorded by the orbiter, including the Digital Terrain Map (DTM) shown above.
Sk yandTelescope.com May 2010 51
worldmags & avaxhome
Exploring the Moon
You can also examine the DTM by using an interactive program available on the Kaguya website: http://wms. selene.jaxa.jp/3dmoon_e/index_e.html. Launch the Java applet Kaguya 3D GIS and the program displays a color-coded topographic map that you can rotate to examine any part of the Moon, including the far side never seen from Earth. Selecting the bottom option in the control panel provides a yellow line that crosses the Moon, and below that a light-hued profi le of the terrain under the line. A graphic example, centered on the Orientale impact basin (shown on page 51), shows an elevation profile from the farside highlands to Oceanus Procellarum. You immediately notice that the highlands are 8 to 9 kilometers (5 to 6 miles) higher than the mare. The Orientale basin formed on the slope between the two types of terrain, making its western rim
4 or 5 km higher than the more familiar Cordillera Mountains on the eastern rim. Look closely to see the local elevation peaks of the inner rings, too. It should be noted that due to Kaguya’s polar orbit, the DTM is less accurate at the lunar equator than near the poles. Spend five minutes with the Kaguya 3D GIS comparing the surface color map with the elevation profi le, and you’ll begin to understand relationships of lunar topography that have been previously unknown in such detail. Observers shouldn’t abandon their telescopes in favor of these simulations, but they will help us to become more knowledgeable interpreters of the lunar surface before stepping out to the eyepiece. ✦ To get a daily lunar fix, visit contributing editor Charles Wood’s Lunar Photo of the Day website at lpod.wikispaces.com.
The Moon • May 2010 Highlighted feature (shown on page 51)
Diameter
Description
Notes
Eudoxus
41 miles
Crater
Terraced walls, no central peak
Plana
27 miles
Crater
Nearly featureless floor
Mason
26 miles
Crater
Heavily eroded, irregular shape
Lacus Mortis
91 miles
Flooded plain
Crater Bürg located inside
Williams
22 miles
Remnant crater
Only low curving ridge remains 23
Phases Last quarter
May 6, 4:15 UT
New Moon
May 14, 1:04 UT
First quarter
May 20, 23:43 UT
Full Moon
May 27, 23:07 UT
28
Distances Apogee 251,180 miles
May 6, 22h UT diam. 29′ 15″
Perigee 229,741 miles
May 20, 9h UT diam. 32′ 5″
Librations May 8
Arrhenius (crater)
May 11
Petermann (crater)
May 23
Beals (crater)
May 28
May 8 For key dates, yellow dots indicate what part of the Moon’s limb is tipped the most toward Earth by libration under favorable illumination.
52 May 2010 sky & telescope
worldmags & avaxhome
S&T: DENNIS DI CICCO
11
Drygalski (crater)
astronomics.com TM
Anyone can sell you a telescope. We’ll sell you the right telescope.
TM
(800) 422-7876
At astronomics, our friendly people have over 150 years of experience using and selling telescopes. We’ll use all of that experience to help you pick the scope and accessories that best fit your needs (and your budget).
astronomics. For 30 years, honest advice from experts, the time to make sure you get the right telescope, and good prices you can afford. Call us toll-free at (800) 422-7876 and see for yourself.
Celestron is celebrating their 50th anniversary. We’ve been a member of the Celestron family for 31 of those years.
Easy just got bigger with Meade’s Hot Product ETX-LS.
Meade ETX-LS6
Celestron started making telescopes in 1960. In 1970, they introduced the C-8, the first affordable mass-produced Schmidt-Cassegrain. The 8” C-8 started a revolution in big aperture backyard astronomy that continues to this day with the introduction of state-of-the-art EdgeHD optics. Astronomics became a Celestron dealer in 1979, partnering with Celestron to bring you innovative high performance astronomical equipment at down-to-earth prices. And our partnership with Celestron is still going strong to this day, 31 years later.
Meade ETX-LS8
The 6” Meade ETX-LS6 has Hot Product for 2010 LightSwitch Technology that uses a GPS receiver and CCD imager for totally hands-free and eyesclosed sky alignment. It makes setting up to observe each night e-a-s-y! Just turn it on and walk away. The ETX-LS lines up on the sky all by itself!
Now the 6” ETX-LS6 has an 8” big brother. Each 6” or 8” ETX-LS scope is available with your choice of either faSCT, mous Schmidt-Cassegrain (SCT) optics or new Ad$1799 vanced Coma-Free (ACF) optics that give you the same coma-free views and images as a RitcheyChrétien telescope, but at only a fraction of an R-C’s price.
SCT, $1399 ACF, $1499
Celestron CGEM 800 HD 8” f/10 SCT with EdgeHD optics
To get the most out of the night sky, you need more than a dinky toy telescope. You need serious Celestron optics for observing and imaging, like a Celestron SCT or Hot Product for 2010 EdgeHD optical tube on a Hot Product for 2010 Celestron CGEM high precision go-to German equatorial mount.
$2399
Celestron CGEM EdgeHD scopes use Celestron’s unique new comafree flat-field EdgeHD optics that have been optimized to take DSLR and CCD imaging to a whole new level of perfection. Hot Product Edge HD optics + a Hot Product CGEM mount = a double Hot Product! CGEM 800, 8” Schmidt-Cassegrain optics, CGEM mount ............... $2099 CGEM 925, 9¼” Schmidt-Cassegrain optics, CGEM mount .............. 2699 CGEM 1100, 11” Schmidt-Cassegrain optics, CGEM mount ............ 2999 CGEM 800 HD, 8” EdgeHD optics, CGEM mount .............................. 2399 CGEM 925 HD, 9¼” EdgeHD optics, CGEM mount ........................... 3099 CGEM 1100 HD, 11” EdgeHD optics, CGEM mount .......................... 3499
Get equipment discounts at astronomics by joining Cloudy Nights for free at www.cloudynights.com/register. With almost 39,000 members, Cloudy Nights is the world’s largest, friendliest, and most informative astronomy gathering place. And it’s free!
Is an Astro-Tech Ritchey-Chrétien in your imaging future? Ritchey-Chrétien reflectors, using the same type of optics as the Hubble Space Telescope, are widely regarded as the best scopes for astrophotography. But R-Cs cost a fortune. Or at least, they used to. The $795 Hot Product for 2009 6” f/9 Astro-Tech AT6RC, first conceived and introduced by Astro-Tech, Astro-Tech was the first astrograph designed for DSI and DSLR AT8RC imaging (“a superb match” according to a review). The economical AT6RC is the first R-C you don’t have to be super rich to afford.
Links to all products in this ad are at www.astronomics.com/sky0510.
This SBIG CCD is a great match for an Astro-Tech R-C. Take your choice. For $1995, the 8.9 megapixel SBIG ST8300 CCD camera is available in either a one-shot color format or in a monochrome version for tri-color imaging with an optional color filter wheel. Either way, the high resolution ST8300 is priced hundreds of dollars less than the competition and is a superb match to the coma-free images of an Astro-Tech 6” to 12” R-C.
Treat your eyes to Takahashi. Some of the finest ultra-premium refractors are from Takahashi, like the $4195 four-element dual ED Takahashi FSQ-106ED shown left on an optional mount. If your eyes deserve the very best, and you don’t want to be on a 9year waiting list, think Takahashi.
The $1395 Hot Product for 2010 8” f/8 Astro-Tech AT8RC has premium features competitors don’t offer, like quartz mirrors; a carbon fiber body; 99% reflectivity dielectric mirror coatings; and dual dovetails. The AT8RC, co-developed by Astro-Tech, was the first sensibly-priced 8” RitcheyChrétien introduced in the U. S. and it’s still the best. The $2695 Astro-Tech AT10RC, a Hot Product for 2010, is the first affordable 10” f/8 R-C ever. Quartz mirrors, dielectric mirror coatings, and a price that’s nearly $4000 less than the formerly least-expensive 10” R-C. Want even more precision? The 10” AT10RCF at $3895 comes with a carbon fiber tube and a Feather Touch focuser upgrade. The new 12” Astro-Tech AT12RC costs $4495. A competitive 12.5” R-C costs over $21,000. If you can see a $16,000 difference with that extra half inch of aperture, by all means spend the money. But we don’t think you’ll see a difference, so what will you do with your $16,000 savings?
astronomics
680 24th Avenue SW, Norman, OK 73069
ACF,
$1999
A CCD camera under the optical tube takes and saves wide field deep space images on an optional SD card. Astronomer-Inside software and a built-in speaker take you on guided sky tours. An optional $99 video monitor lets you view a built-in star chart or more than 75 special multi-media presentations.
Celestron CGEM SCT scopes use the Schmidt-Cassegrain optics that Celestron introduced in 1970 and has spent decades perfecting. A 40,000+ object NexStar go-to computer control and state-of-the-art Starbright XLT multicoatings make that perfection even better.
Mastercard, Visa, Discover, American Express.
Our third astronomics generation.
TM
Our 31st year of friendly service, reliable advice, and money-saving prices.
PHONE/LIVE CHAT HOURS: 9 - 8 CST Mon - Fri, Sat 12 to 5.
E-mail:
[email protected]
STORE HOURS: 9 - 5 Mon - Fri, Sat by appointment.
Prices, special offers, and specifications current as of 2/1/10, but subject to change.
worldmags & avaxhome
Cosmic Trails December 13th–23rd, 2010
W W W . I N S I G H T C R U I S E S . C O M / S K Y
Speakers Andrew Chaikin Susan French Walter Pacholka Gary Seronik David Stevenson, Ph.D.
Southern Caribbean & The Panama Canal
FT. LAUDERDALE
Half Moon Cay
Curaçao Aruba Cristobal, Panama PAN AMA C AN AL
During Our Trip: Geminid Meteor Shower and TOTAL LUNAR ECLIPSE
Cruise prices start at $999, per person, for an Inside Stateroom. For those attending our seminars, there is a $1,275 fee. Taxes are $244.23 per person. Port Charges and an InSight Cruises service fee are $245. For more info contact Neil at 650-787-5665 or
[email protected] CST# 2065380-40
Puerto Limón (San José)
©Walter Pacholka
During Our Trip: TOTAL LUNAR ECLIPSE Tuesday, December 21, 2010
For a full listing visit www.InSightCruises.com/Sky-talks
worldmags & avaxhome
S & T Test Report
Paul Deans
Lunar Discoverer Mac and PC users alike can use this program to aid their telescopic explorations of the Moon Lunar Discoverer US price: $59.95 for the Deluxe Edition (the Standard Edition, with smaller databases and fewer program features, costs $44.95) AstroHawk Corp. P.O. Box 646 Chiefland, FL 32644 astrohawk.com
“Hello, i’m a Mac.” “And i’m a PC.” Most readers probably recognize these opening lines from a long-running series of television ads for Apple computers. Well, I’m a Mac and happily so — most of the time. The rare occasions I have PC envy occur when I see the vast array of Windows-based software versus the minuscule number of titles in the Apple line. In particular, there’s a dearth of Mac-based astronomy software. So imagine my delight when I found AstroHawk’s Lunar Discoverer. The Deluxe Edition contains an extensive database of lunar features (including physical details and images), several types of lunar maps, an audio-format pronunciation guide, and numerous options for customizing the program for your observing sessions. Best of all, the software lets WHAT WE LIKE: you create a custom, interactive map Runs on a Mac of the Moon for any date and time as well as a PC between 1904 and 2040 — on a Mac! Easy to customize (I hasten to add that it works identiWHAT WE DON’T LIKE: cally on a PC.) Another nice feature is that you can generate views that Handles time poorly match the field and orientation of the Doesn’t include the Moon as it appears in your telescope. effects of libration I was particularly interested
in seeing how accurately Lunar Discoverer’s map and its display of the terminator marking the division between lunar day and night compared with the real thing in the sky. There are two basic ways to use Lunar Discoverer’s Moon map. One is to show the Moon as it looks in real time, which is useful for identifying lunar surface features that appear in your telescope’s eyepiece. The other is to plan future observing sessions so you can catch features of interest when they’re optimally placed for observation near the terminator. I used the Deluxe Edition, which has more options and a larger database of named lunar features (4,600+ vs. 1,300+) than the Standard Edition. Both come with a detailed PDF manual that covers the program’s operation on both computer platforms. I tried the program on numerous nights covering most of the lunar phases, and the software performed admirably when it came to identifying features seen through my telescope. Click on a crater and its name pops up. Double-clicking brings up more information, including physical details, information about who it’s named after, a page reference to Antonín Rükl’s Atlas of the Moon, and a close-up photo (if available). Using the lunar map to plot future observing sessions Sk yandTelescope.com May 2010 55
worldmags & avaxhome
S&T Test Report
Lunar Discoverer can generate charts based on several views of the Moon, including actual photographs (top) and a “synthetic” surface that emphasizes relief features (bottom).
also worked well, but with a caveat. The software didn’t do a good job of handling the effects of libration. This subtle “rocking” motion of the Moon varies the lunar face presented to observers and is especially critical when viewing features near the Moon’s limb. Since the charts don’t show libration effects, I had no expectation that the program would tell me the best dates to peek over the Moon’s edge — and it doesn’t. But I was disappointed to find that the libration issue also affects the displayed location of the terminator, when it is more than 45° away from the midpoint of the
lunar disk. At times it was off by as much as two or three hours from its actual appearance. For observers, this usually isn’t a big deal when the Moon is waxing, since any feature in darkness will soon experience sunrise. But it can be a problem when observing features in a waning phase if sunset has already occurred for a feature that the program indicates is still on the sunlit side of the terminator. One of the program’s nice touches is the thin, light-gray band separating the terminator (indicated as a red line) and the black of the lunar night. The band indicates a region where mountain peaks and crater rims may catch rays of sunlight, even though the surrounding moonscape lies in darkness. But beyond the libration problem, the software contains several vexing issues. In particular, time is not handled well. Local time (as read from your computer’s internal clock) is mostly used, though you have to manually adjust the program to account for daylight time. But Universal Time crops up here and there and is incorrectly formatted as a 12-hour clock. Even worse, when I entered a date/time in the Preferences window, the resulting chart would sometimes show the lunar phase for exactly 24 hours later. I confirmed by direct observation that the chart is correct for the date and time shown, but is for one day later than I requested. The problem is related to how the software handles local time and UT. It seems to add the user-defined GMT offset (in my case, 7 hours for Mountain Time) to the requested local time entered in Preferences. If that
causes the time to advance past midnight, a chart is created for the correct time but for the following day. With my 7-hour offset, this “day-advance” happens at 5 p.m., so if I want a chart for a date and time in the future, I have to double check the chart’s date if my requested time is 5 p.m. or later. It’s an odd problem, but I’m surprised it hasn’t been noticed and corrected. Other problems lurk. For example, the lunar eclipse listing is peppered with incorrect details about the eclipse type; totality times are sometimes given for eclipses that aren’t total; the standard/daylight time issues mentioned above also crop up here; and there’s no indication of where on Earth a particular eclipse is visible. Click on a New Moon in the Calendar window and numerous, supposedly visible features around the lunar limb are listed and shown on the chart. And you can’t cancel an accidental command to quit. I tested Version 1.25 of Lunar Discoverer and it seemed to be a work in progress. One feature I’d really like to see added is the ability to adjust the time in hourly increments without having to call up the Preferences menu. As this review was readied for publication, AstroHawk released an update (V1.31), which doesn’t correct the issues I’ve raised above (at least not in the Mac version). Despite its flaws, the program’s mapping functions are good enough that I’ll definitely make this program the one I use for lunar observing. ✦ Paul Deans is a freelance astronomy writer who has recently rediscovered the joy of chasing shadows along the lunar terminator.
The program has many customization options for displaying lunar features and their labels, though labels can sometimes become very crowded along the Moon’s limb. The calculated terminator dividing lunar day and night shows as a red line, while a gray band indicates the region when crater rims and mountain peaks might be catching a few rays of sunlight. Compare the charts made using photographs (left and right) with the one showing a synthetic surface (center).
56 May 2010 sky & telescope
worldmags & avaxhome
worldmags & avaxhome
New Product Showcase
FOCUSER OF THE TITANS The new FLI Atlas Focuser (introductory price $1,995) from Finger Lakes Instrumentation is designed with heavy payloads in mind. Seven inches square and 1¼ inches deep, this large-format focuser uses linear bearings to provide exceptional rigidity while supporting up to 25 pounds of gear without flexing. Its 3¾-inch aperture ensures no vignetting of your telescope’s light path. The FLI Atlas Focuser comes with two FLI Zero Tilt adapters, and it is capable of precision focus in 100-nanometer increments. It’s ASCOM compliant and can be controlled by most auto-focus programs from your computer via a single USB-2 interface. Finger Lakes Instrumentation 7298 West Main St., Lima, NY 14485; www.flicamera.com ▾
FINGER
LAKE S IN
STRUM
ASTROPHOTO.COM
PROCCESSING BY A MASTER Learn some tricks from esteemed astrophotographer Tony Hallas as he shows you how to get the most out of your astrophotos with his new video lecture series E-Z CCD DVD ($68). In this three-volume set of video DVDs, Hallas walks you though his image-processing workflow in Adobe Photoshop. He introduces you to advanced tools and techniques he has pioneered in his three decades of astrophotography experience. Learn how to enhance your photos with layer masks, combine LRGB images to achieve proper color balance, and use advanced techniques such as noise reduction and controlling star bloat. Hallas also explains the fundamentals of image composition and visual psychology to help you become an advanced astro-imager. Astrophoto.com 4060 Morningstar Pl., Foresthill, CA 95631 530-367-5725 ▴
ON EN TATI
OBSERVING PLANNER Get the most out of your astronomy sessions with Knightware’s Deep Sky Planner 5 ($70 for full program, or $35 to upgrade from version 4). Whether your interest lies in planets, comets, asteroids, carbon stars, doubles, or variable stars, Deep-Sky Planner 5 helps you gain more from your visual and photographic observing time. This PC software program lets you see what will be visible each evening, and when it will be optimally placed in the sky for your location. Its database includes updated information for more than 1 million celestial objects, and works in conjunction with popular planetarium programs, including TheSky6, Starry Night, Redshift, and Cartes du Ciel. Deep Sky Planner 5 is compatible with Windows 7, Vista, and XP operating systems. Knightware 305 Evans Estates Dr., Cary, NC 27513; www.knightware.biz
KNIGHTWARE
▶
New Product Showcase is a reader service featuring innovative equipment and software of interest to amateur astronomers. The descriptions are based largely on information supplied by the manufacturers or distributors. Sky & Telescope assumes no responsibility for the accuracy of vendors’ statements. For further information contact the manufacturer or distributor. Announcements should be sent to
[email protected]. Not all announcements can be listed.
58 May 2010 sky & telescope
worldmags & avaxhome
worldmags & avaxhome
FOCUS ON
Sky & Tel said “Too Good To Be True” at $1995. What will they say at $1495?
The headline on the Sky & Tel cover said that the $1995 Astro -Tech AT106 AT106 4.2” $1995 ED triplet AT106LE refractor $1495 was “A Scope Too Good To Be True.” And the four-page review inside said the AT106 “provides all the benefits of a first-class 4-inch apo but without the premium price.”
And now, there’s a Limited Edition Astro-Tech AT106LE available with the same gorgeous f/6.5 FPL-53 triplet optics as the AT106 (with a 2” focuser instead of a 2.7”) for only $1495. An online comment called it “one of the best deals I have ever seen offered in over 2 decades of this hobby.” The production run of the AT106LE is strictly limited to 50 pieces at $1495. When they are gone, they are gone for good. Don’t miss out on this one.
The only color in these scopes is on the outside of the tube! The Astro -Tech AT72ED 2.8” f/6 ED doublet is a larger aperture AT72ED dual-speed 2” $379 focuser version of the AT66ED refractor, one of the most popular Astro-Tech scopes ever. The AT72ED was first available in black only. Then we started getting requests for the AT72ED body in color, the same way the AT66ED was once available. You spoke, we listened. The Astro-Tech AT72ED is now available in your choice of six tube colors: Celestron black, Meade blue, white, red, green, and pink for the young lady astronomer in your family. You can now have great 72mm Astro-Tech ED optics, free from spurious color, in a glorious living Technicolor™ tube! Enjoy!
ASTRO-TECH from Astronomy Technologies 680 24th Avenue SW, Norman, OK 73069 Astro-Tech is available in the U. S. from these dealers:
astronomics.com ● highpointscientific.com auroraastro.com ● optcorp.com ● camerabug.com sunrivernaturecenter.org ● greatredspot.com apmamerica.com ● tetontelescopes.com In Canada, from: escience.ca ● astronomieplus.com a-p-o.ca In Europe, from: altairastro.com scopemania.eu In Asia, from: kkohki.com Dealer inquiries welcome:
[email protected] Prices as of 2/1/10 but subject to change. All prices plus freight.
60
Stull Observatory – Alfred University Alfred, New York The ASH-DOMEs pictured house 8, 9, 14, 16, 20, and 32 inch instruments. The six telescopes located at this site are operated by the Division of Physical Sciences through the Astronomy program. Alfred University offers the student an intensive “hands-on” program. The public is invited during open houses.
ASH MANUFACTURING COMPANY P.O. Box 312, Plainfield, IL, USA 60544 815-436-9403 • FAX 815-436-1032 www.ashdome.com Email:
[email protected] Ash-Dome is recognized internationally by major astronomical groups, amateurs, universities, colleges, and secondary and primary schools for its performance, durability, and dependability. Manual or electrically operated units in sizes from 8 to 30 feet in diameter available. Brochures and specifications upon request.
Save Your Back Issues Preserve, protect and organize your Sky & Telescope back issues. Constructed with heavy bookbinder’s board and covered in a rich Àag blue leather grained material. Includes a gold label with the Sky & Telescope logo. Designed with a wide 3" opening for maximum storage. Great for gifts!
One – $15 Three – $40 Six – $80 Add $3.50 per slipcase for P&H. USA orders only.
Satisfaction Guaranteed
Send orders to:
TNC Enterprises Dept. SKT, P.O. Box 2475, Warminster, PA 18974 Enclose name, address, and payment (No P.O. boxes please) with your order. PA residents add 6% sales tax. You can also call (215) 674-8476 or fax (215) 674-5949 Credit Card Orders: Visa, Master Card, American Express accepted. Send name, card number, exp. date, and signature.
To Order Online: www.tncenterprises.net/skt 0SEFS.PO4BUt15 5PMM'SFF1 'XXX5FMFTDPQFT/&5 5348 Topanga Canyon Blvd. Woodland Hills, CA 91364
GALAXY OF SAVINGS SALE "13*-Ū.":
See us at: F AC 90- S P G
LX
Affordable 8MP camera! Only at – $1,995
F -AC 200 LX GPS
TAKAHASHI Order Takahashi's NEW TSA 120 Super Apochromatic refractor - $3,795
ch wit Ethos, Panoptics, Nagler, Plossl htS pe g i L Sco All Tele Vue's In Stock!
May 12th-16th
telescopes and eyepieces at NEW LOWER PRICES!
KENDRICK ASTRO INSTRUMENTS
Scope, Eyepieces
May 2010 sky & telescope
worldmags & avaxhome
60mm Ha Telescope with Doubles-Stacked External Etalon System and B600 with Pressure Tuner $2,242
Stocking Dealer for Lunt Pressure Tuned Packages
DEMO + USED CGEM 10+ $1,095 CPC800 10+ $1,495 CPC1100 10+ $2,350
NEW! 8"OTA $780 NEW! 11"OTA $1,650 NEW! 9.25"OTA $1,090
-30
Alan MacRobert Celestial Calendar
Saturn’s 8 Amateur Moons How many of them have you bagged? Now’s the time to push your limits. Saturn, glowing yellow in the head of Virgo, is at opposition on the night of March 21st and remains almost as close and big during April and May. Its rings are narrow and narrowing further; they’ll be a thin sliver tilted just 1.7° to our view from mid-May through early June, before widening again for many years to come. So this spring, we have one really good last chance to go satellite hunting close to Saturn. As many as eight of Saturn’s moons (out of the 62 known) are within reach of advanced amateurs. How many are on your life list? Now’s the time to push for perhaps one or two more. Easiest is big, bright Titan, magnitude 8.3 for much of the spring. It always hovers within four ring-lengths of the planet. A 60-millimeter refractor usually shows it. The next three counting inward are Rhea, Dione, and Tethys, magnitudes 9.7, 10.4, and 10.2. These are standard pickups in a 6-inch scope, though Tethys, close to Saturn’s glare, may require some careful looking.
Titan, Rhea, Dione, Enceladus, and Tethys (counting inward) were lined up on Saturn’s western side when Ed Sampson took this stacked-video image on March 18, 2009, using a 12inch Newtonian reflector. The image has been brightened a bit for clarity. The rings were tilted 3° from edge on at the time, with their south face still in view. South is up in all images.
Much tougher is Enceladus, magnitude 11.7 and buried deeper in Saturn’s glare. I’ve barely glimpsed it with my 6-inch, but it’s a fairly routine catch in my 12.5-inch. You can determine where each of these five satellites appears at any time in May, and which is which, by using the wavy-line diagram at far right. Its counterpart for April is in last month’s issue, page 47. From here on, things get trickier.
Iapetus Far Out . . . Missing from the diagram is Iapetus, though it’s often easy to spot in amateur scopes. That’s because Iapetus ranges much farther from Saturn and has an orbit that’s tipped out of the orbital plane of the first five moons. Iapetus is Saturn’s oddball in another way. Its leading side is darker than dark chocolate, and its trailing side is mostly covered with bright ice. So when Iapetus is farthest west of the planet, it shines at an easy magnitude 10.3, but when it’s farthest east, it’s a lot harder at 11.7. Once you’re used to finding Iapetus on one side, its brightness or dimness on the other side looks bizarre. The best way to locate Iapetus is by its distance east or west of the planet. Here are its offsets from Saturn, in seconds of right ascension, on selected dates (at 0h Universal Time, which is on the evening of the previous date in the Americas). Interpolate to find the value for when you plan to observe: April 2, 37s east; Apr. 8, 28s east; Apr. 12, 18s east; Apr. 16, 6 east; Apr. 18, directly south of Saturn by 4 Saturn diameters; Apr. 20, 6s west; Apr. 24, 18s west; Apr. 30, 31s west. May 2, 34s west; May 8, 36s west; May 14, 31s west; May 20, 18s west; May 24, 8s west; May 27, directly Saturn in 2010 north of Saturn by 3 Saturn Ring Mag. diameters; May 30, 8s east. Date Dia. s
tilt
(total)
April 1
19.5″
2.8°
+0.6
May 1
19.0″
1.9°
+0.8
June 1
18.1″
1.7°
+1.0
July 1
17.2″
2.2°
+1.1
Aug. 1
16.4″
3.3°
+1.1
To measure this distance, turn off your telescope’s drive and let the sky drift for the correct number of seconds. When Iapetus is east of Saturn, if follows the planet across your view. When it’s west
Sk yandTelescope.com May 2010 61
worldmags & avaxhome
Celestial Calendar
white spot
Rhea
of Saturn, it precedes Saturn. Iapetus is also a little south of Saturn for most of April, and a little north of it from the end of April through May.
Mimas Close In . . . Also omitted from the wavy-line diagram is tiny, challenging Mimas, closer in than even Enceladus. Most amateur scopes can’t show it. Mimas is 400 km in diameter compared to Enceladus’s 500, and it’s magnitude 12.9 compared to Enceladus’s 11.7. Worst of all, Mimas is deeper in Saturn’s overwhelming glare. I’ve never seen Mimas in my 12.5-inch, but my S&T colleague Tony Flanders has seen it in his own 12.5-inch reflector — once in 1998 and again in 2005 when the rings were wide open! Last year, Alan Whitman of British Columbia described seeing it in his 16-inch (S&T: August 2009, page 11). You’ll need to look less than an hour from when Mimas is at eastern or western elongation from the planet. Here are the dates (in boldface) and times (in decimals of an hour) when Mimas is at eastern (E) or western (W) elongation, in Universal Time: h
h
h
April 1, 8.5 W, 19.8 E; 2, 7.1 W, 18.4 E; 3, 5.7h W, 17.0h E; 4, 4.3h W, 15.6h E; 5, 3.0h W, 14.3h E; 6, 1.6h W, 12.9h E; 7, 0.2h W, 11.5h E, 22.8h W; 8, 10.1h E, 21.4h W; 9, 8.7h E, 20.0h W;
May Meteors The Eta Aquarid meteor shower should be active for a few mornings around May 6th, though last-quarter moonlight will interfere. This shower is often the year’s best for the Southern Hemisphere, with 40 to 80 meteors visible per hour before dawn under ideal conditions. Fewer are seen from northerly latitudes, and essentially none north of about latitude 45°.
Bright Rhea was transiting Saturn’s face, and a white spot in the Equatorial Zone was nearing the central meridian, when Damian Peach in England took this image on May 9, 2009, using a 14-inch Schmidt-Cassegrain scope. The ring tilt was 4°.
10, 7.3h E, 18.6h W; 11, 5.9h E, 17.2h W; 12, 4.6h E, 15.9h W; 13, 3.2h E, 14.5h W; 14, 1.8h E, 13.1h W; 15, 0.4h E, 11.7h W, 23.0h E; 16, 10.3h W, 21.6h E; 17, 9.9h W, 20.2h E; 18, 7.6h W, 18.9h E; 19, 6.2h W, 17.5h E; 20, 4.8h W, 16.1h E; 21, 3.4h W, 14.7h E; 22, 2.0h W, 13.3h E; 23, 0.6h W, 11.9h E, 23.2h W; 24, 10.6h E, 21.9h W; 25, 9.2h E, 20.5h W; 26, 7.8h E, 19.1h W; 27, 6.4h E, 17.7h W; 28, 5.0h E, 16.3h W; 29, 3.6h E, 14.9h W; 30, 2.2h E, 13.5h W. May 1, 0.9h E, 12.2h W, 23.5h E; 2, 10.8h W, h 22.1 E; 3, 9.4h W, 20.7h E; 4, 8.0h W, 19.3h E; 5, 6.6h W, 17.9h E; 6, 5.3h W, 16.6h E; 7, 3.9h W, 15.2h E; 8, 2.5h W, 13.8h E; 9, 1.1h W, 12.4h E, 23.7h W; 10, 11.0h E, 22.3h W; 11, 9.7h E, 21.0h W; 12, 8.3h E, 19.6h W; 13, 6.9h E, 18.2h W; 14, 5.5h E, 16.8h W; 15, 4.1h E, 15.4h W; 16, 2.7h E, 14.0h W; 17, 1.4h E, 12.7h W; 18, 0.0h E, 11.3h W, 22.6h E; 19, 9.9h W, 21.2h E; 20, 8.5h W, 19.8h E; 21, 7.4h W, 18.5h E; 22, 5.8h W, 17.1h E; 23, 4.4h W, 15.7h E; 24, 3.0h W, 14.3h E; 25, 1.6h W, 12.9h E; 26, 0.2h W, 11.5h E, 22.8h W; 27, 10.2h E, 21.5h W; 28, 8.8h E, 20.1h W; 29, 7.4h E, 18.7h W; 30, 6.0h E, 17.3h W; 31, 4.6h E, 16.9h W.
Mimas completes an orbit in just 22.6 hours, so you should see its motion during your observing session.
Saturn’s Moons May 16 0h UT
May 1 2
Very different is Saturn’s weird “sponge moon,” Hyperion, magnitude 14.2. It’s only a little beyond the orbit of Titan, where Saturn’s glare may still be a problem, and at that magnitude you’ll need to distinguish it from 14th-magnitude background stars. This requires very high power and top-quality charting software from a massive stellar database. But if you have a big scope and can print out such a chart for a time when Hyperion is near elongation, Alan Whitman reports that this prize catch is “much easier” than Mimas. ✦ — Alan MacRobert
62 May 2010 sky & telescope
worldmags & avaxhome
WEST
3 4 5
Enceladus
6 7 8 9
Tethys
10 11 12 13 14 15 16 17 18
Titan
19 20 21 22 23 24
. . . and Hyperion in the Dark
EAST
Rhea
25 26 27 28
Dione
29 30 31 The wavy lines represent five Saturnian satellites; the central vertical bands are Saturn and its rings. Each gray or black horizontal band is one day, from 0 h (upper edge of band) to 24h UT (GMT). The ellipses at top show the actual apparent orbits.
Everything for the Amateur Astronomer F I LT E R S
TE LE SC OPE S
StarBlast 6i IntelliScope Reflector
SkyScanner 100mm TableTop Reflector
#27126 $399.95
1.25" 13% Transmission Moon Filter
Nautilus Motorized Filter Wheels
#5662 $19.95
#5526 4x2" $449.95 #5527 7x1.25 $429.95
#9541 $99.95
SkyQuest XT8 Classic Dobsonian #8943 $329.95
2" Multiple 4-Filter Wheel
SkyQuest XX14i IntelliScope Truss Dobsonian
#9947 $229.95
EYEPIECES
20mm Illuminated Centering Eyepiece #8239 $99.95
SkyQuest XT10i 2" Extra-Narrowband Computerized Filter Set IntelliScope #25545
7.5-22.5mm Premium Zoom Eyepiece
#27184 $969.95 $699.95
#8238 $279.95
7mm MegaView Ultra-Wide Eyepiece
#7722 $135.95
#5525 199.95
ShortTube 80-A Refractor
#9791 $1,799.95
9.25" ID Full Aperture Solar Filter
1.25" Variable Polarizing Filter #5560 $37.95
ASTR O - I MAG I N G
6mm Expanse Eyepiece
StarShoot Planetary Imager and AutoGuider
EON 120mm ED Apochromatic Refractor
#8920 $59.95
#9925 $1,799.95
#52079 $349.95
#8853 $197.95
7-21mm Explorer II Zoom Eyepiece #8548 $67.95
1.25in. 3x HighLight 5-Element Barlow Lens #8745 $139.95
BINOCULARS
StarShoot Solitaire AutoGuider #52074 $499.95
8" f/8 Ritchey-Chretien Astrograph
SteadyStar Adaptive Optics Guider
#8958 $1,195.95
#53076 $1,799.95
Mini Giant 9x63 Binoculars #9463 $199.95
Resolux 10x50 WP Astronomy Binoculars #9544 $279.95
ACCESSORIES
2" Dielectric Mirror Star Diagonal #8727 $124.95
BT100 Premium Binocular Telescope
LaserMate Pro Laser Collimation Kit #5684 $99.95
EZ Finder II Reflex Sight
#9566 $1,099.95
#7228 $37.95
SeaOtter 10x25 WP Compact Binoculars
ShoreView 8x42 Waterproof Binoculars #9471 $79.95
Soft Case for StarBlast 6 and 6i #15100 $69.95
VersaGo II Altazimuth Mount #10105 $194.95
#8062 $124.95
worldmags & avaxhome
Beginning Stargazers Toolkit #20034 $33.95
)'(' Polynesian Island Eclipse Tour Tahiti, Moorea, and Easter Island July 9th–14th, 2010
J
oin Sky and Telescope magazine editors Robert Naeye, Dennis di Cicco, and contributing editor Kelly Beatty, in July 2010 for an eclipse tour full of mystery and fantasy. Watch 4½ minutes of totality on Easter Island, then relax in pure luxury at 5-star resorts inTahiti and Moorea. Enjoy only the finest accommodations aboard our specially chartered A340-300 Air Tahiti Nui aircraft with available business and first class upgrades with the expert service of the Polynesian staff. Sign up today! — $4995/person
64
May 2010 sky & telescope
1-866-668-0SKY www.SkyandTelescopeTours.com worldmags & avaxhome
Sue French Deep-Sky Wonders
The Gossamers of Coma Berenices The constellation north of Virgo is littered with galaxies.
ANNE ANDERSON
Garrett P. Serviss
cites this nursery rhyme in his book Astronomy with an Opera-Glass when describing the constellation Coma Berenices, Berenice’s Hair. He writes, “Nearly on a line between Denebola and Arcturus, and somewhat nearer to the former, you will perceive a curious twinkling, as if gossamers spangled with dew-drops were entangled there. One might think the old woman of the nursery rhyme who went to sweep the cobwebs out of the sky had skipped this corner, or else that its delicate beauty had preserved it even from her housewifely instincts.” Garrett’s gossamers comprise Melotte 111, the huge cluster of stars that diadem Berenice’s Hair. Gazing up at a clear dark sky, I can see several of its glittering gems entwined in her tresses, and dozens of stars spring forth through binoculars (S&T: May 2008, page 51). Through a telescope, we see more evidence that the old woman left this region of the sky unswept, for it’s rife with dust-bunny galaxies. One of the most obvious bits of fluff is NGC 4559. It lies 2° east and a bit south of yelloworange Gamma (γ) Comae, the bright foreground star that caps Melotte 111. Through my 105-mm (4.1-inch) refractor at 28×, NGC 4559 is an oval glow with faint stars hugging each side of its southeastern end. At 76× a dimmer star pops out at the southeastern tip. The galaxy covers about 4′ × 1½′, has a brighter core, and is slightly uneven in brightness. NGC 4559 is very pretty through my 10-inch reflector at 192× and spans 6½′ × 2½′. Hazy wisps reach out toward
the middle and easternmost of the three stars arcing across the galaxy. A fainter strand starting north of the galaxy’s center trends north-northwest. An elusive, starlike nucleus rests at the heart of NGC 4559, and brighter spots ornament the galaxy’s face. The magnificent showpiece galaxy NGC 4565 slashes the sky 2° south of NGC 4559. Its slender profile earned this edge-on spiral the nickname of the Needle Galaxy, while some observers fondly call it Berenice’s Hair Clip. As the brightest of the galaxies appearing at least seven times longer than wide, NGC 4565 is one of the best “flat” galaxies for a small telescope. In my 130-mm refractor at 37×, its 9′-long streak contains a brighter area half as long with a small central bulge. At 102× the core is a flattened oval, with a stellar nucleus and a faint star hovering over its
The barred spiral galaxy NGC 4559 is similar in structure to our own Milky Way.
JEFF HAPEMAN / ADAM BLOCK / NOAO / AURA / NSF
There was an old woman tossed up in a blanket, Seventeen times as high as the moon; Where she was going I could not but ask it, For in her hand she carried a broom. “Old woman, old woman, old woman,” quoth I; “O whither, O whither, O whither so high?” “To sweep the cobwebs from the sky, And I’ll be with you by-and-by!”
Sk yandTelescope.com May 2010 65
worldmags & avaxhome
Deep-Sky Wonders 4150
4525
+30°
4308
COMA BERENICES
4793
31 4670 4725
+25°
Mel 111
4310
4565
4747
4494
12h 45m
12h 30m
4245 4283 4278
4174
4338
12h 20m
JOHANNES SCHEDLER
SHELDON FAWORSKI / SEAN WALKER
incredible 15′ of sky, and I can trace its dark lane for about 3′. Moving 3.2° east and a little south takes us to a galaxy with remarkable structure, NGC 4725. A sharply peaked chain of sev-
Dust Motes in the Queen’s Hair NGC 4559 NGC 4565
Type Galaxy
Mag.
Size/Sep.
RA
10.0
10.7′ × 4.4′
12h 36.0m
9.6
15.9′ × 1.9′
Galaxy
Dec. +27° 58′
h
m
+25° 59′
h
m
+25° 30′
12 36.3
NGC 4725
Galaxy
9.4
10.7′ × 7.6′
12 50.4
LoTr 5
Planetary nebula
—
8.8′
12h 55.6m
+25° 54′
NGC 4274
Galaxy
10.4
6.8′ × 2.5′
12h 19.8m
+29° 37′
Hickson 61
Galaxy group
12.2–13.4
6′
h
12 12.4
12h 15m
Most of the galaxies shown on these charts belong to the Virgo Galaxy Cluster, roughly 60 million light-years distant. Melotte 111, the Coma Star Cluster, lies just 280 light-years from Earth.
Left: NGC 4565 is often cited as the most spectacular edge-on spiral galaxy in the sky. Right: NGC 4725 and 4712 are both barred spirals, and each is tilted roughly halfway betweeen edge-on and faceon to Earth. But NGC 4712 is more than three times farther, so it appears much smaller.
Object
6 7 8 9 10 11
Hickson 61 4173 4169 4175
+29°
5 6 7 8 9
12h 15m
northeastern pole. A dusky lane is subtly charcoaled across the core and a bit beyond, skimming just northeast of the nucleus. In my 10-inch reflector at 192×, NGC 4565 is a beautiful sight. It bridges an
4253 4274
4286
4555
4712
4314
Hickson 61 4251 4185
Star magnitudes
4789 LoTr 5
G
4559
+30°
4136
4274 4448
4839
Star magnitudes
37
m
+29° 12′
Angular sizes and separations are from recent catalogs. Visually, an object’s size is often smaller than the cataloged value and varies according to the aperture and magnification of the viewing instrument. Right ascension and declination are for equinox 2000.0.
66 May 2010 sky & telescope
worldmags & avaxhome
eral stars points toward it from the east. The galaxy is fairly large and bright in my 105-mm scope at 28×. It features a small core with extensions northeast and southwest, all enveloped in a faint halo. A faint star dangles beneath the galaxy’s southern edge. At 87× the extensions become part of an oval haze, uneven in brightness, surrounding the core. The core itself is slightly oval and harbors a tiny, bright nucleus. All told, NGC 4725 spans about 6½′ × 4½′ with an extremely faint star pinning its edge, north of the nucleus. My 10-inch scope at 192× nicely displays details within NGC 4725 and reveals two nearby galaxies. NGC 4275 juts into one side of a roughly 10′ rhombus of 12thmagnitude stars. The moderately faint galaxy NGC 4712 lies along the opposite side in the same field of view. Its 2′ × ¾′ oval holds a small oval core. Farther afield, NGC 4747 is 6′ north of the brightest star in the chain. This very faint streak is 2′ long with a somewhat brighter center. Those with large scopes, dark skies, and a touch of masochism might like to try for the planetary nebula LongmoreTritton 5. It rests 52′ east by north of NGC 4747, where it surrounds an 8.9magnitude binary star whose fainter component is the nebula’s progenitor. This planetary has extremely low surface brightness and is among the largest in our sky. It has a diameter of 8.8′ and a structure reminiscent of the Helix Nebula (NGC 7293). To catch sight of it, try low magnification and an O III nebula fi lter. I’ve gazed at this phantom planetary a few
STEVE & SHERRY BUSHEY / ADAM BLOCK / NOAO / AURA / NSF
of four galaxies tightly packed into 6′ of sky. My 105-mm refractor at 87× shows three of them. NGC 4169 is the brightest. It’s tilted north-northwest and has a large oval core. NGC 4174 and NGC 4175 are very faint. The former is a small fuzz-spot tipped northeast, while the latter is larger and leans northwest. The fourth member, NGC 4173, is elusive even in my 10-inch scope. Its long, highly elongated profile is in line with NGC 4173 and best seen with averted vision. Odd though it may seem, NGC 4173 is
Both the inner arms and the outer halo of the spiral galaxy NGC 4274 appear to form ring structures around the galaxy’s core. The bright inner ring is often likened to Saturn’s rings.
Sue French welcomes your comments at
[email protected].
4173
4169 4175
4174
SLOAN DIGITAL SKY SURVEY
times with 14- to 15-inch scopes and could only log it as a “maybe.” Folks with darker skies have reported success with scopes as small as 16 inches in aperture. Now let’s move 2.1° northwest of Gamma Comae to NGC 4274. It shares the field of view with NGC 4278 and NGC 4314 through my 105-mm scope at 28×. NGC 4274 is a fairly bright oval, NGC 4278 is smaller and round with a very bright nucleus, and NGC 4314 is a faint smudge. At 87× NGC 4274 is about 5½′ × 1¾′ and leans south of east. It enfolds a large oval core with a small, round, bright center. A close, unequal star pair lies 6′ south. NGC 4278 grows much brighter toward the center. A very faint star floats 5′ north, while the very small but fairly bright, round galaxy NGC 4283 keeps it company 3½′ east-northeast. NGC 4314 shows a bright, 2½′ spindle with a round central bulge clasping a stellar nucleus. The spindle has a very faint star near its northwestern tip and is enclosed in a tenuous halo. NGC 4274 looks rather strange through my 10-inch scope at 192×. The oval halo seems disconnected from the sides of the core by darker ears. It’s like looking at a ghostly Saturn! There’s a diaphanous envelope around the whole thing that quickly fades outward. NGC 4286 emerges 5′ east-northeast of NGC 4283. Its faint oval glow has a small brighter core and a dim star off its south-southeastern tip. Our final stop is Hickson 61, resting 1.7° west of NGC 4278. Commonly known as The Box, this compact group consists
a foreground galaxy not associated with the other three. We see evidence of this in photos, where NGC 4173 looks larger, more detailed, and bluer than its chance companions on the sky. As with most of the galaxies in this tour, NGC 4173 is a member of the Virgo Cluster, centered some 60 million light-years away. The other Hickson 61 galaxies and NGC 4712 are about three times more distant. ✦
Sk yandTelescope.com May 2010 67
worldmags & avaxhome
Ken Hewitt-White Going Deep
A Fine Field in Boötes This ragtag herd of galaxies is worth corralling. Often overlooked by galaxy hunters, the giant Herdsman is not without extragalactic attractions. As evidence I offer the edge-on spiral galaxy NGC 5529 in the western part of the constellation. My interest in this 11.9-magnitude wisp dates back to Sue French’s Deep-Sky Wonders column of June 2004 (page 84). Sue’s impression of NGC 5529 as a “remarkably flat galaxy” inspired me to scrutinize it with my 17.5-inch Dobsonian under a country black sky. I had no trouble finding the little guy less than 1° northwest of the 5th-magnitude star A Boötis. And, as often happens when one digs deep with large optics, I unearthed other subtle treasures nearby. Let’s tour the area beginning with that flat fuzzy. Sue reported that NGC 5529 “is one of the entries in the Revised Flat Galaxy Catalogue, a compilation of 4,236 galaxies that appear at least seven times longer than wide.” At 6.4′ × 0.7′ — a ratio of 9:1 — NGC 5529 qualifies easily. My initial inspection of the galaxy at 83× resulted in the following statement in my logbook: “Very
slender and gently brighter toward the middle. Slanted northwest–southeast with a dim star off southeast tip.” At 285× I added: “Small, distinct core with some mottling.” I interpret that blotchy texture as a hint of the galaxy’s dust lane. The image on the facing page shows the dust lane cutting north of the nucleus, indicating that NGC 5529 isn’t precisely edge-on. My log entry agrees: “North edge fairly straight; south side bulges slightly.” Two very faint galaxies hover near NGC 5529. PGC 50952, also known as MCG 6-31-87, is visible in my scope at 222× about 4′ southeast of the edge-on’s hub, as shown on the facing page. PGC 50925 (sometimes identified incorrectly as NGC 5527) is an extremely difficult object located a similar distance southwest of the hub. Both companions are comparable in size, but while PGC 50952 has a bright core and glows at magnitude 15.3, PGC 50925 is diff use, with much lower surface brightness. When I try for the fainter galaxy, I first note the 14th-magnitude star directly south of NGC 5529’s core. On the best nights,
5545/5544
5557
UGC 9123
PGC 50944
5527 (“5524”)
SLOAN DIGITAL SKY SURVEY (3)
5529
5572
15′
68 May 2010 sky & telescope
worldmags & avaxhome
5529 PGC 2076843
5545
PGC 2076761
PGC 50925
5544
PGC 50952
the “comet.” The most prominent of these is 11.0-magnitude NGC 5557, whose 2.3′ × 1.9′ halo surrounds a bright core and nucleus. At 285× I see a dim star in the halo southeast of the core. Also in the region are 14.2-magnitude NGC 5572 and 13.8-magnitude NGC 5527. The latter object is labeled NGC 5524 on most star charts, but in a note on the NGC/IC Project website (www.ngcicproject.org), Harold G. Corwin, Jr. argues that NGC 5527, the name sometimes given to faint PGC 50925, should apply to this much more prominent galaxy. According to Corwin, NGC 5524 is likely a faint double star mistaken for a galaxy by Lord Rosse while observing NGC 5529 through his 72-inch reflector in 1855. ✦ Ken Hewitt-White hunts galaxies from western Canada. 14h 30m
14h 20m
14h 10m
a +38°
BOOTES
5557 5529
A
+36°
Star magnitudes
my averted vision occasionally glimpses an exceedingly faint patch whose position relative to the star and the other two galaxies matches what I see in images. Consider PGC 50925 your challenge of the night! Eagle-eyed observers might pick up three other small fry in the same high-power field. Two of the galaxies, PGC 2076761 and PGC 2076843, lie close together 4′ east of NGC 5529. I only recently noticed these tiny targets on photographs and haven’t yet attempted them telescopically, but they seem brighter than the aforementioned PGC 50952. They’ll likely appear stellar unless high magnification is applied. Another midget is 15th-magnitude PGC 50944 (MCG 6-31-86), almost 9′ north of NGC 5529. This pale blob flickers on and off in my optics at 285×, east-northeast of a 10th-magnitude star. Less than ½° northeast of NGC 5529 is a compact galaxy pair I call “the comet.” NGC 5544 and NGC 5545 (together known as Arp 199) make a pretty picture: NGC 5544 is a yellowish, face-on barred spiral partly overlapped by NGC 5545, a bluish, nearly edge-on spiral. At 83× this tight twosome is just an irregularly-shaped nebulosity, but 285× reveals a binary galaxy oriented northeast-southwest. NGC 5544 glows at magnitude 13.4 and exhibits an obvious core inside a 1′-diameter halo. NGC 5545 BOOTES is about 1 magnitude dimmer and elongated 1.0′ × 0.3′ — a faint “tail” flowing away from the bright “head” formed by NGC 5544. Delightful! Your scope can sweep up three additional NGC galaxies within ¾° of
4 5 6 7 8 9 10
Sk yandTelescope.com May 2010 69
worldmags & avaxhome
Gary Seronik Telescope Workshop
A Small Dob Solution The smaller the scope, the trickier the mount. Some of today’s most interesting homemade
ARTHUR GAMBLE
telescopes marry tried-and-true designs with recent innovations — sort of a scenario where Jean Texereau meets John Dobson. That was my first thought when I saw Wichita Falls, Texas, ATM Arthur Gamble’s nifty 6inch f/5 refractor. Although its resemblance to the scopes appearing in Texereau’s classic volume, How to Make a Telescope, is more superficial than actual, the Dobsonian touches are real and very useful. Art’s telescope uses a short-focus, air-spaced achromatic objective lens sold by the New York firm A. Jaegers, Jr. Optics, Inc. (www.ajaegers.com). But the scope’s design has several features that can be utilized in a wide range of instruments, from small refractors to short-focus
Arthur Gamble’s attractive 6-inch f/5 refractor has a modified Dobsonian mount that can also carry a host of other instruments, including 4- and 6-inch Newtonian reflectors.
Newtonians. And it’s with the latter that I think Art’s mount has its greatest utility. As anyone who has made a small Dobsonian knows, such an instrument’s dimensions and light weight can create problems. First, the scope’s focuser is usually located uncomfortably close to the ground. If you build a standard rocker box, you’ll find yourself either kneeling to peer into the eyepiece or setting up the scope on a table. Neither situation is ideal. Second, the scope’s balance point changes dramatically depending on the weight of the eyepiece. This is because the mass of the eyepiece is proportionally more significant in a lightweight scope than in a heavy one. For example, swapping a 3-ounce Plössl for a 1½-pound widefield eyepiece doesn’t necessarily change the balance of a 50-pound instrument, but it will cause a 5-pound scope to nosedive! Art’s mount solves both issues elegantly. The low-focuser issue is neatly addressed with a rigid tripod that elevates the rocker box to a comfortable viewing height. Art’s plywood tripod consists of three identical legs, and a triangular piece on top. The result is both functional and undeniably stylish. And thanks to its fi xed-height, non-folding design, he was able to avoid the sorts of complications that typically make building a tripod such an involved exercise. To tackle the balance problem, Art used a three-way attack. “First, I tried to even out the weights of my eyepieces by machining a steel adapter to make the lighter eyepieces match the weight of the heavier ones,” he explains. “Second, for the altitude bearings, which are riding on Teflon pads, I chose PVC in place of Ebony Star Laminate to increase the friction. Third, I built a set of adjustable clamps to further control the altitude motion.” These clamps are key to preventing the scope from being overly sensitive to changes in balance. As the photo on the next page shows, each altitude-bearing assembly has a ½-inch-wide strip of 1/8-inch-thick steel bent into a curve. This component forces two Teflon buttons against the PVC bearing from above. By adjusting two knurled nuts, Art is able to set the friction of the altitude bearings precisely, for just the right resistance and feel. You can make the clamp with wood if working with steel doesn’t appeal to you.
70 May 2010 sky & telescope
worldmags & avaxhome
Far Left: The scope’s altitude bearings include a variable friction adjustment that’s described in the accompanying text.
ARTHUR GAMBLE (2)
Left: A sturdy, fixedheight tripod supports the rocker box and elevates the eyepiece to a comfortable height.
Although good looks and functionality are not necessarily related, over the years I’ve noted that builders who take the time to make their scopes attractive usually spend extra effort to ensure their scopes work well too. Art’s refractor is certainly a good example of this. I was curious how he obtained the fine finish. As he explains, “I used three coats of a high-gloss acrylic enamel — basically an interior trim paint. I applied the paint with 3- and
4-inch mini rollers, which produces a nice textured fi nish that’s very durable and easy to touch-up if damaged.” Nicely done. I have a feeling that Jean Texereau would be impressed. ✦ Contributing editor Gary Seronik builds scopes and observes the night sky at his home in Victoria, British Columbia, Canada. He can be contacted through www.garyseronik.com.
19TH ANNUAL NORTHEAST ASTRONOMY FORUM & TELESCOPE SHOW APRIL 17-18, 2010
THE WORLD’S LARGEST ASTRONOMY EXPO!
TM
Only 30 minutes from New York City at SUNY Rockland College, Suffern, NY More than 120 vendors from around the world, astronomy workshops, daily solar observing, screenings of the movie “Blast!”, the TWAN Astronomy Image Exhibit, and much, much more!
FEATURING ALEX FILIPPENKO UC Berkley and History Channel’s “The Universe” ALSO FEATURING SCIENCE CHANNEL’S “METEORITE MEN” Steve Arnold and Geoff Notkin and Chris Lintott - Host of Sir Patrick Moore’s “Sky at Night” Amy Mainzer - NASA/JPL WISE Space Telescope Jennifer Lynne Heldmann - NASA Ames Research Center LCROSS Phil Goode - Big Bear Solar Observatory Attilla Danko - Creator of the Clear Sky Clock DON’T MISS THE NORTHEAST ASTRO IMAGING CONFERENCE APRIL 15-16, 2010 AT NEAF
FEATURING WORKSHOPS & LECTURES BY
Richard Berry Ron Dantowitz
SHOW HOURS: SAT 8:30-6 PM, SUN 10-6 PM For more m information or hotel accommodations visit: www.RocklandAstronomy.com/NEAF www contact Alan Traino at 973-427-2020 or con
Doug George Don Goldman
Presented by
Sponsored by
SkyandTelescope.com
Alan Erickson Wally Pacholka
Mike Simonsen Brian D. Warner
Sk yandTelescope.com May 2010 71
worldmags & avaxhome
Innovative Image Processing
Digging Out the Details KEN CRAWFORD
Layered deconvolution adds depth to your astro-images. Astrophotographers always strive to capture the most detailed and colorful images possible with their equipment. While most of us don’t shoot from mountaintops with subarcsecond seeing, we still manage to take noteworthy pictures. Local atmospheric conditions, imperfect guiding, wind buffeting, and other problems blur our images, obscuring small-scale details, bloating stars, and making our pictures look flat or out of focus. Fortunately, modern image-processing techniques, particularly deconvolution, can compensate for many of these deficiencies. The trick is learning how to use them effectively. Perhaps the most powerful digital tools available today are the various deconvolution algorithms included in many astronomical post-processing software programs. Deconvolution is a mathematical process used to sharpen images based on known values, such as the theoretical brightness profile of a perfect star image. Deep-sky
astrophotos respond particularly well to deconvolution. Software can measure the amount of blur in a star image (known as the point spread function, or PSF), and use this to deconstruct the view and then reassemble it based upon the PSF, resulting in a much sharper image. The problem with deconvolution from an aesthetic perspective is that it attacks the entire image. If I want to really dig out the very smallest details in my photos of galaxies or nebulae using a strong deconvolution setting, Above: Taking highly detailed astrophotos with large telescopes is a challenge. To get the most out of his images, Ken Crawford uses a novel technique he calls multi-strength deconvolution layer blend (MSDLB). Crawford recorded this stunning picture of NGC 891 with his 20-inch Ritchey-Chrétien telescope and an Apogee Alta U9000 CCD camera, and then he processed it using his MSDLB technique. All images are courtesy of the author.
72 May 2010 sky & telescope
worldmags & avaxhome
the algorithm will add artifacts to the brighter stars, and it will greatly enhance any noise in the background. I’ve developed an easy method in Adobe Photoshop I call multistrength deconvolution layer blend (MSDLB) to reduce these adverse effects. This technique allows me to aggressively sharpen my images without introducing artifacts that can be misinterpreted as real features.
Processing in CCDStack After I’ve captured, calibrated, and combined all of my data into their various red, green, blue, and luminance images, I start my process with the luminance image. This is where the majority of the contrast and detail resides in a digital color photo. I prefer to use the software CCDStack (www.ccdware.com) to combine, deconvolve, and stretch my images before bringing them into Photoshop, but the end result will be the same if you use your favorite CCD processing software. In CCDStack I pull down the Process > Deconvolve action, which opens the deconvolve window. I then select the Positive Constraint function, and set the number of iterations to about 30. CCDStack measures the PSF of the stars by having you simply click on one; you should avoid choosing the brightest stars in your image, because they can be saturated, which results in an inaccurate PSF value. As soon as you click on a star, an information window opens that lists measurements of the point — the most important is the full-width, half-maximum (FWHM). This measurement reflects how much of a star’s light is concentrated in its Airy disk. The larger the number, the more bloated and soft stars will appear. I often select a few stars of about the same brightness to make sure the FWHM is similar in each, and then I click the Deconvolve button. This action slightly tightens the medium-brightness stars and faint, tiny galaxies in the background. The idea is to make this deconvolution process mild enough so that it doesn’t introduce noise in the background or artifacts to the bright stars. I then save this result as a new 32-bit FIT fi le. Next, I return to the original luminance fi le and apply the same Positive Constraint deconvolution, this time performing 75 to 150 iterations, until I see major improvement in the small details in the galaxy itself; the brighter stars will start showing artifacts such as bright edges and darker centers. I can correct this later. When fi nished, I save this result as a new 32-bit FIT fi le so that I now have three luminance frames: the original, one with mild deconvolution, and another with aggressive sharpening. My next step is to perform a non-linear stretch to each deconvoluted fi le using the DDP (Digital Development Process) function. This step compresses the dynamic range of the images so that the faintest objects and brightest areas of the images can be displayed simultaneously. DDP can actually be displayed in CCDStack throughout the entire process by keeping the Adjust Display window
Above: Once you combine all the data for a luminance image in CCDStack, apply deconvolution to reduce the “fuzzy” appearance of stars and sharpen detail in the subject. You can do this with the Process > Deconvolve pulldown menu, and by clicking a medium-brightness star to measure its full-width, halfmaximum (FWHM) as a reference.
These two crops of NGC 891 show the difference between a mild application of deconvolution (in this case, 30 iterations) in the top image, and an aggressive application of the technique at bottom. The latter method greatly increases details in the galaxy’s dust lanes, but at the expense of creating bright rims and dark centers in most stars throughout the image.
Sk yandTelescope.com May 2010 73
worldmags & avaxhome
Innovative Image Processing
open and by clicking the DDP and Apply to All boxes. These changes aren’t applied permanently to the images until they are saved as scaled data using the pulldown menu File > Save scaled data, then selecting the “All” option. I always save these two scaled images as 16-bit TIFF files so they can be opened in Adobe Photoshop CS.
Blending It All Together The idea behind MSDLB is to blend both deconvolved luminance images into one master luminance to take advantage of the smoothness and tight stars in the mildly deconvolved version and the sharp detail of the aggressively deconvolved photo. I begin by copying the heavily sharpened photo and pasting it onto the mild version. You do this on a PC by first selecting the aggressively deconvolved image and holding down the Ctrl and A keys, then the Ctrl and C keys to copy all. Next, click your mildly sharpened image and hold the Ctrl and V keys to paste the earlier image onto it as a new layer. I now have one file with two layers of data that I’ll save as a Photoshop Document (PSD). To blend these images together, I open the layer window (Window > Layers) then click on Layer 1. Next, I apply the pulldown option Layer > Layer Mask > Hide All. This makes a layer mask that appears completely black next to the thumbnail of layer 1, and hides everything on that layer. To reveal selective parts of the heavily deconvolved layer, I click on the new mask to the right of layer 1, and select the brush tool from Photoshop’s tool palette. Then I’ll chose the brush radius and start “painting” on my image in the places that I’d like to reveal. I should note that I don’t use a feathered brush tool, because I prefer to control the edges of my mask using Photoshop’s Blur func-
tions. Like magic, the sharpened regions start to appear wherever I paint onto my mask. When I’m satisfied with this mask, I apply the Gaussian Blur fi lter to smooth the transition between the layers. One tool I would highly recommend for any “digital darkroom” is a Wacom Intuos tablet (www.wacom.com/ intuos). This tool offers a very high degree of control for most Photoshop applications, such as painting masks or creating complex selections; it’s used just like a pencil on a pad of paper. If I accidentally paint an area in the mask that reveals over-sharpened stars, it’s easy to fi x by changing the color of the brush tool from white to black (done by clicking the small arrow icon at the bottom of the tools palette). This reverses the background and foreground colors, which on a grayscale image are white foreground and black background by default. I then paint a circle over the stars I’d like to hide, changing the radius of the brush tool as needed to accommodate smaller stars. To see the entire mask, I hold the ALT key while clicking on the mask thumbnail. Once I’m happy with this fi le, I simply save it as it is and then create additional adjustment layers to control brightness and contrast, curves, and additional sharpening. The beauty of working with layer masks is that everything is contained in a single fi le, yet the original image is not changed. To combine the processed image with my color image,
Author Ken Crawford shares many innovative imaging techniques in a number of step-by-step video tutorials on his website: www.imagingdeepsky.com/Presentations.html.
use DD6a BeforeMSDLB.tif
Left: Combining the two deconvolved images in Adobe Photoshop CS requires the use of layer masks. Once the aggressively deconvolved image is pasted on top of the mild version as a new layer, you use the pulldown action Layer > Layer Mask > Hide All to conceal the top layer. Right: A “hide all” layer mask needs to have the areas you wish to reveal “painted” in. The mask above has been painted white in the areas of the galaxy to be sharpened. Over-sharpened stars that are revealed can be hidden again by painting black spots over them in the mask. Blending between the two layers can be varied by blurring the mask.
74 May 2010 sky & telescope
worldmags & avaxhome
Crawford’s MSDLB technique combines the best areas of each image. The left photo shows the grayscale view of his data without any deconvolution, while the version on the right displays his final results.
I first flatten the layers by selecting the pulldown menu Layer > Flatten Image, then I copy this image and paste the result onto my color file, switching the layer option from normal to luminosity. A similar technique can be used on tri-color narrowband images by combining each filtered image into a single luminance file. This would be processed exactly as described here, then pasted into the color fi le the same way. Digging out very small details in images with MSDLB requires patience and the right fi lters and masks. Once
you have these methods down, you can selectively apply almost any filter or blending mode. These tools can be used like a surgeon’s knife or a blacksmith’s hammer, so remember to save changes as you go, and go slowly. Start digging out the details in your images using this easy method and leave the noise and artifacts behind. ✦ Ken Crawford is the president of the Advanced Imaging Conference (www.aicccd.com), held each year in San Jose, California. See his images at www.imagingdeepsky.com.
The MSDLB technique can be applied to most deep-sky astrophotos, including tricolor narrowband images. The author recorded this colorful narrowband photo of the Tarantula Nebula (NGC 2070) from his second observatory, located in Moorook, Australia.
Sk yandTelescope.com May 2010 75
worldmags & avaxhome
Sean Walker Gallery
◀ POSEIDON’S
VIEW Chris Kotsiopoulos The Moon appears to take a bite out of the Sun over the ancient Temple of Poseidon in Sounion, Greece, during the annular eclipse last January 15th. Details: Skywatcher PRO 80 ED APO Refractor and Canon Digital Rebel XTi DSLR camera. Exposure was ½ 000 at f/7.5, ISO 100.
76 May 2010 sky & telescope
worldmags & avaxhome
◀ THE
CLOUDS OF MARS Donald C. Parker The red planet presented observers with wispy equatorial clouds and a persistent dust storm over the north polar cap (bottom) in this image captured shortly before opposition last January. Details: 16-inch Newtonian refractor with Lumenera SKYnyx 2-0 video camera. ▶ SHADOW
PLAY Ted Kayser Sunlight filtering through tree leaves produced hundreds of tiny images on the ground in Kampala, Uganda, during January’s annular solar eclipse. Details: Nikon Coolpix L18 digital camera.
▴ 2009
LOOP OF VENUS Tunç Tezel This digital composite of 26 images follows Venus as it traced a retrograde loop across the constellation Pisces during the first half of 2009. Details: Canon EOS 5D DSLR camera with 50mm lens. ◀ THE
VIEW FROM ABOVE Greg Merkel and classmates Students attending the University of Minnesota’s Spacefl ight with Ballooning class launched a weather balloon containing several upperatmosphere experiments, including a digital camera programmed to snap pictures every 30 seconds. This photo records the curvature of Earth from roughly 118,000 feet (36 kilometers). Details: Canon PowerShot A570 IS digital camera. Exposure was 1/1250 second at f/2.6, ISO 80.
Gallery showcases the finest astronomical images submitted to us by our readers. Send your very best shots to
[email protected]. We pay $50 for each published photo. See SkyandTelescope.com/aboutsky/guidelines. Sk yandTelescope.com May 2010 77
worldmags & avaxhome
Gallery
COLORFUL CEDERBLAD 214 Eric Africa This 2½° patch of gas and dust in Cepheus is cataloged as Cederblad 214 at top, and NGC 7822 below, though both are actually brighter areas of the same nebulous cloud. South is up in this photo. Details: Takahashi FSQ-106N astrograph with SBIG STL-6303E CCD camera. Total exposure time is 20 hours through Astrodon Hα, O III, and S II narrowband filters. ✦
78 May 2010 sky & telescope
worldmags & avaxhome
ALL STARS POINT TO . . .
TEAM OPT!
Magdalena Ridge Observatory Socorro, NM www.mro.nmt.edu
Over 200 Years Experience to Help You.
In the fall of 2006 we completed the installation of the 40.375 foot Observa-DOME at Magdalena Ridge Observatory which will house a 2.4 Meter Telescope.
Let our knowledgeable and dedicated astronomy staff help you make the right choice! We don’t just sell astronomy equipment, we use it!
800.483.6287 OPTtelescopes.com
(
(
&
(
(
(
(
PRO- D OME
(
®
Promoting Amateur Science and Amateur-Professional Collaboration
(
E
H
(
— D E O M
M
Symposium on Telescope Science
O
The 29th Annual
(
(
(
(
[email protected]
TM
Designed for the Professional . . . Priced for the Amateur ( 6, 10, & 15 ft. Diameter Observatories
The 2010 Symposium on Telescope Science is a joint meeting with the Center for Backyard Astrophysics (CBA). It will feature noted speakers and workshops on Astronomical Research.
( Stand-alone or On Building ( All Fiberglass ( Easy Assembly ( Manual/Automatic Operation
2010 Dates
AAV, Lue, Switzerland alpineastrovillage.com
Tuesday, May 11th to Thursday, May 13th at the Northwoods Resort in Big Bear, California for further information, please visit our website at: www.socastrosci.org
( Full Height/Handicap Access ( Priced from $ 3,150
CLOUD DETECTION SYSTEM
www.clouddetection.com Low cost, accurate system (hardware & software) to detect cloud cover, light levels and first traces of rain. DDW interface. Call or write for FREE Brochure
TECHNICAL INNOVATIONS
$$!' ) % #$&# ) "! ) $ % ((( " " "
Sk yandTelescope.com
worldmags & avaxhome
May 2010 79
Market Place
Your essential source for astronomical products
ACCESSORIES
ACCESSORIES
StarGPS
World Famous and the World’s Best
"Plug & Play" GPS for Vixen Starbook, AP-GTO, Meade, Celestron, Gemini www.stargps.ca Foster Systems
DEW CONTROL SYSTEMS
Serving astronomers and observatories worldwide
w! Ne
ACCESSORIES
WeatherAlert Weather Monitor
•Top Quality build •Effective •Heaters and Controllers for every budget •Heated Dewcaps
•Rain/Snow alert •Cloudy/Clear sky alert •Dewing alert •Wind Speed alert Configurable •USB and ASCOM compliant From $299 Visit us at www.fostersystems.com
NEW!
Stargate Observer Tent Larger, higher, and expedition quality! Many new features!
The best Power Packs in the business! 12 and 18 volt!
Bahtinov Focusing Masks Amazingly easy and fast, razor sharp focus. All sizes. ...and much more! Visit our web site for details.
Tel - 800.393.5456 www.kendrickastro.com 80
May 2010 sky & telescope
worldmags & avaxhome
ACCESSORIES
ACCESSORIES
ACCESSORIES
SEE MORE NEW STUFF AT OUR WEBSITE
Are you
PEETERSON QUIPPED?
We Make Your Part! Custom astronomy parts machined to YOUR specifications. One-of-a-kind adapters and accessories in aluminum, brass, titanium, stainless steel. Try our free Cost Estimator at www.preciseparts.com 305 253-5707
[email protected]
Custom Parts for Astronomy
8
j GET-A-GRIP™ Ergonomic handles make your big Meade feel many pounds lighter. $72.99/pair k EYEOPENER® Increase light reaching your pupil by up to 65% s while eliminating vignetting. 9 10"-14" scopes. $74.99 l 2" TUBE ADAPTER (not shown) shortens optical train by eliminating the microfocuser. $49.99 m EZ FOCUS™KIT Precision bearings virtually eliminate focuser backlash. All Meade 7"-12" scopes. $29.99 n MOUNTING ASSISTANT™ Greatly simpli¿es LX400/ 200/90 mounting. Compact & non-intrusive. $79.99 o BUCK’S GEARS™ Optimize tracking performance, adjusting drives while replacing plastic RA & DEC gears with precision steel gears. 7"-12" LX200 GPS & R scopes $107.99. 14" LX200 GPS & R $127.99 BUCK’S DRIVE TUNE-UP Tools, parts & directions to achieve Buck’s Gears precision on Meade 7"-12" LX200 & 400 already equipped with precision metal gears. $42.99 p EZ CLUTCH™KIT Lightly tightening DEC clutch knob locks the most unbalanced LX400/200/90 $29.99 q EZ BALANCE™ 3.3# on-axis counterweight for noseheavy 10"-14" LX400/200/90 scopes. $41.99 r TRIPOD SHRINK KIT shortens giant ¿eld tripod. $52.99 s AZ ARM BIAS WEIGHT for precise imaging. $19.99 EZ BINOC MOUNT KIT 5-axis outdoor mount handles all size binocs. View standing, sitting or reclining. 10 sec setup. Kit contains all parts requiring machining, welding, drilling, tapping plus special parts. You supply inexpensive pipe sections readily available locally. $99.99
Peterson Engineering Corp. (401) 245-6679 | www.petersonengineering.com
For over 50 years, your source for camera quality Japanese optics
Planetary Orthoscopics 70-80° Oculars Aluminum Mirror Cells
Online Store www.universityoptics.com 800-521-2828
ScopeStuff
Telescope Accessories & Hardware
Featuring Items From: TeleGizmos Covers • Astrozap Dew Shields Dew-Not Dew Heaters • Peterson Engineering Antares • Telrad • Rigel Systems • Sky Spot Starbound Chairs • Smart Astronomy David Chandler • Lightwedge • Baader ScopeStuff Piggyback & Balance Kits Rings, Rails, Dovetails, Cables, ATM, Eyepieces, Filters, Diagonals, Adapters Green Lasers • And Much More! www.ScopeStuff.com 512-259-9778 BOOKS
worldmags & avaxhome
Sk yandTelescope.com
May 2010
81
BOOKS
DRIVES/MOUNTS
TELESCOPE DEALERS
KHAN SCOPE CENTRE Our 24th Year
Authors Needed
$FMFTUSPOt.FBEFt.BMMJODBNt5FMF7VF 4LZXBUDIFSt8JMMJBN0QUJDTt%FOLNFJFS "OUBSFTt$PSPOBEPtJ0QUSPOt+.*t,FOESJDL -VNJDPOt-VOUt'BSQPJOUt7JYFOt"%. /FXt6TFEt5SBEF*OT
If you can write a book that other amateur astronomers will find interesting, a major international publisher has contracts and advances waiting. This is a genuine offer – nobody’s going to ask you for money!
Email:
[email protected]
1-800-580-7160
CCD EQUIPMENT
www.khanscope.com
TELESCOPES
Equipment for the Serious Amateur Astronomer
Premium telescopes & accessories O B S E R VAT O R I E S / D O M E S
Hate to Rotate? COMPUTER SOFTWARE
Discover why our clamshell domes are simply the best solution. (7ft to 20ft Diameter) 949.215.3777
www.ASTROHAVEN.com
[email protected]
Designed and Manufactured in Australia
We ship to anywhere in the world
8dbeaZiZdWhZgkVidgn·'#(b!(#*b!*b!+#,bY^V# 9dbZdcan 8dbeaZiZanlViZgegdd[ 9dbZgdiVi^dcVcYh]jiiZgdeZgVi^dc BVcjVa Bdidg^hZY 8dbejiZg^oZY 6H8DBXdbeVi^WaZ HiV^caZhhhiZZaÄii^c\h lll#h^g^jhdWhZgkVidg^Zh#Xdb^c[d5h^g^jhdWhZgkVidg^Zh#Xdb
OPTICS
82
May 2010 sky & telescope
worldmags & avaxhome
IDAS
Research grade optical filters
Spectrum-enhanced DSLR cameras
Kenko
Precise portable mount
We feature Japanese-made premium astronomical equipment and accessories for everyone interested in astrophotography and visual astronomy. We are confident you will find the solutions to all your astronomy needs here. 877-BUY-BORG www.astrohutech.com
TELESCOPES
CLASSIFIEDS
The CDK Optical Design delivers flat coma free fields with no off-axis astigmatism across a 52mm field. CDK 12.5" - $9,990 CDK 17" - $22,000 CDK 20" - $32,500
EASTER ISLAND ECLIPSE July 2010. Highly experienced licensed Australia-based tour operator. A choice of two tours. Flights and accommodation guaranteed. Details:
[email protected].
1815 W. 205th St., #303 – Torrance, CA 90501 Phone: (310) 787-9411 – Fax: (310) 634-0439 Image Courtesy of Stephane Murphy (taken with CDK12.5)
www.planewave.com
TELESCOPES
Classified ads are for the sale and purchase of noncommercial merchandise, unique items, or job offers. The rate is $1.50 per word; minimum charge of $24; payment must accompany order. Closing date is 15th of third month before publication date. Send to: Ad Dept., Sky & Telescope, 90 Sherman Street, Cambridge, MA 02140.
ASTRONOMY CAMP STAFF: Yarger Observatory, YMCA Camp Eberhart, Michigan www.campeb.org or http:// analyzer.depaul.edu/paperplate/astrocamp.htm Resume to
[email protected]; 574-291-1121. WANTED: No-longer-used telescopes, parts, and accessories. Contact Gary Hand, 26437 Ridge Rd., Damascus, MD 20872. Phone: 301-482-0000.
T R AV E L
Experience the
AUTHORS/SOFTWARE DEVELOPERS:is your passion astronomy and would you like to see your work published by Willmann-Bell? If so, let’s explore the possibilities. Call 1-800-825-7827 or write PO Box 35025, Richmond, VA 23235.
1257+(51/,*+76 with famed 3-D Astro-photographer, %U\DQ:KLWH ´7KH$XURUD&KDVHUµ
$5&7,&2'<66(<6
70
Exquisite tours of the Arctic and Antarctic since 1976.
The 42nd annual
www.ArcticOdysseys.com
TOTALITY
3
July 11, 2010
The Most Complete Telescope Store in Texas
Eclipse Tours
Easter Island
May 12–16, 2010 YMCA Camp Oakes located just outside Big Bear City, CA
Come See Dozens of Astronomical Vendors, Talks, and Workshops! Visit the Beginners Corner & Observing Fields for Guided Hands-on Learning.
Polynesian Cruise Cook Islands Authorized dealer: Vixen, Orion, Celestron, Meade, Tele Vue, Fujinon, Adlerblick, Home-Dome Books, Charts, Software, Service • Repairs • Private Lessons Free instruction at night with every telescope purchase.
5IF0CTFSWBUPSZ *OD
17390 Preston Rd. #370 (2 Traffic Lights North of Campbell Rd.) Dallas, TX 75252 (972) 248-1450 XXX5IF0CTFSWBUPSZ*ODDPN
TravelQuestTours.com Toll free: 800 830 1998 worldmags & avaxhome
For more information call Robert Stephens at (909) 948-2205, or email your questions to
[email protected]
www.rtmcastronomyexpo.org
Product Locator
Inside This Issue BINOCULARS Celestron (Pages 39, 50, 88) Celestron.com 310-328-9560 Meade (Pages 7, 41) Meade.com 800-919-4047 | 949-451-1450 Orion (Pages 21, 63) OrionTelescopes.com 800-447-1001 | 831-763-7000
CAMERAS Celestron (Pages 39, 50, 88) Celestron.com 310-328-9560 FLI (Page 47) FLIcamera.com 585-624-3760 Meade (Pages 7, 41) Meade.com 800-919-4047 | 949-451-1450 Orion (Pages 21, 63) OrionTelescopes.com 800-447-1001 | 831-763-7000 QSI (Page 54) QSImaging.com 888-774-4223
EYEPIECES
Dealer Locator
Astro-Tech (Page 60) Astronomics.com 800-422-7876 | 405-364-0858 Celestron (Pages 39, 50, 88) Celestron.com 310-328-9560 Explore Scientific (Page 9) ExploreScientific.com 888-599-7597
Meade (Pages 7, 41) Meade.com 800-919-4047 | 949-451-1450 Orion (Pages 21, 63) OrionTelescopes.com 800-447-1001 | 831-763-7000 Sky-Watcher USA (Page 5) SkyWatcherUSA.com 888-880-0485 Tele Vue (Page 2) TeleVue.com 845-469-4551 TMB Optical (Pages 53, 60) Astronomics.com 800-422-7876 | 405-364-0858
FILTERS Astrodon (Page 80) Astrodon.com Celestron (Pages 39, 50, 88) Celestron.com 310-328-9560 Meade (Pages 7, 41) Meade.com 800-919-4047 | 949-451-1450 Orion (Pages 21, 63) OrionTelescopes.com 800-447-1001 | 831-763-7000 Tele Vue (Page 2) TeleVue.com 845-469-4551
MOUNTS
TELESCOPES
Celestron (Pages 39, 50, 88) Celestron.com 310-328-9560 iOptron (Page 11) iOptron.com 866-399-4587 Meade (Pages 7, 41) Meade.com 800-919-4047 | 949-451-1450 Orion (Pages 21, 63) OrionTelescopes.com 800-447-1001 | 831-763-7000 Paramount (Page 87) Bisque.com 303-278-4478 Tele Vue (Page 2) TeleVue.com 845-469-4551
Astro-Tech (Page 60) Astronomics.com 800-422-7876 | 405-364-0858 Astrotelescopes (Page 50) HandsonOptics.com 866-726-7371 Celestron (Pages 39, 50, 88) Celestron.com 310-328-9560 Explore Scientific (Page 9) ExploreScientific.com 888-599-7597 iOptron (Page 11) iOptron.com 866-399-4587 JMI (Page 64) JMITelescopes.com 800-247-0304 | 303-233-5353 Meade (Pages 7, 41) Meade.com 800-919-4047 | 949-451-1450 Orion (Pages 21, 63) OrionTelescopes.com 800-447-1001 | 831-763-7000 PlaneWave Instruments (Page 83) PlaneWave.com 310-787-9411 Sky-Watcher USA (Page 5) SkyWatcherUSA.com 888-880-0485 Tele Vue (Page 2) TeleVue.com 845-469-4551
SOFTWARE Cyanogen (Page 15) Cyanogen.com 613-225-2732 Orion (Pages 21, 63) OrionTelescopes.com 800-447-1001 | 831-763-7000 Software Bisque (Page 87) Bisque.com 303-278-4478
FOCUSERS JMI (Page 64) JMITelescopes.com 800-247-0304 | 303-233-5353
CALIFORNIA
MARYLAND
OKLAHOMA
Oceanside Photo & Telescope (Page 79) Optcorp.com 800-483-6287 Orion (Pages 21, 63) OrionTelescopes.com 800-447-1001 | 831-763-7000 Woodland Hills (Page 60) WHTelescopes.com 818-347-2270
Hands On Optics (Page 50) HandsonOptics.com 866-726-7371
Astronomics (Pages 53, 60) Astronomics.com 800-422-7876 | 405-364-0858
To advertise on this page, please contact Lester Stockman at 617-758-0253, or
[email protected]
worldmags & avaxhome
Index to Advertisers Adorama . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57
Knightware. . . . . . . . . . . . . . . . . . . . . . . . . . . 82
Arctic Odyssey. . . . . . . . . . . . . . . . . . . . . . . . 83
Lumicon International . . . . . . . . . . . . . . . . . 81
Ash Manufacturing Co., Inc. . . . . . . . . . . . . 60
Meade Instruments Corp. . . . . . . . . . . . .7, 41
Astro Haven Enterprises. . . . . . . . . . . . . . . . 82
Northeast Astronomy Forum . . . . . . . . . . . . 71
Astro-Physics, Inc.. . . . . . . . . . . . . . . . . . . . . 82
Oberwerk Corp. . . . . . . . . . . . . . . . . . . . . . . . 80
Astrobooks. . . . . . . . . . . . . . . . . . . . . . . . . . . 82
Observa-Dome Laboratories . . . . . . . . . . . . 79
Astrodon . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80
Oceanside Photo & Telescope . . . . . . . . . . . 79
Astronomical Tours. . . . . . . . . . . . . . . . . . . . 64
Officina Stellare s.r.l. . . . . . . . . . . . . . . . . . . . 10
Astronomics . . . . . . . . . . . . . . . . . . . . . . . . . 53
Orion Telescopes & Binoculars . . . . . . .21, 63
Astronomy Technologies . . . . . . . . . . . . . . . 60
Peterson Engineering Corp. . . . . . . . . . . . . . 81
Atik Cameras . . . . . . . . . . . . . . . . . . . . . . . . . 17
Pier-Tech . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47
Bob’s Knobs . . . . . . . . . . . . . . . . . . . . . . . . . 80
PlaneWave Instruments . . . . . . . . . . . . . . . . 83
Celestron . . . . . . . . . . . . . . . . . . . . . .39, 50, 88
PreciseParts . . . . . . . . . . . . . . . . . . . . . . . . . . 81
CNC Parts Supply, Inc. . . . . . . . . . . . . . . . . . 81
Quantum Scientific Imaging, Inc. . . . . . . . . 54
Cyanogen . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15
Riverside Telescope Makers Conference
DiscMounts, Inc.. . . . . . . . . . . . . . . . . . . . . . 82
Santa Barbara Instrument Group . . . . . . . . 13
Dream Cellular, LLC . . . . . . . . . . . . . . . . . . . 82
ScopeStuff . . . . . . . . . . . . . . . . . . . . . . . . . . . 81
Equatorial Platforms . . . . . . . . . . . . . . . . . . . 80
SCS Astro. . . . . . . . . . . . . . . . . . . . . . . . . . . . 81
Explore Scientific LLC . . . . . . . . . . . . . . . . . . . 9
Sirius Observatories . . . . . . . . . . . . . . . . . . . 82
Finger Lakes Instrumentation, LLC . . . . . . . 47
Skies Unlimited . . . . . . . . . . . . . . . . . . . . . . . 38
Fishcamp Engineering . . . . . . . . . . . . . . . . . 82
Sky-Watcher USA. . . . . . . . . . . . . . . . . . . . . . . 5
Foster Systems, LLC . . . . . . . . . . . . . . . . . . . 80
Society for Astronomical Sciences. . . . . . . . 79
Glatter Instruments . . . . . . . . . . . . . . . . . . . 80
Software Bisque. . . . . . . . . . . . . . . . . . . . . . . 87
Goto USA, Inc. . . . . . . . . . . . . . . . . . . . . . . . 59
SpacialInfo Tech, LLC/RITI . . . . . . . . . . . . . . 82
Half Hitch Telescope. . . . . . . . . . . . . . . . . . . 83
Star GPS. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80
Hands On Optics . . . . . . . . . . . . . . . . . . . . . 50
Starlight Xpress, Ltd.. . . . . . . . . . . . . . . . . . . 52
High Point Scientific . . . . . . . . . . . . . . . . . . . 33
Stellarvue . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50
Hotech Corp. . . . . . . . . . . . . . . . . . . . . . . . . . 81
Technical Innovations . . . . . . . . . . . . . . .79, 81
Hutech Corporation . . . . . . . . . . . . . . . . . . . 82
Tele Vue Optics, Inc. . . . . . . . . . . . . . . . . . . . . 2
InSight Cruises . . . . . . . . . . . . . . . . . . . . . . . 54
The Observatory, Inc. . . . . . . . . . . . . . . . . . . 83
International Dark-Sky Association . . . . . . . 50
The Teaching Company . . . . . . . . . . . . . . . . 42
Interstellar Studios . . . . . . . . . . . . . . . . . . . . . 3
TravelQuest International . . . . . . . . . . . . . . . 83
iOptron . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11
University Optics, Inc. . . . . . . . . . . . . . . . . . 81
JMI Telescopes . . . . . . . . . . . . . . . . . . . . . . . 64
Van Slyke Instruments . . . . . . . . . . . . . . . . . 47
Kendrick Astro Instruments . . . . . . . . . . . . . 80
Willmann-Bell, Inc. . . . . . . . . . . . . . . . . .81, 82
Khan Scope Centre . . . . . . . . . . . . . . . . . . . . 82
Woodland Hills Telescopes . . . . . . . . . . . . . 60
IN THE NEXT ISSUE
Hubble at 20 The Hubble Space Telescope has transformed astronomy during its two decades on orbit.
83
Observing Planetary Nebulae The death shrouds of solar-type stars offer vivid deep-sky targets.
BOTTOM: TRAVIS RECTOR (UNIV. OF ALASKA, ANCHORAGE) / NOAO / AURA / NSF, ET AL.; TOP: NASA / ESA / MARIO LIVIO (STSCI)
Deep-Sky Discovery An amateur planetary nebula finding shows that interesting deepsky objects remain undiscovered.
The New Western Frontier An observer’s guide to some of the best astronomy hotspots in the Southwestern U.S.
SkyandTelescope.com 800-253-0245
On newsstands May 4th! Sk yandTelescope.com May 2010 85
worldmags & avaxhome
Focal Point
Constance E. Walker
Our Light or Starlight? The arc of the Milky Way seen from a truly dark location is part of our planet’s natural heritage. But with half of the world’s population now living in cities, many urban dwellers have never experienced the wonderment of pristinely dark skies and maybe never will. So, how do you explain to them the importance of what they’ve lost to artificial skyglow? How can you make them aware that light pollution is a concern on many fronts: safety, energy conservation, cost, health, effects on wildlife, as well as our ability to view the stars? How do you convince them that it’s worthwhile to take steps, even small ones, to help redress this issue? In preparing for the International Year of Astronomy (IYA2009), the Dark Skies Awareness (DSA) Working Group and I, as its chair, wrestled with these questions. (DSA was 1 of 12 global cornerstone projects for IYA2009.) Ultimately, I’ve come to think that to influence cultural change effectively — to make people literally look up and see the light — we must make children a main focus and use approaches that offer cursory to committed involvement. We must make the programs and resources as turnkey as possible, especially for educators, and provide ways to visualize the problem with simple, easy-tograsp, and enjoyable activities. As I watched IYA2009 unfold, I was astounded by the large number of people worldwide who became involved in DSA, and also by the creativity of these people. Their efforts sparked a revolution in their communities — motivated by some aspect of a DSA program but fueled by their ingenuity and sweat. In one instance, this revolution was the outcome of simply providing a dark-skies kit to a teacher in Chile, as part of a well-
ISTOCK.COM: WORLD BULB; BLACKJACK3D / BACKGROUND: SOLOLOS
Children can play key roles in raising awareness about light pollution.
organized effort through the Cerro Tololo Inter-American Observatory to work with schools in regions near astronomical sites. A book included in the kit, Bob Crelin’s There Once Was a Sky Full of Stars, struck a chord with her students. The students translated the book and made one of the best dark-skies videos from a child’s perspective that I have ever seen. You can find the video (with English subtitles) at http://is.gd/7wuvP. In another instance, creativity flew off the Richter scale. It all started with preparations in advance of last year’s
86 May 2010 sky & telescope
worldmags & avaxhome
Globe at Night campaign (www.globeat night.org), which encourages people all over the world to record and report the brightness of their night sky by matching Orion’s appearance with star maps of progressively fainter stars. One Indiana school district took this simple concept to a whole new level. Thousands of its students observed Orion from their backyards — amassing 20% of the 2009 Globe at Night data. But they did not stop there. They next asked: how much of our night sky have we lost? To find the answer, the students visualized the sky with a 3-D model of their Globe at Night sky measurements. They first stacked 35,000 LEGO® blocks to represent a pristinely dark sky in which thousands of stars could be seen, and then they took away 12,000 blocks according to their Globe at Night sky measurements. What remained corresponded to a sky nine times brighter than the truly dark ideal. The students presented their findings to local leaders and were honored for their efforts (visit www.LetThereBeNight. com for details). Countless individuals around the world have contributed toward preserving dark skies by raising public awareness, either through their own grassroots efforts or through the DSA programs, many of which will continue beyond IYA2009. Seeing their efforts bear fruit will take time, but ultimately they’ll have lasting effects. Perhaps this year you too will choose starlight over our light. ✦ An astronomer by training, Connie Walker serves as the Senior Science Education Specialist for the National Optical Astronomy Observatory in Tucson, Arizona. Learn more at www.darkskiesawareness.org.
Order Today. Yours Tomorrow.
Space waits for no one. Waiting to upgrade your observatory to join the hunt for dwarf planets, exoplanets, comets and minor planets? Or, yearning for the night your image becomes NASA’s Astronomy Picture of the Day (APOD)? That wait’s over. The Paramount ME can be yours right now. Its unrivaled precision, productivity and portability make the ME first and second choice among universities, research institutions and serious astronomers worldwide. What’s really big news, for a limited time you can receive your ME immediately.* Your dreams come true today, not next year or the year after. Because, space waits for no one and it won’t wait for you. bisque.com
robotic telescope mount Paramount ME – $14,500.00 *Guaranteed to ship within 7 days.
worldmags & avaxhome
THOUGHTFUL DESIGN, INNOVATIVE TECHNOLOGY!
CGEM Series &QP¶VNGVVJGHTGUJCVVTCEVKXGCRRGCTCPEG QHVJG%)'/OQWPVHQQN[QW6JKUU[UVGO KUFGUKIPGFVQDGCYQTMJQTUG9KVJKVU KPETGCUGFRC[NQCFECRCEKV[VJG%)'/KU ECRCDNGQHECTT[KPIQWT5%6QRVKECNVWDGU
WRVQ´ CNQPIYKVJ[QWTRTK\GF CUVTQRJQVQITCRJ[GSWKROGPVUGEWTGN[ CPFXKDTCVKQPHTGG6JGGTIQPQOKEFGUKIP KPPQXCVKXG#NN5VCTRQNCTCNKIPOGPVCPF DG[QPFOGTKFKCPVTCEMKPIECRCDKNKVKGUOCMG VJKUUGVWRRGTHGEVHQTCUVTQRJQVQITCRJ[ CUYGNNCUXKUWCNQDUGTXKPI
CGEM 1100
6QNGCTPOQTGCDQWVVJGINNOVATIVE HGCVWTGUQHVJG%)'/OQWPVXKUKVWUCV www.celestron.com MODEL %)'/ %)'/ %)'/ %)'/*& %)'/*& %)'/*& %)'//1706
ITEM#
PRICING
1 0%)+OCIG D[/CTE,QWUUGV
Q126%QTR±±YYYQRVEQTREQO Q*CPFU1P1RVKEU±±YYYJCPFUQPQRVKEUEQO Q*KIJ2QKPV5EKGPVK¿E±±YYYJKIJRQKPVUEKGPVK¿EEQO 2TKEGKUUWIIGUVGFTGVCKNKP75&QNNCTU2TKEKPIUWDLGEVVQEJCPIGYKVJQWVPQVKEG
Q5EQRG%KV[±±YYYUEQRGEKV[EQO Q#UVTQPQOKEU±±YYYCUVTQPQOKEUEQO Q1RVKEU2NCPGV±±YYYQRVKEURNCPGVEQO
worldmags & avaxhome
Q$*2JQVQ±±YYDJRJQVQXKFGQEQO Q#FQTCOC±±YYYCFQTCOCEQO Q6GNGUEQRGUEQO±±YYYVGNGUEQRGUEQO
