Wheat Structure, Biochemistry and Functionality
Edited by
J. David Schofield Department of Food Science and Technology...
62 downloads
1631 Views
16MB Size
Report
This content was uploaded by our users and we assume good faith they have the permission to share this book. If you own the copyright to this book and it is wrongfully on our website, we offer a simple DMCA procedure to remove your content from our site. Start by pressing the button below!
Report copyright / DMCA form
Wheat Structure, Biochemistry and Functionality
Edited by
J. David Schofield Department of Food Science and Technology, University of Reading, UK
RS·C ROYAl. SOCIETY OF CHEMISTRY
The Proceedings of a Conference organised by the Royal Society of Chemistry Food Chemistry Group, held on 10-12 April 1995, in Reading UK
Special Publication No. 212 ISBN 0-85404-777-8 A catalogue record for this book is available from the British Library © The Royal Society of Chemistry All rights reserved. Apart from any fair dealing for the purpose of research or private study, or criticism or review as permitted under the terms of the UK Copyright. Designs and Patents Act. 1988, this publication may not be reproduced. stored or transmitted. in any form or by any means, without the prior permission in writing of The Royal Society of Chemistry. or in the case of reprographic reproduction only in accordance with the terms of the licenses issued by the Copyright Licensing Agency in the UK, or in accordance with the terms of the licenses issued by the appropriate Reproduction Rights Organization outside the UK. Enquiries concerning reproduction outside the terms stated here should be sent to The Royal Society of Chemistry at the address printed on this page. Published by The Royal Society of Chemistry, Thomas Graham House, Science Park, Milton Road, Cambridge CB4 OWF, UK For further information see our web site at www.rsc.org Printed by MPG Books Ltd, Bodrnin, Cornwall, UK
Preface
In 1985, John Blanshard, Peter Frazier and Terry Galliard organised a highly successful international conference on behalf of the Royal Society of Chemistry's (RSC) Food Chemistry Group on the "Chemistry and Physics of Baking". The proceedings of that conference, which those organisers edited, were published under the same title by the RSC. A similar conference was not repeated in the UK until in 1995 the "Wheat Structure, Biochemistry and Functionality" conference was organised in Reading, albeit with a slightly different focus. During the intervening 10 years, substantial progress was made in our understanding of the structural, compositional and physicochemical factors that determine wheat's technological quality for flour milling, for the production of bread, biscuits, pasta and other products, and for other end uses. Significant gaps remain to be filled even now, but it was felt that, 10 years on from the "Chemistry and Physics of Baking" meeting, it would be valuable to bring together an international audience, both of established experts and of scientists new to the area, to review progress and hopefully to identify ways forward. Those then were the aims of the Reading conference, which was again organised by the RSC Food Chemistry Group, and, thus, of this book, which represents its proceedings. Progress in any scientific area is dependent on committed people with good ideas, but also, importantly, on the availability of effective experimental techniques and approaches, which can be used to tease out the information required. In his excellent and thought provoking introductory chapter, which represented the plenary lecture for the conference, Colin Wrigley, one of the undoubted leaders in this field for many years, imaginatively reviews the impact that older and more recent techniques and approaches have had in helping us to advance our understanding of structure-function relationships. In fact, this is a recurrent theme in the various sections of the book. The chapter also contains some timely reminders, not only of the great strides that have been made, but also of some of the pitfalls that await both the researcher carrying out the work and those who come along after and try to build on earlier 'discoveries' if a careful and critical approach is not adopted. The first section of the book deals with macroscopical and microscopical aspects of wheat grain structure. Here, application of newer techniques, such as image analysis for morphological characterisation, fracture mechanics approaches, and newer sample preparation techniques for electron microscopy, are helping to provide new insights into grain structure and relationships to technological properties. Undoubtedly, the greatest research activity over the past two decades has been in determining the structural, physicochemical and genetical characteristics of wheat proteins, in particular the gluten proteins, and in defining how such properties relate to the functionality of those proteins in bread making in particular, but in other applications also. The next three sections contain chapters that describe progress in understanding the structural features of the gluten proteins and relationships to functional properties, such as rheological characteristics, in defining relationships between genetical differences in polypeptide structure and composition and quality indicators, and in demonstrating how molecular biology and genetic engineering approaches can help to answer questions about structure-function relationships amongst the gluten proteins.
vi
Wheat Structure, Biochemistry and Functionality
But the gluten proteins of wheat, although extremely important, are not the only components of the wheat grain that have potentially important effects on the functionality of dough or batter systems. The chapters in the section of the book dealing with low molecular weight sulphydryl compounds examine how redox compounds, such as glutathione, may have significant effects on flour functionality, and they offer experimental approaches for tackling the complex question of the involvement of redox phenomena in flour and dough technology. Similarly, the polar lipid components of flour have potentially important roles, and there interaction with relatively recently discovered lipid binding proteins is of considerable technological importance. Recent progress in this area is dealt with in the next section, and the functionality of added emulsifiers, which to some extent simulate the actions of the natural polar lipids, is also considered. Rheology is often said to provide a link between understanding of structure at the molecular level and technological performance in the bakery. The next section contains several chapters that consider experimental approaches for characterising the rheological properties of dough systems under relevant conditions of shear rate and strain, and, in particular, how those properties relate to gas cell stability in bread doughs. The final section contains several contributions that deal with the importance of the non-starch polysaccharides, particularly the arabinoxylans, in flour and baked product systems, and, in particular, the effects of enzymes on those arabinoxylans that provide novel ways of improving baking performance. For a book such as this, which gathers together offered contributions from a conference, it is difficult to achieve complete and well-balanced coverage of the overall subject area. Likewise, styles of individual contributions may vary considerably. Nevertheless, it is hoped that this book provides an overview of the progress that has been made to date in some important areas and provides insight into some of the newer approaches that may be used in future to solve outstanding problems.
J. D. Schofield
Contents
Windows on Wheat Quality: Fresh Insights and Their Dependence on New Research Technologies C. W Wrigley and F. Bekes
Grain Structure and Quality Grain Size and Morphology: Implications for Quality A . D . Evers
19
The Shape of the Wheat Kernel and its Influence on Fracture J. F. V. Vincent, A. A. Khan and J.-H. Liu
25
Ultrastructure and Technological Properties of Wheat E. Quattrucci, L. A. Pasqui and J. Fornal
31
Microscopical Methods for the Study of Wheat (Triticum aeslivum) Caryopsis Development, from Anthesis to Maturity G. D. Lunn, P. Echlin, P. J. Frazier and N. W R. Daniels Effects of Variable Environment on Wheat (Triticum aestivum) Caryopsis Protein Body Morphology and Protein Matrix Development During Grain Filling and Dehydration G. D. Lunn, P. Echlin, P. J. Frazier and N. W R. Daniels
37
44
Wheat Protein Structure and Functionality The Structures of Wheat Proteins A. S. Tatham
53
Disulfide Bonds of a- and y-TypeGliadins H. Wieser and S. Muller
63
Purification and Characterisation of lBx and IBy HighM,Glutenin Subunits from Durum Wheat Cultivar Lira F. Buonocore, C. Caporale and D. Lafiandra
70
Further Analysis of the Carbohydrates Associated With HighM, Subunits of Wheat Glutenin K. A. Tilley and J. D. Schofield
74
Presence ofGlycosylated Polypeptides inGliadin andGlutenin Fractions M Lauriere, I Bouchez, C. Doyen and G. Branlard
79
viii
Wheat Structure. Biochemistry and Functionality
Identification of Dimers Formed by the Low Molecular Weight Glutenin Subunits Belonging to the D Group S. Masci, T. A. Egorov, D. D. Kasarda, E. Porceddu and D. Lafiandra
85
Composition and Structure of Gluten Proteins A. Graveland, M H. Henderson, M Paques and P. A. Zandbelt
90
Time-Temperature Superposition for Networks Formed by Gluten Subfractions A. Tsiami, A. Bot, W. G. M Agteroj, A. Graveland and T. Henderson
99
The Role of Gluten in the Heat-Induced Changes that Occur in Dough Rheology During Baking A. Nakonecznyj, S. J. Ingman and J. D. Schofield
106
Biochemical Characterisation of Wheat Flour Proteins Using Gel Chromatography and SDS-PAGE E. L. Sliwinski, T. van Vliet and P. Kolster
112
Wheat Protein Composition and Quality Relationships Structural Differences in Allelic Glutenin Subunits of High and Low Mr and Their 117 Relationships with Flour Technological Properties D. Lafiandra, S. Masci, R. D 'Ovidio, T. Turchetta, B. Margiotta and F. MacRitchie Capillary Electrophoresis: A State-of-the-Art Technique for Wheat Protein Characterization J. A. Bietz, G. L. Lookhart, S. R. Bean and K. H. Sutton
128
Electrophoretic and Chromatographic Characterization of Glu-AI Encoded HighMr Glutenin Subunits B. Margiotta, M Urbano, T. Turchetta and G. Colaprico
134
HMW and LMW Subunits of Glutenin of Triticum tauschii, the D Genome Donor to Hexaploid Wheat M C. Gianibelli, R. B. Gupta and F. MacRitchie
139
Relationships Between Biochemical Parameters and Quality Characteristics of Durum Wheats M C. Gianibelli, M Ruiz, J. M Carillo and F. MacRitchie
146
Effects of the lBLlIRS Translocation on Gluten Properties and Agronomic Traits in Durum Wheat G. Boggini, P. Tusa, S. Di Silvestro and N. E. Pogna
153
Durum Wheat for Bread Making: Relationships Between Protein Molecular Properties and Technological Parameters M Carcea, N. Guerrieri and L. A. Pasqui
160
Contribution of the Hordeum chilense Genome to the Endosperm Protein Composition of Tritordeum J. C. Sillero, J. B. Alvarez and L. M Martin
167
Gliadin Components and Glutenin Subunits in Wheat Breeding A. 1. Abugalieva
173
Contents
ix
Gliadin and High Molecular Weight (HMW) Glutenin Subunits in the Collection of Polish and Foreign Winter Wheat Cultivars and Their Relation to Sedimentation V��
lW
Pathogenesis-Related Proteins in Wheat
184
Investigation of Hypersensitivity to Wheat Gliadin from Gluten-Free Dietary Products UsingDot-Blot Assay
189
The Brewing Value and Baking Qu�ity of Polish Winter Wheat Cultivars
192
J. Waga and J. Winiarski
C. Caruso, G. Chilosi, C. Caporale, F. Vacca, L. Bertini, P. Magro, E. Poerio And V. Buonocore
l. M Stankovic, /. Dj. Miletic and V. D. Miletic
J. Winiarski and J. Waga
Wheat Protein Molecular Biology and Genetic Engineering
Wheat Protein Molecular Biology and Genetic Engineering: Implications for Quality Improvement
199
The Use of Biotechnology to Understand Wheat Function�ity
206
P. R. Shewry, A. S. Tatham, J. Greenfield, N. G. Halford, S. Thompson, D. H. L. Bishop, F. Barro, P. Barcelo and P. Lazzeri
A. E. Blechl and O. D. Anderson
Construction ofDx5 Genes Modified in the Repetitive Domain and Their Expression in Escherichia coli 211 R. D 'Ovidio, 0. D. Anderson, S. Masci, J. Skerritt and E. Porceddu
coli for Biophysical Studies J. J. A. Greenfield, L. Tamas, N. G. Halford, D. Hickman, S. B. Ross-Murphy, S. Ingman, A. S. Tatham and P. R. Shewry
Expression of Barley and Wheat Prolamins in E.
215
Low M. Sulphydryl Compounds in Wheat Flour and Their Functional Importance
Measurement and Reactivity of Glutathione in Wheat Flour and Dough Systems
221
Determination of Low Molecular Weight Thiols in Wheat Flours and Doughs
235
J. D. Schofield and X Chen
B. Hahn, R. Sarwin and W. Grosch
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
Wheat Lipids and Lipid-Binding Proteins: Structure and Function
245
Starch Lipids, Starch Granule Structure and Properties
261
D. Marion and D. C. Clark
W. R. Morrison
Wheat Structure, Biochemistry and Functionality
x
Monoclonal Antibodies Against Wheat Glycolipids: New Tools to Investigate Mechanisms of Gas Retention in Bread Dough
271
Aspects on the Functionality ofDATEM in Breadmaking
279
Chang:�s of Wheat Flour Components Induced by Bread Improver
286
Z Gan and J. D. Schofield
N. C. Carr and P. J. Frazier
M Soral-Smietana, M Rozad and A. Cielem�cka
Rheological Properties and Functionality of Wheat Flour Doughs
Experimental and Conceptual Problems in the Rheological Characterization of Wheat Flour Doughs
295
Physical Factors Determining Gas Cell Stability in a Dough During Bread Making
309
Strain Hardening and Dough Gas Cell Wall Failure in Biaxial Extension
316
Stress Relaxation of Wheat Flour Doughs Following Bubble Inflation or Lubricated Squeezing Flow and Its Relation to Wheat Flour Quality
323
Gluten Microstructure and Changes in Hard Biscuit Doughs as Determined by Light Microscopy and Rheology
332
E. B. Bagley, F. R. Dintzis and S. Chakrabarti
T. van Vliet
B. J. Dobraszczyk
J. C. Bartolucci and B. Launay
A. Jurgens, T. V. P. Maarschalkerweerd, J. F. C. van Maanen and W. J. Rottier
Non-Starch Polysaccharides and Enzymic Improvement of Bread Quality
The Effects ofXylanases in Baking and Characterization of Their Modes of Action
343
Peroxidases in Breadmaking
350
A Method for Testing the Strengthening Effect of Oxidative Enzymes in Dough
361
Arabinoxylan in Wheat Flour Milling Fractions
368
Wheat Dough Properties Affected by Additives
371
Subject Index
377
T. S. Jakobsen and J. Qi Si
M van Oort, H. Hennink, P. Schenkels and C. Laane
P. Bak, I. L. Nielsen, H. Thogersen and C. H. Poulsen
R. Andersson and P. Aman
E. Torok
Acknowledgements
It is a pleasure to acknowledge the financial support given to this conference by the following companies. Their donations provided grants to enable a number of delegates, especially those from former Eastern bloc countries, to attend the conference: Allied Bakeries Ltd Dalgety PLC Kellogg Company of Great Britain Ltd Northern Foods PLC PBI Cambridge Ltd United Biscuits (UK) Ltd Weetabix Ltd
WINDOWS ON WHEAT QUALITY: FRESH INSIGHTS AND THEIR DEPENDENCE ON NEW RESEARCH TECHNOLOGIES
C. W. Wrigley and F. Bekes CSIRO Division of Plant Industry Grain Quality Research Laboratory North Ryde (Sydney) NSW 2113 Australia
1 INTRODUCTION Research advances in the elucidation of wheat quality have involved the opening of a series of windows to gain new insights into our understanding of composition-function relationships with respect to the wheat grain, dough and baked products. The opening of these windows has often involved the application of a new technique, or perhaps a new approach has been used in asking an old question. For example, one hundred years of advances in methods of protein composition/function analysis (and the opening of many new windows) have changed our view of gluten-p'rotein composition. As a result, there is a great contrast between Osborne's modee of only two protein components (gliadin and glutenin) and the current view of gluten as a complex of many polypeptides interacting via covalent and non covalent bonds to constitute a vast macro-molecular matrix. Many windows have been used to provide these new insights, such as dough-testing methods, gel electrophoresis in various forms (one- and two-dimensional) and chromatographic methods (most recently size-exclusion and reversed-phase HPLC). New insights are promised with the introduction of further techniques, including capillary electrophoresis, flow field-flow fractionation, immunoassay and a range of gene technologies. 2 METAPHORS: WINDOWS, HOUSEHOLDS AND COMMUNITIES 2.1
Looking in at Windows
Have you gone for a walk on a hot summer evening past houses with the windows wide open? Your don't mean to pry, but you can see in at the windows - someone watching the news on television, someone else writing at a desk, a family at the evening meal. Through another window you see someone reading, a student doing homework, a group playing cards. A glance in each window of the house will give a little more information about the household - how many people in the family, their interests (what television sessions are watched, what books are read), a look into the kitchen and dining-room windows will tell us their eating habits. All these glimpses through windows should enable one to build up an integrated profile on the family'S characteristics. Do this for many households and one should be able, in turn, to obtain a profile of the community (Fig. 1), though it would be important to do so for a representative population of households. This information-gathering activity might involve more than peaking in at windows around a house. Other "windows" available include less obvious opportunities, such as the phone (what is said to whom), the family'S balance sheet from the bank, mail, credit card
N
file
VVindovvs on VVheat Qualit
Qptions Window
t!elp
�
Em.rglng method,
Microscopy
u
barl.�8Hmpl'
I!UI Figure 1
ulations
CU�r.����1S
D Oarius
cr;:::;
W.flgal and ;',.nd.
� �
� �
��!.
�
Micro douglHesl
I!�!I
M��:�:�O�d
�S!!
Windows on wheat quality - seen both as a metaphor ofglimpses through the windows ofa household or a community, and as the succession ofpieces of data provided by a Windows system computer. Such windows of observation on wheat quality include groups of techniques, applied to various populations of wheat samples, with computer assistance in interpretation of the resulting data.
�;::
-�
I:!l
J !:;.
�
�
�
2.. §
�
3
Wheat Structure. Biochemistry and Functionality
accounts, and the bills that come in. In a similar manner, our investigations of flour composition and function must involve a range of approaches ("windows") - microscopy, protein extraction and fractionation, composition analysis, functionality testing - each in tum on a diverse population of samples, trying to make consistent sense of the various pictures seen through those various windows. However, with both of these scenarios, there is the likely problem that we will obtain a fragmented view depending on what windows we look through and when. The conclusions will also depend on how many households or samples we examine. 2.2
Possible Misconceptions
For example, if we look through the bedroom window and see the daughter of the family doing her French homework, we might conclude (incorrectly) that this a French speaking family. If our observation of the family meal happens to be on Christmas day (windows open for summer in Australia), we would conclude (probably incorrectly) that this is an extravagant family of gluttons. In observing a casual game of cards, we may draw conclusions about the group being a gang of gamblers. Our glimpse of someone watching the news on television may lead to the conclusion that he is vitally interested in current affairs, unless we look closely enough to see that he is asleep. The reliability of our conclusions is thus limited by the resolution of our methods of observation and by their frequency. Observations made must be made at many windows on many occasions to obtain a representative and reliable impression of the family. For the same reasons, the compilation of a representative picture of a community requires many observations at the windows of many houses, with intelligent integration of all these glimpses, bearing in mind the limitations of drawing conclusions from the view available at any window.
2.3
Making Good Use of Windows on Wheat
There has been a century of "modem" observation of wheat structure, biochemistry and functionality, the focus of this book. Progressively, new windows have been opened through which we have been able to make fresh observations. So often, we have obtained isolated glimpses that have, in tum, seemed to yield inconsistent and fragmented information. For example, conflicts and misconceptions have arisen when conclusions have been based on statistical observations of limited national sets of cuItivars. Attempts to reconcile the disparate information due to genotype versus environment provide recurring examples of these dilemmas. It is the function of a book such as this to help us to broaden our views on the range of windows available to us and to realise the importance of extending the population of windows through which we seek information.
3
TECHNIQUES
Can we correctly integrate all this information, bearing in mind the limited view provided by each window? What are some of these windows on wheat composition and function?
3.1 Microscopy
2
"What is unique about wheat gluten?" was the question posed by Eckert et al. at the latest International Workshop on Gluten Proteins. It is a recurring question. These authors addressed it by microscopy, observing the differences in the behaviour of flour particles from various grains upon wetting. Rye, barley and com contained insoluble protein that formed "network-like structures filling the space between the starch granules", but wheat flour alone provided a dough that had the "elasticity and aggregation behaviour" needed to hold growing gas cells during fermentation and oven rise. In a companion pape�, they reiterated the long-standing hypothesis that these gluten-specific characteristics are due to
Wheat Structure, Biochemistry and Functionality
4
the unique combination of gliadin and glutenin, "gliadins existing as monomers imparting viscosity to dough whereas the glutenin fraction is responsible for dough strength and elasticity". These observations reinforce the dramatic video sequences and the micrographs published by Bernardin and Kasarda4 showing how eagerly gluten fibrils form when wheat flour particles are wetted. 3.2
Protein Fractionation
3. 2. 1 Fractional Extraction. Centuries ago, the discovery that gluten could be washed from dough opened up a window on the nature of proteins themselves, the word "protein" being more recently devised than "gluten"s. The distinction between gliadin and glutenin as the two major components of gluten! provided an initial means of attempting to relate composition to function, but this window proved to be particularly blurred. Several research groups around the world (American, Australian, English, French) late last century used the Osborne procedure of fractional extraction to characterise various wheat-flour samples, obtaining results varying from 22% to 80% for the proportion of gliadins. The Australian Guthrie6 embraced the method enthusiastically, applying it to a range of flour samples, initially claiming success in reporting6 a positive relationship between glutenin content and dough strength (defined as water absorption) for tabulated results, which look less convincing when tho/ are treated graphically (Fig. 2) and statistically. With further experimentation, Guthrie finally concluded that this relationship "is not as simple as I at first thought; nor is the separation and accurate determination of the two proteins quite satisfactory. This method has, therefore, been abandoned in this laboratory". Though this
60 I:
CI)
'550 " -
r
D
0.66
I:
.-
c 40 'C as .-
.-
" 30 tI.
20 40
•
D D
•
•
50
60
70
Strength Figure 2
An early attempt (1896) to explain gluten strength (here measured as water absorption) as ajunction of the proportions ofgliadin and glutenin in gluten. The original resulti were tabulated, not statistically analysed, yet a relationship was claimed
Wheat Structure, Biochemistry and Functionality
5
method of protein fractionation may today be regarded as "bucket chemistry", Osborne's method and nomenclature have stood the test of a century of criticism, although many authors have variously redefined the terms gliadin and glutenin.
3.2.2 Gel Electrophoresis. A succession of gel electrophoretic methods opened up a vista of seemingly endless degrees of heterogeneity for Osborne's two fractions from gluten. Electrophoretic methods, first in starch gels, then in polyacrylamide, and later combined two-dimensionally with isoelectric focusing, have revealed gliadin to be a complex mixture of monomeric polypeptides, coded by genes on the short arms of group 1 and 6 chromosomes8. Gel electrophoresis in the presence of sodium dodecyl sulfate (SDS)9 opened an important window on the mysteries of the glutenin complexlO, particularly after the incorporation of methods to exclude non-glutenin protein from the patternll. Although the necessary rupture of disulfide bonds also destroys some of the function-composition information, the resulting classification of high M,9,1O,12 and low M,ll polypeptides of glutenin has led to important relationships, permitting the prediction of genetic potential for dough properties. 3.2. 3 High Performance Liquid Chromatography (HPLC). Whilst not replacing gel electrophoresis, reversed-phase HPLC has provided a valuable alternative means of defining the compositions for gliadin and for low and high M, glutenin polypeptides 12-14 and thus of predictin��enetic potential for dough-forming properties. Change the column type to size exclusion 7 and a molecular-size profile is provided, promising more reliable prediction of dough properties for the combined effects of genotype and environmental factors, especially if the methodology can be made to accentuate the larger-sized aggregates of gluten proteinsls-17. -
3.3
Emerging Methods
3.3. 1 Size Distribution Analysis. Indications from size-exclusion HPLC of the importance of very large glutenin aggregates have stimulated attempts to extend the analysis of size distribution into the millions of molecular weight. Two such "emerging" methods are multilayer SDS-gel electrophoresisl8,19 and flow field-flow fractionation . (FFF)20 21. The former involves conventional SDS electrophoresis in a series of layers of gel, increasing in polyacrylamide concentration in steps - 4, 6, 8, 10, and 12%T. The extent of staining in the respective gel layers provides quantitative indications of gluten protein content in size classes well over 100,000 in size. Difficulty in obtaining suitable standard proteins in the very large size ranges has so far precluded satisfactory calibration of the method. Nevertheless, our surveys of size distribution for various sets of wheat samples reinforce the likelihood that it is the very large aggregates of glutenin that are most effective in providing dough-strength properties (defined, for example, as resistance to extension in the Brabender Extensograph). FFF, on the other hand, is theoretically an absolute method, permitting size-distribution measurements up into particle-size ranges20. Figure 3 illustrates some of the potential of this method to distinguish between the various sizes of gluten proteins21. 3.3.2 Capillary Electrophoresis (CE). This method appears currently to be revolutionising protein and polypeptide analysis in general. According to Breliminary reports, it promises to offer advantages for wheat-protein analysis, for gliadins -24 and for glutenin polypeptides23. Figure 4 shows how CE profiles can be obtained in less than ten minutes to provide rapid varietal identification based on gliadin composition with considerable discrimination, three of the varieties shown in Figure 4 being indistinguishable by conventional acidic-gel electrophoresis. 3.3.3 Immunoassay. The specificity of antibodies in their ability to target defined amino-acid sequences (epitopes) offers the possibility of simplified mass screening of flour
6
Wheat Structure, Biochemistry and Functionality
o
8
16
24
32
40
2
3
4
5
48
Stokes' diameter (nm)
:Ii:
N
«
o Figure 3
6
Time (min)
The application of flow field-flow fractionation20 to provide size-based separation of wheat-grain proteins. Three fractions (obtained by low-pH solvent fraction) were analysed seJXl..rately (Fractions 1, 5 and 8) giving very different size-distribution profilell (reproduced with permission from Gustavsson et al.21)
samples for appropriate quality-related structures in the gluten proteins, taking advantage of methodology devised for medical diagnostics. Some examples of this approach have involved the raising of antibodies directed towards specially synthesised peptides, representing specific gluten proteins2s. Alternatively, combinations of extraction conditions, antibodies and delivery systems have been sought that would provide correlations to specific quality attributes, particularly to screen for dough strength26
(primarily based on Extensograph height, Rmax). Detection, in turn, of the epitopes identified by the strength-relevant antibodies27 reinforces evidence28 that the �-spiral conformations of the high Mr glutenin polypeptides are important for dough properties.
3.3.4 Genetic Probing Methods. Results such as these, indicating amino-acid sequences, are vital steps towards the obvious progression from the identification of functional groups in proteins to the isolation of corresponding quality-related genes. Intermediate in this process is the use of this information to probe at the gene level for nucleotide sequences relevant to quality. For example, restriction fragment length polymorphism (RFLP) procedures and probes have been described for identification of Glu-l alleles using leafDNA!O,29. In addition, the wide range of gene-grobing techniques are also valuable tools for discriminating identification of cereal varieties o. 3.3.5 Expressing and Modifying Genes. The isolation and characterisation of genes is, in turn, only a means to ultimate goals of modifYing the genes in a beneficial way and using them to improve grain quality through transformation3!. Intermediate goals involve discovering more about the aspects of protein composition that affect functional properties, and possibly finding that these properties are already available in natural germplasm stocks.
Wheat Structure, Biochemistry and Functionality
7
3.0 2.5
§.
0 0 N
ai
(J s:;; ca .c
... 0 1/1 .c « III > '';::
2.0 1.5 1.0
ca
Qj 0:::
0.5 0.0 2
4 Time, min
Figure 4
Profiles ofgliadin composition for four American wheat cultivars obtained b.y capillary electrophoresis by the method of Lookhart and Bearl2• (reproduced with permissionfrom Lookhart and Wriglej4)
The molecular-biology approach involves expressing the respective gene (native or modified) in a heterologous system, such that the functionality of the expressed polypeptide can be tested, and proceeding to show that the gene can be introduced into the target plant, with the desired functional properties being contributed in the grain. Progress to this end has been demonstrated by the expression, in tobacco, of modified glutenin genes lacking a cysteine residue32. In this case, the degree of aggregation of the modified polypeptides could be tested, but not the functional properties in dough. It has thus been important to develop a system for doing so in order for the contributions to dough properties to be evaluated for minute amounts of purified or expressed polypeptides. 3.4
Micro Dough Testing
The development of very small-scale tests for functional properties has permitted the direct evaluation of very small samples of purified or expressed Erotein samples, which was not previously possible. Use of the direct-drive Mixograph for this purpose has generally confirmed hypotheses about the relative contributions to dough properties of specific gliadins and glutenin polypeptides34. All gliadin polypeptides tested contributed a
8
Wheat Structure, Biochemistry and Functionality
weakening effect to dough, measured as a considerable shortening of time to peak mixing resistance (as shown in F ' but also as decreased peak resistance and faster resistance breakdown after the peak '. For the gliadins, the results were essentially the same whether or not a partial oxidation-reduction cycle were used35; it was therefore not applied routinely for gliadins. Simple addition of glutenin subunits (high or low Mr types) also produced a weakening effect, similar to that caused by the gliadin addition or incorporation. The strength-conferring properties of the glutenin polypeptides could only be demonstrated if they were incorporated into the disulfide-crosslinked gluten matrix by the partial reduction and re-oxidation of disulfide bonds35 Figure 6 shows that purified (native) polypeptides of glutenin behaved similarly in dough to the corresponding polypeptides expressed in a bacterial system34a. Furthermore, their individual contributions to dough strength (shown as an increase in the mixing time of the base flour of 1 80 sec) were generally proportional to their size. There was a statistically significant difference between the increases in mixing time due to the incorporation of subunits 2 and This may be due to the higher proportion of cysteine residues in subunit than in subunit 2, rather than the size differencelO Figure 6 also shows the contributions of the low M, subunits (from three sources) after they had been incorporated into the dough matrix by partial reduction and re-oxidation of disulfide bonds35. Their shorter length presumably accounts for their proportionately lower contribution to dough strength.
W 5),
•.
5
5.
2 5 0 ,-------,
200
u CD
!!.150 CD
E i=
C)
.!: 100 ><
:i
50
o
Figure 5
control
alpha
beta
gamma
omega·1
omega·2
Contributions to dough properties (as time in seconds to peak in the Mixograph33) by gliadin fractions (6 mg in each case, purifiedfrom Chinese Sprin� wheat) added to dough (from 2 g flour) using the procedure oj Bekes et al. .
9
Wheat Structure. Biochemistry and Functionality 400 .---------------------()�5�+-1�0�---------------, ()2+12 350 ,....., (/J
"; 300 e
20•• 7
E=: 250 ell
. 10 f:::. 111L • 1� 12,
...I:� ... � 200
150
100�. 30
�
�--_r----._--_r----,_--_,----,_--_,--
40
50 60 70 80 90 100 lVIolecular VVeight [kD]
110
120
Figure 6 The relationship ofpolypeptide size (as Mr) to change in dough strength (as time in seconds to the peak in the Mixograph33) due to the incorporation into dough of the respective glutenin polypeptide (5 mg each into 2 g flour) by the method of Bekes et aI.34• The baseflour had a mixing time of 180 s and was different from that usedfor the experiments shown in Figure 5. High Mr subunits (numbered appropriately) are indicated by squares (purified), by triangles (gene-expression products) or by hexagons (where two subunits (2. 5 mg of each) were incorporated together). Low Mr subunits (as pentagons) were purified (separately) from flour of the cultivars Rosella, Chinese Spring or Gabo. These data are the result of collaborations involving Drs O. D. Anderson (USDA, Albany, USA), R. B. Gupta (CSIRO, Canberra, Australia), D. Lafiandra (University of Tuscia, Viterbo, Italy), P. 1. Payne (PBI Cambridge Ltd, UK), 1. H Skerritt (CSIRO, Canberra, Australia) and A. S. Tatham (IACR-Long Ashton Research Station, University of Bristol, Long Ashton, UK).
4
POPULATIONS
The above enumeration of major "windows" through which to picture wheat quality attributes is not complete without a description of the ways in which they must be used for valid conclusions to be drawn. Just as the formulation of a generalisation about the profile of a community requires the observation of many households, so also the development of valid conclusions about wheat quality requires analysis of appropriate populations of wheat samples. This need can first be illustrated by the use of an inappropriate sample set. 4.1
Very Heterogeneous Samples
/
Such an example is a sample of barle 6 stored since 1877 in a sealed bottle in the University of Agronomy of Vienna. Analysis of 44 of the seeds by pH 3-gel electrophoresis showed that there were at least 26 different biotypes present, as combinations of 8 high-Mr and 14 low-Mr hordein patterns in frequencies from 1 to 5 seeds having any one of the 26 combinations. Study of a heterogeneous sample as this would be
10
Wheat Structure, Biochemistry and Functionality
impossible if the aim were to relate composition to a functional attribute of the sample overall. 4.2
National Cultivar Sets
Generally, such extreme problems of sample heterogeneity are not encountered in the most commonly studied sets of samples, namely, national sets of cultivars. Nevertheless, the possibility of polymorphism and sample mixing are major aspects to check in such a study. National sets of cultivars have frequently been the focus of attempts to relate glutenin composition to quality attributes, to the extent that international databanks of gluten-allele information have been set up, initially to facilitate this type of study, and also to make use of appropriate parent materiae1. Conclusions about the reliability of the Payne Glu-l quality score38 to predict dough strength (or baking quality) have varied considerably, depending on which of various national sets of cultivars has been examined (see review by MacRitchie et al.39). In an analysis of 84 British wheats, 67% of the variation in. breadmaking quality could be accounted for using the scoring system, adjusted for the influence of rye in translocation lines. In contrast, poor relationships to dough strength (as Rmax) were given by the Glu-l score for 102 Australian wheats3 , with only 15% of the variation being accounted for40. These conflicting results are probably due to the very different parental lines used in the breeding programs of these two countries, and most importantly on the different contributions to do�h properties of other classes of polypeptides, particularly the low M, glutenin subunits39• . In fact, consideration of both high and low M, groups of glutenin subunits greatly improved the predictability relationship for the set of Australian wheats40. This contrast had earlier led to conflicting reports in the literature about the relative contributions of the gliadins and glutenins to dough properties41•42. Similar contrasts have been reported for various sets of cultivars39 In view of the great reliance of the results of such surveys on the genotype set, our more recent studies have included a collection of cultivars from around the world43, chosen to provide a range of genetic backgrounds and quality characteristics. Application of the Glu-l score system to this World set again indicated its predictive value, and the need to have a representative population of genotypes when drawing conclusions about composition-quality relationships. Many of the genotypes in this ' World' set were included in a survey of the content of very large glutenin aggregates by multi-layer SDS gel electrophoresisl9. The results of this method provided good predictability of dough properties for many of the World set of cultivars, with a correlation coefficient of 0.85 relating Rmax to the proportion of the largest size of aggregate (unpublished results). 4.3
Warigal and Friends
The reliability of the Glu-l quality score has been shown most clearly when it is tested in comparisons not disguised by other aspects of protein composition. This has been shown, for example, for isogenic lines, biotypes and sister lines. Such examples are provided44 for pairs of biotypes of the Australian cultivars Warigal (also the name of a native Australian dog, thus the icon in Fig. 1), Lance and Avocet. The Glu-Dld (subunits 5+10) biotypes were consistently stronger in dough properties (longer Mixograph development time), with a greater proportion of very large glutenin aggregated protein, compared to the biotypes with the Glu-Dla alleles (subunits 2+12). 4.4
Darius
Despite these and many other indications of the predictive value of the Glu-D1 locus, there are contrasting examples, such as the French cultivar, Darius4s. This wheat has very good breadmaking quality but some of the "poorest-quality" Glu-l alleles, namely:- null, subunit 7 and subunits 2+12, giving it a Glu-l quality score of only 4 (minimum of 3;
11
Wheat Structure, Biochemistry and Functionality
maximum of 1 0). To resolve this apparent anomaly, Branlard and Dardevet4� crossed Darius to three cultivars of poor, medium and good baking quality. They found that poor quality in the progeny followed the "poor" Glu-1 alleles of Darius, thus vindicating the Glu-1 quality score, but again showing its limitations. They showed that the superior quality of Darius could be attributed to (a) its null allele at the GIi-D1 locus (leading to the absence of corresponding co-gliadins), and (b) an increased proportion of low M, subunits of glutenin. What if Darius had been the first or only "window" that cereal chemists had looked at? The conclusions about composition-quality relationships would be very different from what they are now. Nevertheless, the "Darius window" opens, in turn, new possibilities about the importance of gliadin alleles for further examination in a wider population of genotypes.
4.5
Genetically-defined Grain Samples
4.5.1 Isogenic and Sister Lines, Segregating Populations. Some of the examples above illustrate the need for a thorough understanding of the genetics of the wheats being examined. Thus, many studies of composition-quality relationships have focused on genotypes designed specifically to examine this topic. The most reliable, probably, are isogenic lines in which (theoretically) the genetic background is uniform except for the aspect of genotype under study. This ideal situation is approximated in sister lines from the same cross if they are selected appropriately at late generation. Warigal and friends (above44) provide cases of this approach. Analysis of quality and composition for individuals in a segregating population can also ,erovide a valuable window on these relationships (the approach taken to study Darius4 ). The value of these approaches also lies in the similarity they bear to the practical task of selecting for quality in a breeding program46• 4.5. 2 Null Lines. The availability of lines with null alleles for defined loci offers another
powerful window on composition-quality relationshipsI7,47,48. The Darius study (above4�) illustrates this for the commonly occurring null allele Glu-A1 c. Multiple null alleles have been produced b� crossing for a wide range of highM, glutenin subunits47,48, and also for lowM, subunits4 , leading to the conclusion that all these alleles are of critical importance to dough properties, although it was possible for aggregated glutenin to be formed from all high M, or all lowM, subunits. Removal of highM, glutenin subunits one allele at a time (Fig. 7) has increasingly great consequences for dough strength (measured in this case as Rmax, the height of an Extensogram). Figure 7 also shows that there is a corresponding decrease in the proportions of the very large aggregates of utenin, measured as the two largest fractions separated by multi-layer gel electrophoresis ,19. It may be significant that the double-null line still carrying the G1u-D1 allele is stronger than the other two double null lines, with a higher proportion of very large glutenin.
%l
4.6 Environmentally-Defined Grain Samples Variations in growing and storage conditions are a potential cause of quality changes that may be mistaken for genetically based changes. There is thus a need for better understanding of these non-genetic sources of quality variation, including the interactions between genotype and environment.
4.6. 1 Fertiliser Application. Concern to maintain or raise yield and protein levels in grain
have led to increasing applications of nitrogen fertilisers, often in forms lackin� sulfur, with the result that sulfur has become limiting - with implications for grain quality O-�2. Lack of sulfur has been shown in field experiments to lead to an imbalance of flour-protein composition, with higher proportions of sulfur-poor proteins, particularly the co-g1iadins51 but also the highM, glutenin polypeptides�2. These observations provide opportunities for
12
Wheat Structure, Biochemistry and Functionality
Rmax
ABD
382
305
180
+, - ,
80
+,+, -
,
110
- ,
100
80
o
Figure 7
5
%
W
U
W
�
Large polymers (t1
� +
�
t2)
�
60
Proportions of very large glutenin polymers (first two area segments from multilayer gel electrophoresis - t I + t2) in flour sample milled from wheats lacking I, 2, or all 3 of the high M,. glutenin-subunit alleles of the A, B, or D genomes. Indications of their respective dough qualities are given down the left side as Extensograph height (Rmax).
"pre-fractionation" of protein composition in the native state without the imposition of extraction and reconstitution procedures'7 (and the accompanying risks of artefact formation). On the other hand, these observations highlight the need to ensure that tests of genotype differences are not due to inadvertent variations in growth conditions. Heat stress during grain filling is another factor that has been identified as a cause of grain-quality variation, particularly for certain wheat-growing countries. Initial reports suggested that there was the general phenomenon that dough properties were weaker for wheat from plants that had been subjected to heat stress (such as a few days with maximum temperatures over 35°C) (see reviews53,54). Subsequent analyses of a range of genotypes have indicated various reactions to heat stress in dough properties, ranging from slight increases in dough strength (as longer mixing time in the Mixograph) to considerable weakening55. Those cultivars that showed the greater loss of dough strength in this case tended to have the Glu-DIa allele (coding high Mr subunits 2+12), whereas the 5+10 cultivars tended to be heat tolerant55. This observation, if proven to be general, would explain why early reports, based on Australian wheats, which happened to be mainly 2+12 types, conflicted with another report56 , which was based on American 5+10 cultivars; hence again illustrating the need for caution in reviewing the range of "windows" being studied, according to their being representative of the general population.
4.6.2 Growth Temperatures.
13
Wheat Structure. Biochemistry and Functionality
In contrast to the effects on dough properties described above for heat stress, increasing temperatures (during grain filling) in the more modest range (IS-35°C) have been reported to cause a strengthening of dough properties54,57,58. No doubt, there is also the likelihood that this observation will not apply equally to all wheats, and there will be the opportunity to select for genotypes that are more tolerant than others to the effects on grain quality of temperature variations in the moderate range.
5 5.1
INTERPRETATION
Testing for Statistical Significance
Following the above advice of taking observations at many windows leads to a major problem - a large volume of information! Although our results may now (potentially) have statistical significance, appropriate interpretation is needed. This was the problem for Guthrie with his very small data set (Fig. 2). To be fair to him, a century ago he lacked statistical procedures with which to develop correct interpretations. Furthermore, he lacked the equipment with which to readily carry out those procedures - the computer. Today, we have the great advantage of vast computing power, which enables us (potentially) to make sense of large data sets, reducing many numbers to meaningful conclusions. This same boon carries the parallel risk of producing nonsense from our valuable results if they are interpreted incorrectly. It also carries the temptation to continue on with meaningless experiments, accumulating useless results, if we have blind faith in the computer's power nevertheless to deliver intelligent interpretations.
5.2 Modelling and Prediction A further opportunity now offered by the computer is to go well beyond mere evaluation of "what we saw" to integrate the whole picture more effectively, leading to predictions of "what we might expect to see in the future". For example, could we analyse historic data describing the effects of climatic variables on grain quality for a specific site, and thus predict quality some weeks before harvest, knowing the climate for most of the recent growing season? This has been attempted in various places with some degree of success. In one such study59, the expected protein content of the crop was narrowed from a standard deviation of over l .0 in protein percentage to less than 0.5 % for barley, by considering the model relating protein content to the two most significant climatic factors winter rainfall and spring heat. Another relevant application of modelling includes the prediction of quality deterioration during storage60. In contrast to opportunities in Guthrie's da , we now have many excellent techniques with which to make observations. Any particular researcher may not have opportunity to use all these windows, but it is essential to be aware of their existence and of their potential for extending knowledge. The necessity to apply the range of these methods to a representative set of samples may be daunting in terms of sample numbers, but we now have the advantage of computer power to make sense of the large number of observations, provided we can use it correctly. We thus do well to read on in this book to allow it to open our eyes to the range of windows available.
l
References l.
2. 3.
4.
T. B. Osborne, 'The Vegetable Proteins', Longmans, Green and Co., London, 1 909. B. Eckert, T. Amend and H.-D. Belitz, In 'Gluten Proteins 1 993', Assoc. Cereal Research, Detmold, Germany, 1 994, p. 498. B . Eckert, T . Amend and H.-D. Belitz, I n 'Gluten Proteins 1 993', Assoc. Cereal Research, Detmold, Germany, 1 994, p. 505. 1. E. Bernardin and D. D. Kasarda, Cereal Chem. , 1 973, 50, 529.
Wheat Structure, Biochemistry and Functionality
14
5. 6. 7.
C. W. Wrigley,Cereal Foods World, 1993,38,68. F. B. Guthrie,1. Royal Soc. N. S. W, 1896,30,124. F. B. Guthrie, 'Wheat and Flour Investigations', Science Bulletin NSW Department of Agriculture,Sydney,1912. 8. C. W. Wrigley and KW. Shepherd,Ann. N. Y. Acad. Sci. , 1973,209,154. 9. P. I. Payne,KG. Corfield and 1. A. Blackman, Theor. Appl. Genet. , 1979,55,153. 10. P. R. Shewry,N. G. Halford and A. S. Tatham,1. Cereal Sci. , 1992,15,105. 11. R. B. Gupta and KW. Shepherd, Theor. Appl. Genet. , 1990,80,65. 12. 1. L. Andrews, R. L. Hay,1. H. Skerritt and K H. Sutton, 1. Cereal Sci. , 1994,20, 203. 13. F. R. Huebner and 1. A. Bietz, In 'High-Performance Liquid Chromatography of Cereal and Legume Proteins',Eds 1. E. Kruger and 1. A. Bietz,Amer. Assoc. Cereal Chemists, St Paul,MN USA,1994,p. 206. 14. K H. Sutton, R. 1. Hay, C. H. Mouat and W. B. Griffin,1. Cereal Sci. , 1990, 12, 145. 15. R. B. Gupta, KKhan and F. MacRitchie,1. Cereal Sci. , 1993,18,23. 16. 1.-c. Autran, In 'High-Performance Liquid Chromatography of Cereal and Legume Proteins',Eds 1. E. Kruger and 1. A. Bietz,Amer. Assoc. Cereal Chemists, St Paul, MN USA, 1994,p. 326. 17. F. MacRitchie,Adv. Food Nutr. Res. , 1992,36,1. 18. KKhan and L. Huckle,Cereal Chem. , 1991,69,686. 19. C. W. Wrigley,R. B. Gupta and F. Bekes,Electrophoresis, 1993,14,1257. 20. 1. C. Giddings,Science, 1993,260,1456. 21. K-G. Wahlund, M. Gustavsson, F. MacRitchie, T. Nylander and L. Wannerberger, 1. Cereal Sci. , In press. 22. G. L. Lookhart and S. R. Bean,Cereal Chem. , 1995,72,42. 23. W. E. Werner,1. E. Wiktorowicz and D. D. Kasarda,Cereal Chem. , 1994,71,397. 24. G. L. Lookhart and C. W. Wrigley, In 'Identification of Food-Grain Varieties', Ed. C. W. Wrigley, Amer. Assoc. Cereal Chemists, St Paul, MN, USA, 1995, In press. 25. S. Denery-Papini, 1. P. Briand, I. Quillien, Y. Popineau and M. H. V. van Regenmortel, 1. Cereal Sci. , 1994,20,1. 26. 1. L. Andrews,M. 1. Blundell and 1. H. Skerritt,Cereal Chem. , 1993,70,241. 27. 1. L. Andrews and 1. H. Skerritt,1. Cereal SCi. , 1994,19, 219. 28. 1. M. Field,A. S. Tatham and P. R. Shewry,Biochem. J. , 1987,247,215. 29. P. Reddy and R. Appels,Theor. Appl. Genet. , 1993,85,616. 30. 1. S. C. Smith,In 'Identification of Food-Grain Varieties',Ed. C. W. Wrigley, Amer Assoc. Cereal Chemists,St Paul,MN USA, 1995,In press. 31. V. Vasil, A. M. Castillo, M. E. Fromm and I. K Vasil,Bio/Technology, 1992, 10, 667. 32. N. Shani, N. Rosenberg, D. D. Kasarda and G. Galili, 1. BioI. Chem. , 1994, 269, 8924. 33. C. R. Rath, P. W. Gras, C. W. Wrigley and C. E. Walker, Cereal Foods World, 1990,35,572. 34. F. Bekes, P. W. Gras and D. Murray, In "Proc. 44th Australian Cereal Chern. Conference", Eds 1. F. Panozzo and P. G. Downie, Royal Aust. Chern. Inst., Melbourne,1995,p. 197. 34a. R. 1. Fido, F. Bekes, P. W. Gras and A. S. Tatham, In 'Proc. IntI. Conference Wheat Kernel Proteins: Molecular and Functional Aspects', University of TuscialCNR, Viterbo,Italy,1994,In press. 35. F. Bekes,P. W. Gras,and R. B. Gupta,Cereal Chem. , 1994,71,44. 35a. F. Bekes, O. D. Anderson, P. W. Gras, R. B. Gupta, A. Tam, C. W. Wrigley and R. Appels, In 'Improvement in Cereal Quality by Genetic Engineering' Eds R. 1. Henry and 1. A. Ronalds,Plenum Press,New York,1994,p. 97. 36. A. Schuize, A. M. Steiner and P. Ruckenbauer,Plant Varieties and Seeds, 1994, 7, 193. ,
,
,
Wheat Structure, Biochemistry and Functionality
15
A. I. Morgunov, R. 1. Pena, 1. Crossa and S. Rajaram,J. Genet. Breed. , 1993,47, 53. 38. P. I. Payne,M. A. Nightingale,A. F. Krattinger and L. M. Holt,J. Sci. Food Agric. , 1987,40,51 39. F. MacRitchie,D. L. du Cros and C. W. Wrigley,Adv. Cereal Sci. Technol. , 1990, 10,79. 40. R. B. Gupta, F. Bekes and C. W. Wrigley,Cereal Chem. , 1991,68,328. 41. C. W. Wrigley,G. 1. Lawrence and K. W. Shepherd, Aust. J. Plant Physiol. , 1982, 9,15. 42. P. I. Payne, K. G. Corfield, L. M. Holt and 1. A. Blackman, J. Sci. Food Agric. , 1981,32,51. 43. W. P. Campbell, C. W. Wrigley,P. 1. Cressey and C. R. Slack,Cereal Chem. , 1987, 64,293. 44. R. B. Gupta and F. MacRitchie,J. Cereal Sci. , 1994,19,19. 45. G. Branlard and M. Dardevet,J. Cereal Sci. , 1994,20,235. 46. C. W. Wrigley and C. F. Morris, In 'Cereal Grain Quality', Eds R. 1. Henry and P. S. Kettlewell, Chapman Hall,London,1995,In press. 47. G. 1. Lawrence,F. MacRitchie and C. W. Wrigley,J. Cereal Sci., 1988,7,109. 48. P. I. Payne,L. M. Holt,K. Harinder,D. P. MaCartney and G. 1. Lawrence, In 'Proc. Third IntI. Workshop on Gluten Proteins', Eds R. Lasztity and F. Bekes, World Scientific Publ. Co.,Singapore,1987,p. 216. 49. R. B. Gupta, F. MacRitchie, K. W. Shepherd and F. Ellison, In 'Gluten Proteins 1990', Eds W. Bushuk and R. Tkachuk, Amer. Assoc. Cereal Chemists, St Paul, MN, USA p. 71. 50. M. F. Timms,R. C. Bottomley,1. R. S. Ellis and 1. D. Schofield,J. Sci. Food Agric. , 1981,32,684. 51. P. 1. Randall and C. W. Wrigley,Adv. Cereal Sci. Technol. , 1986,8,171. 52. F. MacRitchie and R. B. Gupta,Aust. J. Agric. Res. , 1993,44,1767. 53. C. Blumenthal,E. W. R. Barlow and C. W. Wrigley,J. Cereal Sci. , 1993,18,3. 54. C. W. Wrigley, C. Blumenthal, P. W. Gras and E. W. R. Barlow, Aust. J. Plant Physiol. , 1994,21,875. 55. C. Blumenthal,P. W. Gras, F. Bekes,E. W. R. Barlow and C. W. Wrigley, Cereal Chem. , 1995,72,135. 56. 1. E. Bernardin, In 'Proc. 44th Australian Cereal Chemistry Conference', Eds 1. F. Panozzo and P. G. Downie,Royal Aust. Chem. Inst.,Melbourne,1995, p. 60. 57. A. Schipper, W. Jahn-Deesbaach and D. Weipert, Getreide Mehl und Brot, 1986, 40,99. 58. P. 1. Randall and H. 1. Moss,Aust. J. Agric. Res. , 1990,41,603. 59. R. Correll,1. Butler,L. Spouncer and C. W. Wrigley,Aust. J. Plant Physiol. , 1994, 21,869. 60. M. L. Bason,1. A. Ronalds and C. W. Wrigley,Cereal Foods World, 1993,38,361. 37.
Grain Structure and Quality
GRAIN SIZE AND MORPHOLOGY: IMPLICATIONS .FOR QUALITY
A. D. Evers Campden & Chorleywood Food Research Association Chorleywood
Herts, WD3 5SH
I.lNTRODUCTION 1.1
Sources of variation Grain size varies enormously in wheat as in other cereals and the reasons for this are
many and various.
Probably the major source of this variation lies in the inherent
characteristics of individual varieties.
Many of the traditionally favoured milling types,
such as Canadian Spring wheats are small grained while many of home-grown varieties are much larger.
The reason for the increasing popularity of large grained varieties may
result from the factor that grain size contributes to yield, but it may also reflect the notion that a larger grain contains a greater proportion of endosperm.
A further source of variation resides in the way that a grass plant is structured. Each
plant comprises several stems because of branching at the basel. The first stem bears the
ear containing the largest grains, and the mean grain sizes on later ears decline with order of initiation.
Even a single
ear
bears grains which display a wide range of sizes.
The
variation is systematic, occurring both along the length of the ear or spike and within the
branches or spikelets. More than two fold differences in mass are to be expected among grains on a single ear alone 2 •
Additionally the growing conditions of the plant can vary in terms of site, soil fertility, weather and severity of attack by field pests and pathogens, and the effects of these factors
on the grain weights of three popular UK varieties, over a number of years, are shown in
Figure
1
It must be borne in mind when considering effects of grain size variation that variation due to one cause may give rise to differences quite unlike those induced by others. While the causes of variation will always include those due to botanical causes, various environmental factors in many possible permutations, may also play a part and although the effects discussed in this paper in relation to the characteristic being compared, are consistent, their universal implications are not assured. 1.2
Image analysis Until recently, grain size, as distinct from grain mass, has not been easily measured.
The innovation that has changed this situation is the advent of Image Analysis. It is a versatile technique and several options exist for measuring grain size, depending on the
Wheat Structure, Biochemistry and Functionality
20
60 .------,
;: 50 01
.�
c:
.§
01 o o
�
40
� +-----�----._--r_--_,,_--_.--_1 1966
1966
1967
1969
1990
Year
1991
1992
1993
Figure 1 Variation in average 1,000 grain weight for three popular UK varieties grown in trial plots between 1986 and 1993 (Data by courtesy National Institute of Agricultural Botany) level of information required and the time available.
At one end of the spectrum very
simple presentations can yield useful size descriptions very consistently. At the other end of the scale, detailed morphological information can be collected by examining single grains and even features within them. In this contribution we discuss three quality criteria which might be affected by grain size.
Image analysis measurements have been vital to
all of the studies involved.
2. VARIAnONS RELATED TO SIZE 2.1
Grain size and endosperm content In the first case to be considered here, an attempt was made to determine the proportion
of the grain that was contributed by endosperm in a series of samples that had been milled. Since endosperm is the tissue from which white flour is produced it can be assumed that the proportion of endosperm is a significant determinant of the amount of flour that can be extracted.
A series of
20 wheats had delivered extraction rates between 70 and 80%
by a consistent protocol, on laboratory BUhler mills, and considerable variation in endosperm content among them had been expected.
It had also been expected from
geometric considerations that endosperm content would increase with greater size because
of the principle that surface- to-volume ratio declines as size increases. In spite of using
extremely detailed measurements, image analysis failed to show any systematic differences among the samples, either in relation to grain size or extraction rate, and it appeared at first that our image analysis measurements were of little value. It later emerged that they were telling us something which was not wrong, but merely unexpected. We undertook a series of dissections to further investigate whether grain size and endosperm content were related. The dissections confirmed that the total endosperm content varied only by small amounts among well filled grains of different sizes; and only a little more between well-filled and shrivelled grains. Differences were much smaller than expected and they were certainly much smaller than the 10% differences in extraction rate3•
21
Grain Structure and Quality 1.1
Grain size and protein content In a recently published study4 , Regner examined the relationship between grain mass
and protein content in four Spring and four Winter wheats. For the Spring varieties a strong positive relationship was found between grain mass and nitrogen content, and in
the case of two of the Winter types the same general pattern applied, though less clearly.
In the other two Winter varieties the relationship was reversed. 1.3
Grain size and protein quality Differences in protein quality as a function of size came to light when extracts of single
grains were compared using reversed phase high performance liquid chromatography HPLC).
(RP
Extracts from larger grains consistently contained a higher proportion of high
molecular weight (HMW) subunits than those from smaller grains from the same sampleS.
An implication of this observation, which occurred to us, is that, within a sample, large
grains might have better baking properties than smaller grains.
We examined baking properties of flours produced from grains of different sizes separated by sieving.
Four fractions were produced by use of
2.2 mm, 2.5mm
and
3.5mm slotted sieves from each of two U.K. varieties: Mercia and Riband, a good and a poor baking wheat respectively.
The largest fraction contained too little material but the
other fractions were milled on the Chopin mill, and the flours were tested and baked into
loaves, using the Chorleywood Bread Process. Results of conventional quality tests, and loaf characteristics are shown in Table I
Table I
Flour and bread quality data for products of grains of two
UK varieties
separated by sieving.
Riband
Mercia
<2.2mm
2.2-2.Smm
2.S-23.Smm
<2.2mm
2.2-2.Smm
2.S-3.Smm
48.5
50.0
49.5
52.3
53.0
53
29
30
32
69
72
74
Volwneml
1115
1118
1215
1375
1392
1388
Oven spring inches
0.1
0.2
0.25
1.09
1.25
1.3
45.7
51.4
55.7
50.6
57.2
58.4
FLOURS
Water absorption
% (Farinograph) SDS VollDlle
LOAVES
Crumb colour (lhmterlab Y-value)
Though not referred to in their earlier paper, the significance of grain-size-related protein differences on baking quality was not overlooked by the group responsible for the HPLC observations described above.
A subsequent paper provides evidence of a good
correlation between grain weight and loaf quality for the New Zealand variety Otane6 .
22
Wheat Structure, Biochemistry and FunctioTUllity
2.4 Grain size and alp/la-amylase activity. Figure 1 shows that the size of grains of all varieties varies from year to year and site to site variation has also been noted above.
As a result, assessment of "typical" size for
a given variety is somewhat arbitrary and size descriptions in the publication giving botanical information on UK cereal varieties7 are somewhat cautious.
Grains of most
varieties are described as "medium" and in a recent edition only 13 varieties have descriptions suggesting they are either longer, broader or both longer and broader than medium. Of these, only five have appeared in the Recommended List trials between
1986
and 1993, this contrasts with about SO varieties with smaller grains. It is notable however
that the larger grained varieties consistently have relatively low Falling Numbers, to the extent that in an arbitrary category of the "four lowest falling numbers" of each harvest, the larger-grained types appear disproportionately frequentlyl. It is also interesting that, before conducting the survey in terms of
grain size
descriptions, an attempt was made using 1000 grain weight data The relationship did not show up, possibly because grain size and weight are not simply related.
Economic
investigation of this relationship has now become a realistic possibility if simple image analysis techniques are used.
annual records.
It could feature as a useful additional parameter in the
It is important to realise that in the majority of the years under consideration, the
general level of Falling Numbers was relatively levels did not arise as a result of germination.
high,
indicating that the high enzyme
It is interesting now to consider the
relationship between grain size and enzyme activity in a year when most samples showed a
low Falling Number.
The 1987 harvest was such a year, and attempts were beginning to be made to salvage
millable fractions from unacceptably sprouted bulks. In work at ADAS, grains of different sizes were separated by sieving and
Falling Numbers and other characteristics of the
fractions were determined. In one experiment grains smaller than 2.7Smm were separated from larger ones which were all less than 3.7Smm. Falling Numbers of all varieties involved were higher in the smaller grains than the largerl. The argument for an association between large grains and low Falling Number seems attractive but any argument based on archival evidence is easier to sustain if it can be complemented with explanatory theory. Some relevant observations have been made in our work for a
LINK project in which CCFRA is collaborating with colleagues from the
John Innes Institute who have produced
a series of crosses from an Australian variety
Spica and the old variety Chinese Spring. The crossing experiments provide much useful information about the inheritance of the high pregermination enzyme condition but at ChorIeywood most of our activities to date have concerned the parent varieties and involved microscopy to relate physical characteristics to enzyme activity. Spica is a variety which suffers from the problem of high amylase activity even in the absence of germination. In view of the foregoing it is no surprise that it also produces large grains. We have found that, in common with many large grains, Spica grains have a large endosperm cavity. Sometimes the cavity remains open, but more often it becomes crushed giving it a slit-like form (Fig 2). Detection of amylase activity
in situ, is difficult and in the first instance we turned to
an established fluorescence method which detects esterase9•
It has
been used as an
indicator of all the hydrolytic enzymes, including alpha-amylase, produced in the aleurone cells.
The position of fluorescence detected with an epifluorescence microscope, in grain
23
Grain Structure and Quality sections, provides an indication of the
cells wherein it is produced.
Figure 2 Diagram of some of the types of endosperm cavities encountered in wheat grain transverse sections. J) large cavity in an open condition, 2) and 3) two frequently occuring distortions of the cavity through crushing, 4) small cavity typical ofsmall grains. Results indicated that even in high falling number (low alpha-amylase) samples some enzyme activity occurs but the amounts and sites of origin differed in the two types of grain. The source of enzyme in the ungerminated Spica grains lay in the aleurone of the crease region, while in Chinese Spring the enzyme was either absent or present mainly in the aleurone cells around the periphery of the grain, the more conventional location. The observation concerning activity in the crease is, to the best of our knowledge, an unexplored phenomenon and one which required further substantiation; after all esterase is of less interest to us than amylase, and can we be sure that the two are produced together? Unfortunately there are no fluorescently linked substrates available for alpha-amylase, similar to those for esterase, but use of starch- or
beta
limit dextrin-containing gels, into
which amylase diffused from half grains placed on their surface confirmed the site of origin as the endosperm cavity region, in the case of SpicalO 3 . CONCLUSIONS To summarise the position on grain size in the context of the three quality aspects examined: it has l ess effect than might be expected, on endosperm content; it has a detectable but possibly inconsistent effect on protein quality and evidence form several sources indicates that large grain size and high hydrolytic enzyme activity are linked. Perhaps, as the greatest constraint to consistent high usage of UK wheats lies in our
failure
so
far to control
interesting of them all.
alpha-amylase
production, this last factor may be the most
It is one of the many fascinating topics relating to excessive pre
harvest enzyme activity receiving further attention in new MAFFIHGCA proj ects, in which CCFRA and the John Innes Laboratory continue to collaborate.
Acknowledgements W. Burk of the Technical University of Munich (supported at CCFRA by a COMET award and supervised by Dr P Pritchard) performed the studies on protein quality.
Wheat Structure. Biochemistry and Functionality
24
References 1 . N. L. Kent and A D. Evers, 'Kent's Technology of Cereals' 4th Edn. Pergamon, Oxford, 1994, Chapter 2, p. 29 2. P. M. Bremner and H. M. Rawson, A ust. J Plant Physiol. 1 978, 5, 6 1 3 . A D . Evers, R I . Cox, M . Z. Shaheedullah and R P . Withey, 'Aspects o f Applied Biology 25 Cereal Quality II ' Eds G. F. 1. Milford, P. S. Kettlewell, 1. H. Orson, W. T. B. Thomas, P. E. Pritchard and C. Myram, Assn. of Applied Biologists, WeUesbourne, 1 990. p. 4 1 7 4 . S Regner, Doctoral Thesis, Swedish University o f Agricultural Sciences, Uppsala, 1 995. 5. R. L. Hay, Proc. Fortieth Australian Cereal Chemistry Conference, Royal Australian Chemical Institute 1 990. p. 1 6 1 6. K. H . Sutton, RL.Hay an d C . H. Mouat, J Cereal Science. 1 992, 15, 253 7. Anon. 'Detailed Descriptions of Varieties of Wheat, Barley, Oats, Rye and Triticale' National Institute of Agricultural Botany, Cambridge. (Annually updated) 8. A D. Evers, 1. Flintham, and K. Kotecha J Cereal Science 1 995, 21, 1 . 9. S Aa Jensen, L. Munck and 1. E. Kruger. J Cereal Science 1 984, 2, 1 87 1 0. 1. Flintham, M. Gale and AD. Evers. Agronomist 1 994 (3), 4 -
THE SHAPE OF THE WHEAT KERNEL AND ITS INFLUENCE ON FRACTURE
1. F. V. Vincent, A. A. Khan and 1.-H. Liu The Centre for Biomimetics The University of Reading Earley Gate READING RG6 2AT
1. INTRODUCTION For many years wheat and its main product, flour, have been studied using the techniques of biochemistry, microscopy and rheology. Not surprisingly these approaches have not added to our understanding of the milling properties of wheat. For this are needed the techniques of materials science and, more particularly, fracture mechanics. With these one can explore, analyse and understand the true causes of hardness and softness in wheat, and apply the information so gained in improvements to processing techniques, breeding, trouble-shooting and quality control. This approach was taken in a DTI-LINK project led from the CCFRA, and we are grateful to the members of the "Optimill" consortium for permission to publish data from this project. The mechanical properties of a complex object such as a grain of wheat are due to a combination of effects. Some of these are due to the mechanical properties of the materials which make up the components, some are due to the shapes of the components.
These is
no way of telling which of these will be the most important in any one object, but the techniques developed in materials science make this largely possible.
The main factors
contributing to the properties of a grain of wheat are therefore the shape and size of the grain and the mechanical properties of the endosperm. The properties of the bran may be of importance but that is not certain, since there is so much less bran that endosperm.
The
properties of the endosperm will in turn be controlled by its water content, the shape, size, distribution and relative amount of protein, starch granules, cell wall, etc. For the purposes of the present analysis it is sufficient to know the properties of the endosperm in bulk and to ignore the origin of these properties. The endosperm is assumed to be isotropic.
2. MATERIALS AND METHODS
2.1 Mechanical Properties Of Endosperm In order to measure the mechanical properties of endosperm, samples must be prepared which will allow the use of the analytical methods developed in materials science. The simplest shape of sample is the cylinder, so samples were turned on a watch-maker's
Wheat Structure. Biochemistry and Functionality
26
lathe from half grains of wheat . The grains were split down the crease and one end was cut flat.
This end was then stuck to a small aluminium or brass cylinder ( I 0 mm diameter x
10
mm depth) allowing i t t o b e mounted i n the lathe chuck. The half grain was then machined to a cylinder about I mm diameter x
1 . 5 mm long. All the bran was thus removed, as was
all trace of the crease. The endosperm cylinder, still stuck to the metal cylinder, was then
4202 Instron) and tested in compression by
mounted in a materials testing machine (a
lowering a probe, mounted on a load cell, onto it at a speed of 0.5 mm/min. The stiffuess of the endosperm was calculated from the steepest part of the loading curve, as (F'lA )/(//L), where
F is
a force in newtons, A is the cross-sectional area of the cylinder over which the
force is acting, / is the length by which the cylinder is compressed by
F,
and
L is the initial
length of the cylinder.
2.2 Mechanical Properties Of Whole Grains Whole grains were compressed in the
4202 Instron at 0.5 mm/m, orientated crease
downwards. The data were recorded as force/deflection traces. cut off before being tested in this way.
Some grains had the ends
These grains are referred to as "truncated" .
Sufficient o f the ends was removed for the remaining (central) part o f the grain to have a constant cross-section along its length, which was thus about
3 mm. Some truncated grains
were tested with sandpaper beneath them on the lower platen, the sandpaper tending to stop the halves of the grain either side of the crease from moving apart and allowing the crease to open.
2.3 Finite Element Analysis Finite element (FE) analysis involves dividing the specimen into a large number of small sections and calculating force-deflection data for each, summing the result over the entire specimen. modelled.
In this way the mechanical behaviour of complex structures can be
The cross-sectional shape of grains of four varieties of wheat (Riband, Mercia,
Durum, Apollo) was copied from scanning electron micrographs into a computer CAD application and co-ordinates measured at points around the outline.
These co-ordinates
were transferred into the FE package "Algor" and used as the basis for the FE model of the grain. Stiffuess values of the endosperm used in these models were GPa (Apollo),
1 .34 GPa (Mercia) and 2.0 GPa (Durum).
0.88 GPa (Riband), 1.0
The FE model was used to
generate stress distribution maps of the grains in cross-section, with and without the crease being stabilised (see below) and to generate force-deflection curves for the whole section. These could be compared with data from whole grains compressed in the Instron.
Force
deflection curves were also calculated for the different grain shapes using a constant and common value for the stiffness of
1 . 0 GPa.
3. RESULTS Force-deflection curves for cylinders of endosperm of Mercia and Riband give different values of stiffuess which were used in the FE calculations (see above) and whose origin and significance will be presented and discussed in a later paper. Compression tests of whole and truncated grains give curves in which the load and deflection before failure (indicating incipient fracture) are characteristic (fig
1). Grains of soft wheat (Riband) tend
Grain Structure and Quality
27
to fail by a split starting from the crease; grains of hard wheat (Mercia) fail by splitting elsewhere. Truncation caused total failure to occur at lower loads and also guaranteed that it occurred by a split starting at the tip of the crease. With the inference that the ends of the grain stabilise it from splitting at the crease, probably by reducing the tendency of the two halves of the truncated grain to move apart when compressed,truncated grains were tested with the crease stabilised by a sheet of sandpaper, and showed failure behaviour more akin to that of whole grains. This suggested that FE modelling of the grain could be simplified by considering the cross -section of the grain and imposing different boundary conditions to either side of the crease,either holding them stationary or allowing one to move. All four varieties of grain were modelled in this way using measured values for the stiffness of the endosperm with Riband and Mercia, and estimating values of 2 GPa for Durum and I GPa for Apollo. The cross -sections (fig 2a, b) in each instance were loaded at three points with 2.5 N (about half the minimum failure load, so the grains are well within the linear zone of their mechanical response) and all showed stress concentrations at the loading points, but at the crease only when the restraint, equivalent to truncation, was removed. The degree of stress concentration at the crease varies in the four varieties shown, in direct proportion to the openness of the end of the crease. Thus Riband shows stress concentrated at the crease even when constrained, whereas Mercia shows very little sign of stress in this area. The load deflection behaviour of the grains was also modelled, both with the measured or estimated values of stiffness for the endosperm (fig 3) and with a common value of 1 GPa. In the latter case the order of the varieties changed with Appollo as the stiffest,then Riband,Durum and Mercia. Experimental data points are also shown in fig 3, confirming that the models are effective and believable. 4. DISCUSSION
This study has shown that the shape of the grain is more important than the mechanical properties of the endosperm in dictating the load -deflection properties of the whole grain. This is emphasised by the appearance of Durum, with the stiffest endosperm, below Riband with the softest endosperm,in the ranking of overall stiffness. This cannot be predicted from the shape of the grain without the sort of analysis reported here. This study has not directly addressed the problem of fracture,which demands more extensive modelling. Fracture properties are demonstrably different in that experiment shows that the "harder" (=stiffer) grains fracture in a different manner from the softer ones. This is possibly associated with the greater strength of the endosperm of Mercia but cannot be dissociated from the low tendency of Mercia to sustain a stress concentration at the tip of the crease,even in the unconstrained state. The reason for this is obscure, since Mercia has the sharpest crease of all the grains studied,which would be expected to induce a higher stress concentration which would in tum precipitate fracture. Presumably the rounded character of Mercia allows the rest of the grain effectively to support the crease and protect it from high loads. However, it accounts for the general behaviour of Mercia in compression tests, where fractures rarely start from the tip of the crease. Conversely, the open crease of Riband with its rounded end allows the development of stress concentrations even when the crease is constrained, causing the fracture always to start from this point.
28
Wheat Structure, Biochemistry and Functionality
The relative compliance of Durum is presumably due to the large angle between the two halves of the grain, though the flattened end of the crease reduces the concentration of stress when constraints are removed. It seems likely that at later stages of milling, after the first break, the shape of the grain will be of less importance to the behaviour of the grist and the properties of the endosperm itself will tend to dominate.
This may not be entirely true, since the first break
will be governed by the shape of the grain. At this point, one needs input from the millers, who will be able to give advice on the phenomena which have to be modelled and understood.
The small amount of data which we have so far on these practical aspects
suggests that the influence of the shape of the grain is greater than hitherto expected and may well filter further down the series of mills than might be expected.
150
Z � Q) u � 0 I.J...
100
50
O ��------�---, o
0.5
Deflection (mm) Fig 1.
1.0
Force-deflection (to failure) curves of Riband and Mercia, showing crack path
c;) � s·
J �
� � �
Fig 2a. Stress distribution in grains in with the crease stabilised. Shading shows zone above stress value indicated.
Fig 2b. Stress distribution in grains with the crease not stabilised; stress increases at the tip o f the crease.
�
Wheat Structure, Biochemistry and Functionality
30
'/
14
Durum Apollo
12
Riband
10
S
/
8
(J) 6 u !.... o 4 I.l. 2
0.02
0.03
Displacement (mm) Fig 3.
0.04
0.05
Load-deflection curves for whole grains of wheat; data points for grains of Mercia and Riband shown
U LTRAS TRUCTURE AND TEC H N OLOG I C AL P R OP ERTIES OF W H E AT
E. Ouattrucci.
L. A. P a s q u i and 1 . F o r n al
N ational I n s titute of N u triti o n , 5 4 6 , 00 1 7 8 Rome, Italy
*
U n it of S tudies on Cereal s , Vi a Ardeatina
* P o li s h Academy o f S c ien ces , Centre o f Agrotec h n o l o g y S cienc e s , u l . 1 . Tuwima 1 0 , 1 0- 7 1 8 Olszty n , P o land
and
Veterinary
1 . I N TRODU CTION
It is w el l k n o w n that the endos perm texture of w heat grains i n fluences the milling performance and end use of various w heat varieties ( Matte r n , 1 9 8 8 ; G lenn & S au n ders , 1 9 9 0 ; F o r n al et al. , 1 99 4 ) . I n c o m m o n w heat (Triticum v u lg are) the endospe rm texture is us ually defined as h ard o r s oft. W h e at w i th h ard texture req u ires more force to fracture the kernel. It also m ai n tains larger particles thro u g h the milling process and c o n tains m o re damaged s tarch ( Mattern , 1 9 8 8 ; Mal o u f & H o s e n e y , 1 9 9 2 ) than s o ft c o m m o n w heat. S y mes ( 1 9 6 5 , 69) reported that a s i n g le m aj o r gene and m i n o r g enes c o n trol w h eat h ard n es s . Differences i n textural h ardness might result from the deg ree o f s tarch - p r o tein adhes ion derived from the d i fferent cellular p r o d ucts d e p o s ited at the starch - p rotein i n terface. S i m o n d s et al. ( 1 9 7 3 ) i s o lated a s tarc h extract that they s u pposed w o uld be able to cement s tarch an d protein i n h ard w heat varietie s . G reenwell and S c h o field ( 1 9 8 6 ) fo u n d that a 1 5 K Da protein friab i l i n associated w ith th e s u rface o f e x tracted s tarc h gran u les i n fluences w h eat grain h ardnes s . ( G le n n & S au n ders , 1 9 9 0 ; Malouf et al. , 1 9 9 2 ) . I n fact, w h e n it is present, it appears to reduce the b i n d i n g of s torage proteins to s tarch g ranules. More recent studies carried o u t b y S c h ofield et alii o n friabilin imm u n o locatio n seem to s h o w , in i n tact kernels , little d i fference in levels o f friab ilin in h ard and s oft w h eats , as measured by ELI S A. The d i fferences in friabilin levels detected by S DS - P A G E on i s o lated s tarc hes m ay have a d i fferent e x pl a n ati o n . A s e c o n d th eory h o ld s that t h e degree o f e n d o s perm h ardness is determined by the c o n ti n u ity o f the p rotein matr i x , its s tructure and the s trength w i th w h ich it p h y s ically entraps s tarch gran ules (S ten vert & K i n g s w o o d , 1 97 7 ; G le n n & S au nders , 1 990) W h ereas many s tudies h ave been carried out o n the u l trastructure o f T. v u l g are varietie s , very little can b e fo u n d in th e literature o n T. d u r u m . T. durum is c o n s i dered the best material for pasta m ak i n g , w h ereas Triticu m v u lg are h as very g o o d tec h n o l o g ical value for products o th e r than pasta . The aim o f the study was to inves tig ate if d ifferences e x i s t in g rain e n d o s perm s tructure between w heats , h av i n g g o o d and poor tec h n o l o g ical qu ality and d i fferent protein contents , b o th in T. durum a n d T. v u lg are . . W heat q u alIty was as s e s s ed by means of rheolog ical and ch emical tests w h ic h are used to p re d ict the tec h n o l o g ical performance of the raw material .
32
Wheat Structure, Biochemistry and Functionality 2 . MATER I AL S AN D METHODS
Tw o I talian T. durum cultiv ars w ith d ifferent pasta m aking q u ality , each h a v i n g tw o levels of p rotein c o n tent, w ere s tu d i e d : S i meto and Vitro n . w ith d i fferent b aking S i milarly t w o c u l tivars o f Triticum v u lgare q u ality w e re examin e d : Manital and Auto n o m ia. The p ro tein c o n tent o f w h o le meal was determined b y the Kjeld h aJ meth o d ( N x 5 . 7 0 , dry m atter b asis ) , w h ereas the S D S sedimentati o n v alue w as o b tained acc o r d in g to the meth o d of Axford et al. ( 1 9 7 8 ) w ith a 3 % S D S s o lution ( De x ter e t al. , 1 9 8 0 ) . The g luten Index w as o b tained acc ording to C u b ad d a et al. ( 1 9 9 2 ) . Alveograph te sts w ere performed acc o r d i n g to AACC appro ved meth ods 5 4 - 2 1 and 5 4 - 3 0 , respectively ( 1 98 3 ) . W h eat kernels were fractured tran s v ersely w ith a razor b l ade for p relimin ary microscopy investigations o f th eir s tructure. The s u rface w as c o ated w ith carbon and g o l d in a J E OL 4X vacuum e v ap o rator. For detailed analy sis o f the e n d o s perm cell s tructu re , s lides o f the seed ( 1 . 5 m m thick) were fixed w i th 2 . 5 % glutar- aldehyde ( 4 h rs ) , w as h e d w i t h p ho s p hate bu ffer ( 3 x 1 5 m i n ) , p o s tfixed w i th 1 % OS04 ( 1 hr) a n d d e h y drated in a series o f ethan o l s o lutions ( 40 - 1 00 % , 1 5 m i n . e ac h ) , critical p o int dried (B alzers U n i o n ) and co ated a s ab o v e . S p ecimens were v iewed w ith a s c anning electron micro scope J EOL 5 2 00.
3 . RES U LTS The pr otein contents and gluten q u ality o f 4 c u ltivars of T. durum are reported in Table 1 . The kernel internal s tructure of varieties of d u r u m w h eat h a v i n g d i fferent tec h n o l o g ical quality a r e s h o w n in F i g s . 1 . 1 - 1 . 4 . I n Triticum du ru m t h e kernel w i t h g o o d tec h n o l o g ical q u ality - S imeto cu ltivar - c learly s h o w s a ti g h t adhesion of p r o teins to the s tarch granu les . It is d i ffic u l t to d i s t in g u i s h indiv i d u al s tarch granu les n o t c o vered by pr o tein . S o m e g r anules w ere also broken during c u tti n g w h ic h als o i n d icates a very s tro n g b in d i n g betw een p r o tein and s tarch ( F i g . 1 . 1 ) . I n kernels o f the s ame variety ( S imeto) w ith low p r o tein c o n tent ( Ta b le 1 ) , p r o teins s till seem to coat the s tarch s u rface b u t s o m e in d iv id u al granu les can also be o b served. I n the S i meto c u l ti v ar the p r o tein matrix w as very d e n s e and c o m p act. The fib r illar s tructure o f th i s matrix is c o m p o s ed o f m i n u te g lo b u lar p articles w ith a d i ameter of less than 0 . 05 m m . F ibrils i n teraction w i th the s u rface o f the s tarch granules m ay i n v o lve o n ly a s m all p o rti on o f the s tarch s u rface o r i t may envelop alm o s t the w h o le granule ( F i g . 1 . 2 ) . I n s o me p i c tures s m all gran u les are co vered by minute g l o b u l ar depos its probably fro m the p ro tein matri x . Micro p h o tographs taken fro m e n d o s perm secti o n s treated w ith g l utar aldehyde and o s m iu m tetro xide co nfirmed the o b s ervations d i s c u s s e d above Additio n ally, details o f the p r o tein m atrix s tructure and o f the s tarc h p r o tein i n teractions may b e o b s erved. w ith p o or tec h n o l o g ical q u ality I n the Vitron v ariety, a T. durum ( Table 1 ) , en d o s perm s tructure is less co m p ac t s h o w i n g l o o sely p acked s tarc h g ranules o f a deformed s h ape ( F i g . 1 . 3 ) . The p o o r tech n o l o g ical q u ality of the Vitron v ariety m i g h t be related to the l o o s e l y p acked p ro tein matr i x . Min ute p r o teic dep o s it s , were fo u n d , also o n s tarch , but they did not seem to c o n s titute cementing material for i n d iv i d u a l g r anules ( F i g . 1 . 4 ) . w ith different p r o tein co ntent and Kernels o f Triticum v u lgare d i fferent tec h n o l o g ical q u ality (Table 2 ) are s h o w n i n F i g s . 1 . 5 - 1 . 8 .
33
Grain Structure and Quality
The tran s verse s ection of Manital, a variety w i th very g o o d tec h n o l o g ical q u ality, s h ow e d the e n d o s p erm s tructure w i th s tarch g ranules s till embedded in the protein matrix. The s mall g ranu les , p acked among the large o n e s , s eem to be present in larger amounts i n kernels w ith a l o w er protein c o n te n t ( F i g . I . 5 ) . The protein matrix s tructure o f the Manital kernels w as s im ilar ( F i g . I . 6) to that of the Triticum durum s amples s h o w n in F ig . I . 2 . T h e m aj o r d ifference w as the greater d iameter of T . v u lgare p rotein b o d ies b u ilding up the matrix fibrils . The Au tonomia v ar . , w h ic h generally h as a p o o r tec h n o l o g ical quality (Table 2 ) , s eems to be c h aracterized b y a d is c o n ti n o u s s tructure of its protein m atrix between s tarch granules . In the kernels of Auto n o mia v ar . w ith lower b a k i n g q uality b u t ch aracterized b y an equal l e v e l o f proteins ( 1 2 . 6 % ) , different patterns o f fibrillar s tructure w ere fo u n d . One of them was c h aracterized by a delicate network s h o w in g s in g le fibrils o f g l o b u lar s tructures w ith a d i ameter les s than 0. 0 1 mm ( F i g . 1 . 7 ) w hereas another s h o w e d a neuron like s tructure w ith endin g s ad hering w eakl y to in d iv id u al s tarch g r anules ( F i g . I . 8 ) .
T ab l e 1 Protein contents ( a and b ) and g luten quality of four Italian T. du ru m cultivars of different pasta making properties.
Variety
Protein (NxS.70)
%
d.m.
15.5 13. 2 12.6 1 1.9 14.5 13.7 15.2 1 1.7
S imeto a S imeto b G r azia a G r azia b Appulo a Appulo b Vitron a Vitron b •
G l u ten I n d e x : 2 6 - 45 , goo d/excellent q u ality
Gluten quality Gluten * Index
SDS tes t
(score)
(ml)
86 76 81 59 36 51 27 32
45 40 35 43 35 36 30 29 quality ;
low
�
65,
Tab l e 2 Protein content and some rheological param eters of fo ur Italian T. vulgare cultivars of differen t baking �ualit"t. (a and b) Variety Protein A lv eograph Zeleny test (NxS .70) Man ital a Manita1 b S almone a S almone b G emini a G emini b Au tonomia a Au to n o mia b •
%
d.m.
16. 1 1 4. 1 14.5 1 3. 5 13. 3 12.5 12.6 12.6
W*
226 20 1 322 230 168 76 1 44 1 18
G
PIL
25. 5 21.7 26. 7 24. 5 26. 7 18.7 28. 6 19.7
0. 47 0 . 64 0. 5 1 0. 5 5 0. 3 4 0 . 60 0. 27 0 . 67
W� 200 goo d/excellent baking quality
( ml )
43
40 57 39 30 28 24 24
34
F i g u re 1
Wheat Structure. Biochemistry and Functionality
Triticum durum: cultivar S im eto ( 1 . 1 - 1 . 2 ) w ith good and cu ltivar Vitron ( 1 . 3 - 1 . 4) w ith poor technolog ical quality . Tritic um vulgare : cultivar Manital ( 1 . 5 - 1 . 6) w ith good and cultivar A u tonomia ( 1 . 7 - 1 . 8) w ith poor b ak ing q u ality.
Grain Structure and Quality
35
4 . D I S C U S S ION The resu lts p resented above co nfirmed those of s o me scanning electron m icroscopy i n ves tigatio n s b y other authors ( Mattern, 1 9 8 8 ; B ean et alii, 1 990; G lenn & S aunders, 1 990; Malouf & H o s eney, 1 99 2 ; F o rnal et alii, 1 99 4 ; Shi e t alii, 1 99 4 ) o n u n fixed s pecim e n s . I t w as fo u n d th at in h ard texture g r ains w hen kernels are fractu re d , initial breaks fo l l o w the cell w a l l s . This means that i n the case at h an d the starc h - p rotein interface is much s tr o n ger than i n other kernels o f the s o ft w heat varieties i n ves tig ated . I t i s w orth mentioning that c o h e s iveness o f proteins t o s tarch granu les seems to be stronger i n the case of kernels w i th g o o d tec h n o l o g ical q u ality ( mainly in Triticum durum varieties ) (Malouf & H o s eney, 1 99 2 ) . This is also c o n firmed by the g reater amounts of broken s tarch g r an u les after fractu ring in varieties of g o o d tec h n o l o g ical q u ality. Our results clearly s h ow d ifferences in cohes iveness between h ard and s oft w heat grains generally involving contin uity o f the protein matrix as well as s tarc h - p rotein adhesio n . When w heat kernel s lices w ere fixed w ith g l u tar-alde h y d e a m o re detailed m icroscopic s tructure of the endos perm proteins w a s observed. H y d rated and fixed proteins appear as s m al l fib rils often linked in a network. The three- dimensio nal netw ork is h i g h l y interconnected and entraps the s mall s tarch g r anules ( B ernardin & K as ada, 1 9 7 3 ; F o rnal et alii, 1 99 4 ) . I n many cases , s mall starch granu les were rem o ved during s p ecimen prep aration making it p o s s i b le to o b s erve the detailed s tructure of the p rotein netw ork . I t w as s h o w n that all v arieties w i th low tec h n o l o g ical v al u e ( b o th i n T. durum and i n T. v u lgare ) w ere c h aracterized b y a thin and d isconti n u o u s netw ork w ith large amounts of s m all g lo bular d e p o s its o n s tarch granules s urfaces . The thick ness o f this network a p p ears t o b e c o rrelated t o t h e protein levels , measure d b y chemical analy s i s , as w e l l a s t o the p r o tein q u ality ascertained thro u g h rheolog ical tests . I t s h o u l d also be taken into cons ideration that d ifferent force s , including s u r p h ace p h en o m e n a , may be i n v o lved i n the dis pers ion o f th e protein into a fib rillar form fro m the p ro tein matrix in the e n d o s p erm ( B ernardin & K as ada, 1 97 3 ) . These res u lts s h o u ld b e cons idered prelim i n ar y . F urth er w o r k i n th is field i s underway and i s tak i n g into c o n s ideratio n : i) a larger n u m ber of varieties ; ii) s tu dies o n the protein matrix and netw o rk after s tarch g ranu les d i ge s ti o n ; iii) i n vestigations o n the microstructure o f selected cereal derived produ cts ; and iv) ev alu ation of differences in w heat g r ain microstructure b y Digital I mage Analy s i s .
A c k n o w l e d g e me nts
We a r e g r ateful t o th e Italian Ministry o f Fo rei g n Affairs and t o th e Polish Academy o f Science for their support i n this b i l ateral wo rk.
Refere nc e s 1. American Ass ociation o f Cereal C h em i s ts . Approved meth o d s o f the AA The Ass ociati o n . S t. P au l M N U S A, 1 9 8 3 .
2.
Axford, D . W . E. , E . E. McDermott and D. G . Redman, S m all scale tes t of b re ad - m aking q u al i ty . Milling Feed Fert. , 1 97 8 , 1 6 1 , 1 8 .
3. B ean, M . M . , Den S . H u an g , R . E . Miller, S o me W h eat and F l o u r P r o p erties o f K l asic-A H ard W h ite W h eat. Cereal Ch e m . 1 99 0 ' 67 , ( 3 ) 3 0 7 - 309 .
,
36
Wheat Structure, Biochemistry and Functionality
4.
B ernard i n , J . E . , D. D. K asada, H y d rated P r o tein Fibrils fro m W h e at En d o s perm. Cereal Chem . , 1 9 7 3 , 5 0 , ( 5 ) , 5 2 9 - 5 3 0 .
5. C u b a d d a , R . , M . Carcea and L . A. Pasqui, S u itability o f t h e G luten I n d e x method for as s e s s i n g g l u ten s treng th i n durum w heat and semolina.
Cereal Foods Wo rld, 1 99 2 , 3 7 , 8 6 6 .
D' E g i d i o , M. G . , B . M. Marian i , S . N ardi, P . N o v aro, R . C u badda, 6. C h e m ical and Tec h n o lo g ical Variables an d Their Relatio n s h ip s ; A Predictive Equation for P asta Cooking Qu ality . Cereal Chem . , 1 99 0 , 6 7 , ( 3 ) , 2 7 5 -
281.
7.
Dexter, I . E . , R . R . Mats u o , F . G . K o s m o l a k , D . Lei s le and B . A. Marc h y l o , The s u i tability of the S DS s e d imen tation test for as s e s s in g g luten s tren g th i n d u r u m w heat. Can. J. Plant S ci. , 1 9 80, 6 0 , 2 5 .
8. F o r n a l , 1 . , 1 . S ad o w s k a , S . G ru n d a s , A . P a s q u i , W h e at G rain, G l u ten and Dough S tructure. 1 4th ICC C o n g res s , Le Hague, N etherlan d s , 59 J u ne 1 994, P 3 1 . 9.
G le n n , G . M . , R . M . S aunders, P h y s ical and S tructural P r o p erties o f W h e at E n d o s perm Associated w i th G r ain Tex ture. Cereal Chem . , 1 990, 6 7 ,
(2), 176- 1 82.
10. Malo u f, R . B . , R . C . H o seney, W h eat H ardnes s . I . Meth o d to Meas u re Endo s p erm Ten s i l e S trength u s i n g Tablets made fro m Wheat F lo u r . Cereal
Ch em . , 1 99 2 , 6 9 , ( 2 ) , 1 64- 1 6 8 .
1 1. Malouf, R . B . , W . D. A. Lin, R . C . H o s en e y , W h eat H ard n es s . I I . Effects o f S tarch G ranu l e P r otein o n E n d o s p erm Tensile S tren g t h . Cereal
Chem . , 1 99 2 , 6 9 , ( 2 ) , 1 69 - 1 7 3 .
1 2. Mattern , P . 1 . , W h eat H ardnes s : A Micr o s c o p ic C l a s s ification I n d i v i d u al G r ai n s . Cereal Ch em . , 1 9 8 8 , 6 5 , ( 4 ) , 3 1 2 - 3 1 5 .
of
S h i , Y. c. , P . I . S eib, 1 . E. B ern ard in, Effects o f Temperature d u ri n g 1 3. G rain F i l l i n g o n S tarches from S ix W h eat C u ltivars . Cereal Chem . , 1 994,
7 1 , (4), 369- 3 8 3 .
S tenvert, N . L . , K . K i n g s w o o d , The I n fl uence 14. S tructu re o f the Protein Matrix o n W h eat H ardnes s . J.
1 97 7 , 2 8 , 1 1 - 1 9 .
of
the
P h y s ical
S ci. Food A g ric. ,
MICROSCOPICAL METHODS FOR THE STUDY OF WHEAT (TRITICUM AESTIVUM) CARYOPSIS DEVELOPMENT, FROM ANTHESIS TO MATURITY
G. D. Lunn1, P. Echlin2, P. 1. Frazie� and N. W. R. Daniels3 lDepartment of Agriculture and Horticulture University of Nottingham, Sutton Bonington Campus Loughborough, Leics. , LE 12 5RD, UK
2Department of Plant Sciences University of Cambridge Cambridge, CB2 3EA, UK
30algety Food Technology Centre Station Road Cambridge, CB 1 2JN, UK 1 INTRODUCTION Wheat caryopsis ultrastructure has proved hard to study due to the difficulty in preparing starch-filled endosperm for microscopy. Previous studies have focused on high-protein relatives (eg. T. dicoccum1 ) or early developmental phases2, resulting in fragmentary knowledge of the development of ultrastructure. Because of the conversion of young, soft, high-moisture tissues to hard, dry, mature tissues after starch and protein biosynthesis during grain filling, various techniques have been needed to prepare material of different phases for observation, which makes comparisons difficult. Re-appraisal of preparative techniques for light- and transmission electron microscopy has allowed the application of a single, flexible fixation-infiltration protocol to wheat caryopsis material from the whole range of tissues, throughout all phases of development (immediately post-anthesis; cell formation and cell division; grain filling and during drying to maturity). The techniques described were used to probe the pathway of endosperm storage protein deposition, described in the paper on effects of environment on wheat protein body morphology (Lunn et al. , this volume). The protocol allows the microscopical observation of well-preserved examples ofmost caryopsis tissues (pericarp; seed coat; aleurone layer; starchy endosperm and embryo) and therefore should allow further study of the many developmental processes that affect wheat quality. 2 MATERIALS AND METHODS The fixation protocol ( summarised in Figure 1) was tested on caryopsis tissues sampled at approximately 3-5 day intervals during the sixty day development period from flowering (anthesis) to harvest maturity. Grains of the cultivars Mercia (hard) and Apollo (soft), grown in a range of separate environments, were analysed.
38
Wheat Structure, Biochemistry and Functionality
fl . (Day 1): Fix whole ovules (0- 1 0 dpa), sliced endospenn ( 1 0-25 dpa) or 1 -0.5 mm3 endospenn fragments (25-60 dpa) in 1 .8% glutaraldehyde solution in 50 mM Sorenson's phosphate buffer, pH 7. 1 , overnight ( 1 8 h). All procedures perfonned at ambient temperature on laboratory rotator to maintain concentration gradients. Ovule epidennis sliced with razor lto allow fixative enetration. Fixation times increased with a e of tissue .
.IJ.
2. (Day 2): Wash 3 x 5 min in Sorenson's before post-fixation in 1% aqueous osmium tetroxide for 2 h s ecimens blackened . 3. (Day 2): Wash 3 x 5 min in distilled water before dehydration in ethanol series: 0.5-1 h each in 30010, 50010, 70010, 90%, 1 00010, 100010 + Molecular Sieve (2 changes); theoretically absolutely dry. Samples for LM only require 80% ethanol. 4. (Day 2): Incubate overnight in 2: 1 absolute ethanol:resin (Spurr's for TEM or LR White for LM), then (Day 3) 4 h in 1 : 1 ethanol:resin, 4 h in 1 :2 ethanol resin, overnight in 1 00% resin. Frequent changes maximise infiltration by reducing premature polymerisation. Infiltration times increased with increasing starch content of tissue.
l
� (Day 4): Incubate in 1 00% resin for 3 - 14 d, changing resin each 4 h and overnight (12 h). 1 .IJ. 6. (Day 6 - 1 7): Embed in silica rubber moulds (Spurr's-TEM) or gelatin capsules (LR White lM), 64 h at 60°C in vented oven.
�. Trim and produce 3 Ilm sections for light microscopy with LKB Bromma 1 1 800 I lfY!:amitome (glass knives); viewed with Zeiss Axioskop 20 microscope. 8. Produce 50-100 nm sections for electron microscopy with LKB Nova Ultratome (diamond knife). Pick up fragile sections on piolofonn-coated grids and view with Philips EM30 1 TEM (60 key)
f9. Photomicrographs (Figures 2 and 3) produced by Mitsubishi CP I OOB colour sublimation �rinter or by darkroom processing. [l0. Fixation and embedding times increased to 1-2 weeks with mature tissues Figure 1 Schematic representation of generalfixation protocol (up to 20 dpa; after 20 dpa fixation and infiltration times successively increased with age of tissue and coated grids used for TEM sections)
39
Grain Structure and Quality
3 RESULTS AND DISCUSSION 2.1
Fixation Protocol
The methodology used is summarised in Figure 1 . The glutaraldehyde fixativelbuffer vehicle minimised osmotic damage to tissues due to its optimal osmolarity (500 mM, determined by Chardako� experimentation). Osmium tetroxide post -fixation provided an electron -dense stain for transmission electron microscopy as well as cross-linking lipid and protein. From 0-25 days post-anthesis (dpa), whole ovaries or slices of caryopses could be fixed and viewed by microscopy. With increased deposition of starch and protein during development, successively smaller pieces of endosperm were required for adequate fixation « 0.5 mm3 for mature tissue). The time required for fixation was also successively extended, from overnight ( 1 8 h) to one week, as moisture content of material was reduced by grain filling. Dehydration in alcohol series (replacement of water by 1 00% ethanol) was critical for SpU"'s4 embedding (TEM), due to the immiscibility of Spurr's resin and water. This was not critical for light microscopy, as the acrylic resin used (LR WhiteS, hard grade) was miscible with 80% ethanol. This resin allowed staining with water -soluble dyes (Table 1). Efficient embedding of starchy endosperm tissue was also required for subsequent microscopy. This was achieved by gradually increasing resin infiltration times, from three days to two weeks, as starch content increased, to compensate for the difficulty in infiltrating dense, dry tissues with resin monomers.
3 Ilm sections (light microscopy) could be observed from all stages, from the immature ovule to the fully mature endosperm (Figure 2). Major endosperm components could be differentiated by staining with the solutions shown in Table 1 . Table 1 Staining Solutions for Light Microscopy
Staining Solution
Fraction Stained
Colour
50% BDH Jensen's iodine/ potassium iodide6(aq)
starch
red-brown to blue-black
0. 05% Sigma Toluidine Blue 07(aq)
storage proteins
purple-blue
J/KI followed
starch proteins cytoplasm
blue-black orange green
by
Toluidine Blue 0
(as above)
Sections (50-100 nm) of endosperm produced by ultramicrotomy were robust enough for TEM when material from 0-25 dpa was used (Figure 3). Subsequently, fragile sections had to be carefully collected on plastic -coated grids, so that starch granules were retained in the sections.
40
Wheat Structure, Biochemistry and Functionality
( 1)
(2 )
(3 )
(4)
(5)
(6)
Figure 2 Light photomicrographs from throughout development, showing goodfixation and preservation of microstructure. (1) Pericarplseed coat 3 dpa (2) Endosperm cellformation 5 dpa (3) Meristematic proto-aleurone 15 dpa (4) Starch and protein in central starchy endopserm 15 dpa (5) Biosynthate-packed endo!>perm cells 40 dpa (6) Mature endosperm 60 dpa
Grain Structure and Quality
41
2.2 Fixation Integrity and Ultrastructure
Figures 2 and 3 show representative photomicrographs of various tissues of differing ages, showing the utility of the fixation protocol for preserving many structures and tissues during the entire developmental process. Cell structure was conserved close to that expected in vivo, with rigid cell walls and closely adpressed, smooth cell membranes; central vacuoles appeared turgid, with smooth tonoplasts. Subcellular organelles (nuclei, mitochondria, chloroplasts, amyloplasts, starch granules, endosplasmic reticulum, protein bodies, ribosomes and vesicles) had structures similar to those reported in the literature1,2,8,9. Early in development, ovule tissues, including epidermal layers, starchy parenchyma, chlorenchyma, nucellus, chalaza and integuments could be observed (Figure 2 (1». The fragile structure of the coenocytial phase of free nuclear division and primary cell wall formation was also well preserved. Differentiation of the ovule wall into pericarp tissue (differentiation of chlorenchyma and epidermal cells to cross- and tube- cells) could be followed. Compression of the integuments to form the seed coat and the nucellar epidermis to form the hyaline layer was visible during the phase of endosperm cell division and enlargement, when mitosis of the proto-aleurone, the beginning of starch and protein biosynthesis and aleurone layer differentiation was also noted (Figure 2 (3» Starch granules showed characteristic electron-dense folds in the sections, as described by other authors. .
Finally, mature structures of the harvest-ripe caryopsis, including the terminally differentiated pericarp and seed-coat, dehydrated starch-protein matrix of the endosperm and the dormant aleurone and embryo tissues (Figure 3 (5), (6», could all be fixed and observed using the protocol techniques described in Figure 1 . Electronrnicrographs are shown in Figure 3, comparable to Figure 2 and demonstrating preservation of structures for both light and electron microscopy.
4 CONCLUSION The light and electron micrographs presented in Figures 2 and 3 demonstrate that careful application of the fixation procedure outlined in Figure 1 allowed preservation of all caryopsis tissues throughout all phases of development, during the conversion of young, soft high water content tissues to mature, dry hard tissues, a transition which has previously made such studies difficult.
42
Wheat Structure. Biochemistry and Functionality
(1)
(2)
(3)
(4)
(5 )
(6 )
Figure 3 Electron pholomicrographs showing preservation of ullraslnlclure. (1) Pericarplseed coal 3 dpa (2) Endosperm cell wallformalion 5 dpa (3) Starch andprolein bodies in central endosperm 20 dpa (4) Mature starch-protein matrix of endosperm 60 dpa (5) Embryo cells 60 dpa (6) Mature aleurone cells 60 dpa
Grain Structure and Quality
43
References 1 . M. L. Parker, 1 982, Plant Cell and Envt. , 5, 3 7. 2. H. L. Levanony, R. Rubin, Y. Altschuler and G. GaliIi, J. Cell. BioI. , 1992, 1 19 (5), 1 1 1 7. 3 . F. B. Salisbury and C. W. Ross, 'Plant Physiology, 4th Ed " Wadsworth, California, USA., 1992.
4. A. R. Spurr, J. U1trastruc. Res. , 1969, 26, 3 1 .
5. 1. L. Hall and C. Hawes, 'Electron Microscopy of Plant Cells', Academic Press, London, UK, 1 99 1 . 6 . O . F . Flint, Analyst, 1 990, 1 15, 6 1 . 7 . F . 1. Green (Ed.), 'The Sigma-Aldrich Handbook of Stains, Dyes and Indicators', Sigma Aldrich Corporation, USA, 1 990.
8. D. B. Bechtel, R. L. Gaines and Y. Pomeranz, Annals ofBotany, 1982, 50, 507. 9. M. L. Parker, J. Cer. Sci. , 1985, 3, 27 1 .
EFFECTS OF VARIABLE ENVIRONMENT ON WHEAT (TRITICUM AESTIVUM) CARYOPSIS PROTEIN BODY MORPHOLOGY AND PROTEIN MATRIX DEVELOPMENT DURING GRAIN FILLING AND DEHYDRATION
G. D. Lunn\ P. Echlin2, P. 1. Frazie.-J and N. W. R. Daniels3 IDepartment of Agriculture and Horticulture University of Nottingham, Sutton Bonington Campus Loughborough, Leics., LE 1 2 SRD, UK
2Department of Plant Sciences University of Cambridge Cambridge, CB2 3EA, UK
3Dalgety Food Technology Centre, Station Road, Cambridge, CB 1 2JN, UK I
INTRODUCTION
The development of the wheat caryopsis is a very important process that determines the quality ofone ofthe major raw materials used by the food industry. After fertilisation, embryo and endosperm tissues expand by cell division and enlargement by water uptake (vacuolisation) whilst ovary tissues are degraded or terminally differentiated into seed coat or pericarp structures. During the developmental process, endosperm becomes the major constituent of the caryopsis. Grain filling follows cell division and differentiation, when endosperm cells fill with storage deposits of protein and starch, which interact intimately on dehydration forming a starch-protein matrix, the energy-rich caryopsis component of major economic importance. The chemical nature of the storage reserves and other minor components largely determines functionality in manufactured food products, whilst their physical properties and mature structure affect the storage- and processing properties of wheat grain. Both the chemical make-up and physical structure of wheat caryopsis endosperm are affected by genotype and environment, causing variation in quality of consequence to the end users of grain. The effect of genotypic variation on wheat processing quality has received most attention and certain aspects (eg. gluten sub-unit structure and bread-making qualityl) are relatively well understood. Despite empirical observation of environmental variation manifested as variable raw material quality from different sites and seasons, this aspect of quality variation has been little studied and is poorly understood2. The studies of Blumenthal et af,4 have shown that high temperatures can alter the ratio of gliadins to glutenins in protein bodies, affecting protein quality, but broader studies into the effects of environment on endosperm structure have been rare. The paper 'Microscopical methods for the study of wheat caryopsis development. . ' (Lunn et al. , this volume) described techniques for the study of caryopsis ultrastructure. This is traditionally very difficult due to the problems with preparing starch-filled endosperm for microscopy. However, use of the methods described in the poster has allowed observation of the pathway of protein synthesis throughout development and comparison with more fragmentary studies and observations of related speciess,6. Material from different well-
Grain Structure and Quality
45
characterised environments was studied to probe the effects of environment on mature caryopsis microstructure.
2 METHODS Wheat caryopses were selected from plants of the cultivars Mercia and Apollo, grown in characterised environments (glasshouse, horticultural tunnel and field plots), from throughout the 60 day post-fertilisation period. The main differences in growth conditions were elevated temperatures and variable relative humidity. Samples were prepared for light and electron microscopy as described in the poster presentation.
3 RESULTS AND DISCUSSION 3.1 Pathway of Protein Synthesis The usefulness of the protocol for observation of well preserved subcellular structures from all tissues and developmental phases of the wheat caryopsis is explained in the other paper by the authors in this volume. Representative photomicrographs of the pathway of protein synthesis are shown in Figure 1 . The results of this analysis agree broadly with previous studies performed on isolated developmental phases7-9 and related species6,7 but includes observation of the whole developmental period. Storage protein bodies were initially seen very early in development as small « 2 �m) bodies in the cytoplasm, in close association with endoplasmic reticulum. Protein body membranes were hard to distinguish, but could be observed in some sections as thin peripheral electron-dense layers, implying that individual protein bodies were vesicular organelles of endomembranous origin, packed with so much protein that the membrane was closely adpressed to the deposit (Figure 1 ( 1 ». Association with rough endoplasmic reticulum (RER) suggested that the primary route for protein body synthesis was by accretion of protein synthesised by ribosomes on the RER before budding of vesicles, although this process was not directly observed. Very many small vesicles, as well as larger membranous structures, were frequently seen in association with the periphery of cytoplasmic protein bo lies (Figure 1 (2». This is probably a mechanism for subsequent deposition of protein onto first-formed protein bodies, and the vesicles could be from the RER or Golgi apparatus. Golgi apparati were not observed in significant numbers during this work, confirming the work of Briarty et apo, suggesting that initial transport of storage proteins via the Golgi pathway was not a major route6• Some authors1\ using specific stains for the Golgi apparatus, have postulated its greater involvement in the pathway. While a minority of gluten proteins have been shown to be g1ycosylated12, it is not likely that the majority of gluten proteins are similarly modified due to the low content of bound carbohydrate recorded for gluten. A minority of g1ycosylated proteins could be added to the main protein body by the vesicular deposition observed, by minor route Golgi processing. Enlargement of protein bodies to approximately 5-1 0 �m diameter occurred either by addition of small globular deposits from RER, vesicular deposition or fusion of smaller protein
46
Wheat Structure, Biochemistry and Functionality
(I)
(2)
( 3)
(4)
Figure 1 : Representative Electronmicrographs of the Pathway of Protein Synthesis. (/) Young membrane-boundprotein body in association with RER (2) Membranous structures associated with cytoplasmic protein bodies (3) 'Internal secretion' ofprotein body into central vacuole (4) Vacuolar protein body, with peripheral membranous vesicles
Grain Structure and Quality
47
bodies. Enlarged, cytoplasmically-deriwd protein bodies were transported by an as yet unknown mechanism to be deposited in the central vacuole. The mechanism was similar to that described previously6, with the protein body being extruded into the central vacuole after apparent fusion of the protein body and central vacuole membranes (Figure I (3» , a process previously described as 'internal secretion'13. Protein bodies depositeri in the central vacuole retained membranous structures surrounding their periphery (Figure 1 (4» , possibly representing continued deposition of proteins by small shuttle vesicles, derived from the Golgi or RER; although the mechanism oftransfer across the tonoplast and within the vacuole is uncertain, blebbing processes across the membrane would be required. These membranes could represent the source of some of the lipid associated with the surface of mature starch granules, after interaction with the surface of protein bodies. The sequence of the initial processes of protein body initiation and deposition did not vary significantly between material from the two wheat cultivars (hard and soft) and three environments studied (temperature, humidity and water stress variation). Although the events in the pathway remained the same, elevated temperature increased the rate of protein body deposition resulting in a shorter period of grain filling. Many details of the process are still far from clear but could be elucidated by autoradiography and immunocytochemical techniques. 3.2 Aggregation of Protein Bodies With continued deposition of protein bodies in the central vacuole, two types of accretion were observed at the end ofgrain filling. In some sections, aggregation of small protein bodies into large, spherical 'continuous' deposits 20-50 Ilm in diameter was initiated, possibly by small, electron-dense globular deposits within the individual protein bodies (Figure 2 ( 1 » . Fusion events could be readily distinguished by the shapes of the protein bodies, which eventually filled the central cell vacuole. In other cases, small protein bodies did not fuse but remained as a collection of 'discontinuous' deposits 1 - 1 0 Ilm in diameter, with spaces between them. During maturation, the continuous protein deposits were squeezed between starch granules, enveloping them completely, resulting in a complete starch-protein matrix. The discontinuous, non-aggregated protein deposits resulted in a discontinuous matrix on drying, with spaces between the starch and protein (Figure 2 (2» . Thus the two types of protein body deposition lead to a predisposition to vitreous or mealy texture, although the texture of the endosperm could also be affected by the rate and temperature of dehydration, as shown by artificial drying experirnents14. More study is required to fully delimit the environmental factors governing these processes. 3.3 Drying and Maturation Some surprising observations concerning the nature of the drying/maturation process were made during observation of that phase of development (Figure 3). Light microscopy showed that the conversion ofvacuolar protein deposits to a mature starch-protein matrix, empirically associated with drying, occurred on an individual cellular basis (Figure 3 ( 1 » with discrete cells observed containing mature starch-protein matrices adjacent to cells still retaining large central protein deposits. The process was observed to occur from the inside of the endosperm, outwards in concentric waves (Figure 3 (2), (3» . This implies that dehydration also occurred in this manner, which is opposite to what might be expected initially. Magnetic resonance
48
(1)
Wheat Structure, Biochemistry and Functionality
(2 )
Figure 2 Electronmicrographs of Protein Body Aggregation (I) ContimlOus (2) Discontinuous
(1)
( 2)
( 3)
Figure 3 Photomicrographs of i'-ndosperm Tissues During Drying (I) Adjacent cells with mature and immature starch-protein matrices (2) Drying wheat endosperm: central cells with mature starch-protein matrix (3) Drying wheat endosperm: peripheral cells with immature starch-protein matrix
Grain Structure and Quality
49
imaging techniques have shown that columns of silica beads can dry in this fashion, from the inside out, with water movement driven by evaporation and capillarity. This process could also occur in wheat, during passive drying. However, an active mechanism for water removal could also be postulated, with 'facilitated diffusion' of water across the outer layers of the caryopsis (eg. aleurone and embryo), which selectively retain more water than the starchy endosperm that dehydrates and dies. This hypothesis is supported by drying and maturation of wheat caryopses even in unfavourable, damp conditions and may help to explain the variation in texture achieved by artificial drying of intact ears and isolated grains14.
4 CONCLUSION
This work has demonstrated an outline pathway ofprotein synthesis consistent with the work of other authors on isolated phases and related species (bodies deposited by RER in cytoplasm. transported to vacuoles for growth by fusion and vesicular addition; Golgi route minor)5-10 Early events in the pathway appear to be constant regardless of environment or cultivar, although the rate of protein deposition was increased by elevated temperature. Two different types of protein body aggregation were observed at the end of grain filling, probably affected by environment and genotype, leading to a predisposition to vitreous or mealy endosperm texture (ultimately dependant on drying conditions). Observations into the mechanism of starch-protein matrix formation during drying were especially interesting, with microscopy implying the presence of an active mechanism for water removal from the centre of the wheat caryopsis during maturation. The drying and maturation of the caryopsis are critical for acquisition of many mature quality characteristics and are affected by environmental conditions. Further work is required to elucidate the exact relationship between environment, water loss and quality.
50
Wheat Structure, Biochemistry and Functionality
References I.
51.
P. I. Payne, K. G. Corfield, L. K. Holt and 1. A. Blackman, 1. Sci. Fd. Agric. , 1 98 1 ., 32,
2 . R. Graybosch, S . Yong-Weon and 1. Petersen, 'Proceedings of the 5th International Workshop on Gluten Proteins, Detmold 1 993', Arbeitsgemeinschaft Getreideforschung, 1 994. 3.
C. Blumenthal, E. W . R . Barlow and C. Wrigley, Nature, 1 99 1 , 347, 20.
4.
C. Blumenthal, E. W. R. Barlow and C. Wrigley, 1. Cer. Sci. , 1 993, 18, 3 .
5.
M . L. Parker, 1. Cer. Sci. , 1 985, 3, 27 1
6.
H. L. Levanony, R. Rubin, Y. Altschuler and G. Galili, 1. Cell Bio!.. 1 992, 1 19, 1 1 1 7.
7.
M. L. Parker, Plant Cell Envt. , 1 982, 5, 37.
8.
D . B . Bechtel, R . L. Gaines and Y. Pomeranz, Cereal Chern. , 1 980, 59 (5), 226.
9.
D. B. Bechtel and R. L. Gaines, Amer.
1.
Bot. , 1 982, 69 (5), 880.
1 0. L. G. Briarty, C. E. Hughes and A. D. Evers, Annals oj Botany, 1 979, 44, 64 1 . I I . M. L . Parker and Hawes, Planta, 1 982, 1 54, 277. 12. K. Tilley, G. Lookhart and C. Hoseney, Cereal Chern. , 1 993. 1 3 . 1. S. D. Graham, R. K. Morton and 1. K. Raison, A ust. 1. Bioi. Sci. , 1 962, 16 (2), 376. 1 4. 1. A. Parish and N. 1. HaIse, A ust. 1. Agric. Res. , 1 968, 19, 365
Wheat Protein Structure and Functionality
THE STRUCTURES OF WHEAT PROTEINS
A.S. Tatham
IACR-Long Ashton Research Station Department of Agricultural Sciences University of Bristol Long Ashton Bristol BS18 9AF
1 INTRODUCTION Cereal protein chemistry has a long history, starting in 1 745 when Beccari described the separation of wheat flour into starch and glutenl. Osborne classified the proteins into solubility groups2 and wheat gluten proteins were among the first proteins to be studied using the developing physical techniques in the 1930's and 1940·s3•4•5• Despite this early start in the field of protein chemistry we still know relatively little about the detailed three-dimensional structures of cereal prolamins. There are a number of reasons for this, the prolamins comprise a complex heterogenous mixture encoded by large multigene families, purifying sufficient quantities of a single pure component is quite difficult. Their solubility characteristics are unusual, being soluble in aqueous alcohols, some requiring the presence of reducing agents to break intermolecular disulphide bonds to reduce complex polymers to single components. Despite this we do have considerable information about prolamin structure from combining information from a number of different techniques. from cDNA and gene derived sequences, structure prediction and different spectroscopic methods. The prolamins of wheat can be classified into three groups on the basis of their amino acid sequences, the high molecular weight (HMW) subunits of glutenin, the or gliadins (S-poor) and the al{3-, y- and low molecular weight (LMW) subunits of glutenin (S-rich) . This nomenclature does not precisely correspond to the gliadin/glutenin classification which is based on the ability to form inter-molecular disulphide bonds, S rich prolamins are found in both groups. In contrast the S-poor and HMW prolamins are present only in the gliadin and glutenin fractions, respectively. This paper describes the present knowledge of the structures of the prolamins of wheat. We have protein sequences for a whole range of wheat prolamins. apart from the orgliadins for which we have no complete sequences. and LMW subunits of glutenin, for which we have a few sequences. The studies of the orgliadins are based on studies of the homologous proteins from barley. the C hordeins for which gene sequences are available.
Wheat Structure. Biochemistry and Functionality
54
2 THE HMW SUBUNITS OF GLUTENIN The HMW subunits of glutenin are the most widely studied group of prolamins, as allelic variation in their composition is correlated with breadmaking qualitt. They are encoded by a small multigene family and, therefore, do not show the heterogeneity associated with other prolamin groups. This has enabled the isolation and characterization of a number of HMW genes encoding expressed proteins. The proteins have M,s ranging from 67,500 to 88,000 and all are rich in glutamine ( - 35 mol%) , glycine ( - 20 mol%) and proline ( - 10 mol%)1. They consist of three domains; a central repetitive domain varying in length from about 440 to 680 residues, flanked by non-repetitive N- and C-terminal domains of 81-104 and 42 residues, respectively. The N- and C-terminal domains contain most or all of the cysteine residues. Two types of HMW subunits can be defined by their sequences, low M, x-types and high M, y-types (Fig 1 . ) . They differ in their N-terminal domains and in their repeat motifs7• Both contain hexapeptides (consensus PGQGQQ) and nonapeptides (x-type consensus GYYPTSLQQ and y-type consensus GYYPTSPQQ) and in x-types only a tripeptide (consensus GQQ) .
1 Dx 5 NH2
1
���PEA;:S�
89
785 827
II\ SH SH SH SH
1
� COOH
SH
Figure 1 Domain structure of x- andy-type subunits (cv. Cheyenne) The secondary structures of the HMW subunits have been studied using predictive methods, indicating that the repetitive domains consist predominantly of overlapping f3turns, with an absence of a-helix or f3-sheet structure (Fig 2)8. Circular dichroism (cd) and infra-red (IR) studies of synthetic peptides corresponding to the two repeat motifs confirm the presence of f3-turns in solvents of a low dielectric constant, in water the structures being random or extended9• The shape of the molecules in solution have been determined by intrinsic viscositylo and small angle X-ray scatteringll in different solvents, both of which indicate highly asymmetric molecules. From intrinsic viscosity measurements in 50% (v/v) aqueous propan-l-01 of subunit IBx20, a rod-like structure 49 x 1 . 8nm (axial ratio 27: 1) was determinedlO, and from SAXS in the same solvent but with another single subunit, dimensions of 57 x 8nmll . The larger diameter from the
55
Wheat Protein Structure and Functionality
SAXS data probably indicates aggregation as indicated by the large partial specific volume of the protein . Further evidence for an extended structure came from scanning tunneling microscopy (STM) , where two dimensional arrays of aligned HMW subunits , on Fourier deconvolution, showed a spiral structure with a diameter of about 1 .8nm and a pitch of 1 . 5nm12• The N- and C-termini of the molecules could not be visualised and the length of the molecules could, therefore, not be determined. The intrinsic viscosity, SAXS and STM results all indicate that the HMW subunits have extended structures, the different studies giving similar lengths for the molecules. I Dx5
lDylO
PGQGQQ GQQ
PGQGQQ GYYPTSLQQ
2-=---PGQGQQ GQQ -=----PGQGQQ �-
Q
-==--- -PGQGQQ
---- --
-
-
QGQGQQ GYYPTSLQQ
PGQGQP GYYPTSPQQ
PGQGQQ GHYPASLQQ
sGQ
PGQ
GQ;'GYYmsQ�
-=-
-
PTQ
Figure 2 Secondary structure prediction of the repetitive domains of x- and y-type subunits. Underlined tetrapeptides are predicted to form f3-turnsJ3•
On the bases of these studies it was proposed that the central repetitive domain adopted a helical structure based on {3-turns, similar to that formed by the synthetic polypentpeptide (VPGVG) repeat of the mammalian protein elastinl4. The synthetic polypentapeptide has been shown to form a so-called {3-spiral structure, which when covalently cross-linked, forms fibres which behave as elastomers, with an elastic modulus similar to that of native elastinl4. It was postulate that a similar mechanism of elasticity could account for the elastomeric properties of HMW subunits and elastins, since both proteins contain a large number of short repeated sequences capable of forming f3-turns. The HMW subunits possess the features required of an elastomer; high molecular weight, cysteine residues (for covalent cross-linking) located mainly in the N and C-termini, allowing the central repetitive domain to undergo deformation/reformation under stress and relaxation. In an NMR relaxation study Belton et al. 15 compared HMW subunit behaviour with increasing hydration and increasing temperature to that of elastin. On heating hydrated elastin coacervates; that is, the protein contracts and excludes water. The HMW subunits are also insoluble in water, but as the temperature is increased the behaviour is different to elastin, hydrogen bonds are disrupted and water uptake increases. This indicates that the hydrophobic interactions associated with elastin elasticity are not important in HMW subunit elasticity. Computer aided modelling has been used to look at secondary and tertiary structures in the repetitive regions of the HMW subunits. Matsushima et al.16 attempted to model the nonapeptide repeat (consensus GYYPTSPQQ) but generated a large number of possible structures, and concluded that there were too many degrees of freedom under the constraints of the system to defme a unique structure. Kasarda et alP compared the structures of elastin and repetitive domain of the HMW subunits. The results of modelling by secondary structure prediction, energy minimisation and chemical dynamic
56
Wheat Structure. Biochemistry and Functionality
calculations indicate the presence of inverse y-turns (three residues are involved in a y tum, rather than four as in a f3-turn) , rather than f3-reverse turns, producing a highly stable spiral structure. The diameter of the spiral was calculated as 2.4nm with a repeat of about O. 9nm. The spiral is stabilized by extensive hydrogen bonding of glutamine side chain amide groups to the backbone amide groups and to other glutamine side chain groups. The question as to whether the spiral structure consists of 13- or y-turns remains to be resolved. Techniques with high resolution such as NMR and crystallography are being persued to resolve the question. Most studies on the structure of HMW subunits, to date, have been carried on isolated proteins in solution, an environment unlike that of the 'native' state of the protein. In the seed and in dough systems the proteins exist as hydrated solids, in contact with water and other components such as starch and lipid. Perolet et al.IS studied Fourier transform (FT)-IR spectra of whole gluten in the hydrated solid state and concluded that hydrated functional gluten contains a considerable amount of intermolecular f3-sheet in addition to a-helix and f3-turn structures. They suggested that the elasticity could result from intermolecular interactions involving these sheet structures. Using NMR and FT-IR Belton et al. I9 studied the hydration of purified HMW subunits. In the dry state there was no evidence of f3-sheet structure; increasing hydration led to an increase in intermolecular f3-sheet and extended chain structures. Hydration increased hydrogen bonding between glutamine residues and water and allowed formation of hydrogen bonds with other glutamine residues and the backbone of the protein. The results indicate the co-existance of relatively ordered regions of intermolecular hydrogen bonding in equilibrium with disordered unbonded regions, the level of hydration affecting the formation and content of f3-sheet and extended chain structures. These structures may affect the elasticity of the HMW subunits in gluten and dough systems. There is no direct evidence that the HMW subunits of glutenin are intrinsically elastic, although they are associated with the elasticity of doughs and glutens. The development of transgenic wheats with increased levels of HMW (or chimeric HMW) subunits of glutenin have been reported20. This material should enable larger quantities of subunit to be purified for rheological studies to understand the basis of gluten elasticity. HMW subunits, both purified and expressed in E. coli, have been used in small scale mixograph stud4!s.and have been shown to affect dough rheology in different ways2 1 .22. Expression in E. coli or in transgenic plants should allow structure-function studies to be undertaken that have been difficult to persue due to the amounts of material required. The HMW subunits are only present in polymers with M,s in excess of 1 x 106, these polymers are stabilized by disulphide bonds, but little is known about which cysteine residues form intermolecular or intramolecular disulphide bonds. Patterns of disulphide bonding within and between HMW and LMW subunits have been reported2J. 25. The polymers also contain LMW subunits of glutenin linked via disulphide bonds. The number and distribution of the disulphide bonds would be expected to affect the elastomeric properties of the polymers, for example whether the polymers were highly branched or linear chain. There are still many questions as to the nature of the elastomeric mechanism(s) of glutenin polymers and the detailed secondary and tertiary structures of the proteins.
57
Wheat Protein Structure and Functionality
3 THE arGLIADINS The argliadins are quantitatively minor components accounting for about 10% of the total prolamins of wheat. To date no gene sequences have been reported for the ar gliadins, although some complete gene sequences are available for the homologous C hordein of barley and arsecalins of rye26• A limited number of argliadins have been purified and amino acid compositions determined, these indicate that the gliadins encoded by chromosomes l A and ID contain high contents of glutamine ( - 40mol%) , proline ( - 30mol%) and phenylalanine ( - 9mol%) ; whereas the IB encoded argliadins contain higher levels of glutamine ( - 50mol%) , lower levels of proline ( - 20mol%) and similar levels of phenylalanine ( - 9mol%) . They contain no cysteine residues and interactions with other components of gluten and doughs is by hydrogen bonding. The l A and I D encoded argliadins appear to have a repeat motif based on an octpeptide motif, consensus PQQPFPQQ (4Q:3P: IF) , whereas the repeat motif of the I B encoded argliadins is unknown (5Q:2P: IF) . N-terminal amino acid sequencing indicates similar sequences to the C hordeins of barley and arsecalins of rye26• A short N-terminal domain of about 1 2 residues, followed by two to three pentapeptide repeats and then the octapeptide repeat domain, with a short (four to ten residues) C-terminal domain. No accurate molecular weights for the argliadins are known, most methods apparently over estimate the molecular weights26.
NH21 [\\\\�\\\\\�\\\'i�COOH 12
374 378
Figure 3 Domain structure of an w-secalin from rye, homologous to the w-gliadins of wheat.
Most studies have been carried out on the C hordeins of barley and have been extrapolated to argliadins. Studies on the structure started with predictions of short N terminal sequences, where f3-turns were predicted in the pentapeptide region27. This was extended using the repetitive domain sequences to predict overlapping f3-turns and it was proposed that the proteins adopted a helical structure28• The presence of f3-turns and low
o P O O P FPOO
POOPFPOO POO
Figure 4 Secondary structure prediction of the octapeptide repeat of the w-gliadins. Underlined tetrapeptides predicted to form f3-turns13•
58
Wheat Structure, Biochemistry and Functionality
levels of a-helix and f3-sheet structure were consistent with cd spectra29,3O. Studies of a synthetic peptide based on the octapeptide repeat (GQPQQPFPQG) indicated a f3-tum structure in equilibrium with a poly-L-proline II-like structure (an extended left-handed helix with no intramolecular hydrogen bonds along the polypeptide backbone) 30. The amide groups of the glutamine residues and backbone are therefore available for intermolecular hydrogen bonding between adjacent molecules. Intrinsic viscosity measurements of C hordein indicate highly asymmetric moleculesll . Assuming a rod-shaped molecule, dimensions varied dependent on conditions, from 36 x 1 .7nm to 26.5 x 2. 0nmll . Other studies on the binding of fluorescent probes to argliadins indicated that they were non-globular and asymmetrid2• SAXS studies of C hordein indicated that they were stiff coils and behaved like worm like chains in solution, rather than as rigid rodsll. Scanning tunnelling microscopy (STM) of argliadins deposited onto a graphite substrate gave images of proteins with dimension of about 15 x 4nm34• This would suggest a different conformation in the solution and dry/partly hydrated solid states. FT-IR of arl gliadin in water indicated f3-sheet and f3-tum structure at 23mg/mll5. In another study FT-IR spectra of argliadins dissolved in acetic acid and hydrated with excess water were compared. In solution the major bands were associated with f3-tums, with less intense bands corresponding to a-helical, unordered and intermolecular f3-sheet. In the hydrated sample the f3-tum band was reduced with the helix and intermolecular f3-sheet bands increasedl8. In another FT-IR study dry argliadin was succesively hydrated with water; in the dry state the backbone appeared to be distorted by extensive hydrogen bonding involving the glutamine side-chains. With increasing water content these hydrogen bonds were broken by water molecules, giving rise to intermolecular f3-sheet structures. At high levels of hydration and in solution f3-tums and extended chain structures (probably involving proline residues) predominate36• The octapeptide repeat has been computer modelled on the basis of one or two f3turns per repeat and short sections of poly-L-proline II structurell. A number of structures were developed, all of which were elongated spiral structures with the capacity to form intermolecular (but not intramolecular) hydrogen bonds. The modelled structures are in general agreement with the structures determined in solution, particularly with those from viscometric and SAXS studies. The structure of C hordein in solution consists of a worm-like chains, with elements of f3-tum and poly-L-proline II-like structure. As the protein concentration increases protein-protein interactions increase and the gliadins form hydrogen bonds through the glutamine side-chains and the amide groups of the peptide backbone, increasing the content of intermolecular f3-sheet structure. Dependent on the level of hydration some extended chain structure also appears to be present in equilibrium with the f3-sheet and f3-tum structures. The results indicate that under different conditions ie. in solution and the dry solid the confomations of the argliadins and C hordeins may differ. The hydrated solid having a much more compact conformation (by STM) than the worm-like chains in solution (SAXS) . In glutens and doughs the argliadins can form hydrogen bonds with other prolamins, not being covalently bound into higher polymers they can contribute to the viscous flow of glutens and doughs.
Wheat Protein Structure and Functionality
59
4 THE alf3-, y-GLIADINS AND LOW MOLECULAR WEIGHT (LMW) SUBUNITS OF GLUTENIN
The S-rich prolamins are the major group of prolamins present in wheat. In wheat they can be classified broadly into three groups alf3-gliadins, y-gliadins and LMW subunits of glutenin. They are the most diverse in structure and include monomeric proteins containing intra-chain disulphide bonds and polymeric proteins with both intra chain and inter-chain disulphide bonds. They do have common structural characteristics, for example they all consist of two distinct structural domains. An N-terminal domain consisting of glutamine and proline-rich repeats; based on PQPQPFP + PQQPY (alf3gliadins) , PQQPFPQ (y-gliadins) and PQQQPPFPS + QQQQPVL (LMW subunits of glutenin) . The sequences are related to those in the C hordeins/wgliadins and are predicted to form f3-reverse turn structures. The C-terminal domains are non-repetitive and contain most, if not all of the cysteine residues, and the domains are predicted to be predominantly a-helical. The C-terminal domains are related between the different prolamins, the a-gliadin types contain two glutamine-rich regions (called polyGln) . The repetitive sequences account for between one third and one half of the whole proteins, which consist of 250-300 residues. The a-, f3- and y-gliadins appear to be compactly folded, but show some asymmetry32. One of the most studied groups is the A-gliadin group of a-type gliadins. The individual molecules are globular, with axial ratios of about 1 : 1 .437 and these aggregate under certain conditions of ionic strength and pH to form fibrils with diameters up to 8nm and lengths 300-40Onm38•39• The fibrils are probably mainly stabilized by hydrogen bonding with a contribution from ionic and hydrophobic interactions. The N-terminal repetitive domain forms f3-turns and poly-L-proline II-like structure, as determined by cd40•
a-
5
99
266
* y-
276
125
12
I I
** LMW
14
1 1"'1 1
"** **
I I
**
�COOH
285
89
NH21 t\\\\\\\1 !
�COOH
I 1 **
7\ I * **
1
I I
* >1,
I I"":
'r * *
I
*
I
*
�COOH
figure 5. Schematic representation of the domain structure of a-gliadin, y-gliadin and a LMW subunit ofglutenin. * Indicates a cysteine residue. The y-gliadins typically contain about 280 residues, the repetitive domain accounting for about one half of the sequence41•42, the repeat is related to that of the co-gliadins
Wheat Structure, Biochemistry and Functionality
60
(consensus PQQPFPQQ) minus one glutamine residue, PQQPFPQ. These sequences form {Hum and poly-L-proline II-like structures43• The C-terminal domain is predominantly a-helicaI43• Preliminary SAXS studies indicate a prolate ellipsoid with an axial ratio of anout 1 : 1 . 5 , while STM images of y-gliadins deposited onto a graphite surface indicated proteins with dimensions of about 10 x 3nm, with a slight broadening at one end44• The shape could result from the combination of a rod-shaped repetitive domain and a more compactly folded non-repetitive domain. Images of the protein deposited from a higher concentration produced a monolayer, with the long axis of the molecules lying perpendicular to the graphite surface44, forming an ordered array. Little information regarding the LMW subunits of glutenin is known despite being one of the major prolamin classes. They are divided into three groups B, C and Irs. B types subunits form a discrete group with two sub-classes called LMWs and LMWm on the basis of their N-terminal sequences46• The C-types are related to the a-type and y type gliadins, with additional cysteine residues for disulphide bond formation46• The D types appear to be related to the w-gliadins with the addition of cysteine residues47• A limited number of complete sequences are known and these are only for the minor forms of the LMW subunits. The proteins are difficult to purify in large amounts for physico chemical work, cd spectra of mixtures of LMW subunits would indicate a similar secondary structure content to the monomeric alf3-gliadins and y-gliadins48•
5 CONCLUSIONS This paper has concentrated on the structure of the prolamins of wheat, this work being stimulated by an interest in the unique technological properties of wheat flours and doughs, particularly in relation to breadmaking. It is difficult to explain the basis of gluten viscoelasticity based on our present knowledge of protein structure and interactions. Gluten is a complex system and so far we have only started to study and understand protein-protein and protein-water interactions, a whole range of other interactions involving, for example, starch and lipids, are probably also important in determining physical properties. There is still a considerable amount to understand regarding some of the unique protein structures found within the cereal prolamins. The application of a number of different techniques, including rheology, should enable a better understanding as to the structure-function properties of the prolamins.
References 1. 2. 3.
4. 5. 6.
7. 8. 9.
J.B. Beccari , Inst. Acad. Comm. Bologna , 1745, 2, 122. T.B. Osborne, 'The Vegetable Proteins' , Longmans, Green and Co. , London, 1924. L. Krejci and T. Svedberg, J. Am. Chem. Soc. , 1935, 57, 946. O. Lamm and A. Poulsen, Biochem. J. , 1936, 30, 528. P.P. Entriken, J. Am. Chem. Soc. , 1941 , 63, 2127. P.1. Payne, Ann. Rev. Plant Physiol. , 1987, 38, 141 . P.R. Shewry, N.G. Halford and A.S. Tatham, J. Cereal Sci. , 1992, 15, 105. A.S. Tatham, P.R. Shewry and B.J. Miflin, FEBS Lett. , 1984, 177, 205. A.S. Tatham, A.F. Drake and P.R. Shewry, J. Cereal Sci. , 1990, 1 1 , 189.
Wheat Protein Structure and Functionality
61
10. J.M. Field, A.S. Tatham and P.R. Shewry, Biochem. J. 1987, 247, 215. 1 1 . N. Matsushima, G. Danno, N. Sasaki and Y. Izumi , Biochem. Biophys. Res. Commun. 1992, 186, 1057. 12. M.J. Miles, H.J. Carr, T. McMaster, K.J. I' Anson, P.S. Belton, V.J. Morris, J.M. Field, P.R. Shewry and A.S. Tatham, Proc. Natl. Acad. Sci. (USA) , 1 991 , 88 , 68. 13. P.Y. Chou and G.D. Fasman, Ann. Rev. Biochem. , 1978, 47, 251 . 14. D.W. Urry, J. Prot. Chem. , 1988, 7, 1 . 1 5 . P.S. Belton, I.J. Colquhoun, J.M. Field, A . Grant, P.R. Shewry and A.S. Tatham, J. Cereal Sci. , 1994, 19, 1 15. 16. N . Matsushima, C.E. Creutz and R.H. Kretsinger, Proteins, 1990, 7, 125. 17. D . D . Kasarda, G. King and T.F. Kumosinski, ACS Symposium Series 576
'Molecular Modeling: From Virtual Tools to Real Problems' , American Chemical Society 1994, Chapter 13, p. 209. 18. M. Pezolet, S. Bonenfant, S. Dousseau and Y. Popineau, FEBS Lett. , 1992, 299, 247. 19. P.S. Belton, I.J. Colquhoun, J.M. Fild, A. Grant, P.R. Shewry, A.S. Tatham and N . K. Wellner, Int. J. Bioi. Macromol. , 1995, 17, 74. 20. J.T. Weeks, O.D. Anderson and A.E. Blechl, Plant Physiol. , 1993, 102, 1 077. 2 1 . F. Bekes, P. W. Gras, R. Gupta, D.R. Hickman, D.R. and A.S. Tatham, J. Cereal Sci. , 1994, 19, 3. 22. F. Bekes and P.W. Gras, 'Gluten Proteins 1993' Association of Cereal Research, Germany, 1993, 170. 23. P. Kohler, H.D. Belitz and H. Wieser, Z. Lebensm. Unters Forsch , 199 1 , 192, 24.
234. P. Kohler, H.D. Belitz and H. Wieser, Z. Lebensm. Unters Forsch , 1993, 196,
239. 25 . H.P. Tao, A.E. Adalsteins and D.D. Kasarda, Biochim. Biophys. Acta , 1992, 1 159, 13. 26. A.S. Tatham and P.R. Shewry, J. Cereal Sci. , 1995, In press. 27. J.C. Pernollet and J. Mosse, Int. J. Peptide Prot. Res. , 1983, 22, 1 3 1 . 28. A.S. Tatham, A.F. Drake and P.R. Shewry, Biochem. J. , 1985, 226, 557. 29. A.S. Tatham and P.R. Shewry, J. Cereal Sci. , 1985, 3, 103. 30. A.S. Tatham, A.F. Drake and P.R. Shewry, Biochem. J. , 1989, 259, 471 . 3 1 . J.M. Field, A.S. Tatham , A.M. Baker and P.R. Shewry, FEBS Lett. , 1986 , 200, 32. 32. Y. Popineau and F. Pineau, Lebens. Wis'sen. Technol. , 1988, 2 1 , 1 13 . 3 3 . K.J. I' Anson, V.J. Morris, P.R. Shewry and A.S. Tatham, Biochem. J. , 1992, 287, 183. 34. P.R. Shewry, M.J. Miles and A.S. Tatham, Prog. Biophys. Mol. Bioi. , 1 994, 6 1 , 37. 35. J.M. Purcell, D.D. Kasarda and C.S.C. Wu, J. Cereal Sci. , 1988, 7, 2 1 . 36. N . K . Wellner, P.S. Belton and A.S. Tatham. Submitted. 37. E.W. Cole, D.D. Kasarda and D. Lafiandra, Biochim. Biophys. Acta , 1984, 787, 44. 38. D.D. Kasarda, J.E. Bernardin and R.S. Thomas , Science , 1967, 155 , 203. 39. J.E. Bernardin, D.D. Kasarda and D.K. Mecham, J. Bioi. Chem. , 1967, 242 , 445. 40. A.S. Tatham, M.N. Marsh, H. Wieser and P.R. Shewry, Biochem. J. , 1990, 270,
62
Wheat Structure. Biochemistry and Functionality
313. 41 . J.A. Rafalski , K. Scheets, M. Metzler, D.M. Peterson, C . Hedgecoth and D . SoU, EMBO J. , 1984, 3, 1409. 42. T.W. Okita, V. Cheesbrough and C.D. Reeves, J. BioI. Chern. , 1985, 260, 8203 . 43 . A.S. Tatham, P. Masson and Y. Popineau, J. Cereal Sci. 1990, 1 1 , 1 . 44 . N.H. Thomson, M.J. Miles, A.S. Tatham and P.R. Shewry, Ultrarnicro. , 1992, 42-44, 1 204. 45. P.I. Payne and K.G. Corfield, Planta , 1979, 145, 83. 46. E.J.-L. Lew, D.D. Kuzmicky and D.D. Kasarda, Cereal Chern. , 1 992, 69, 508. 47. S . M . Masci, E. Porceddu, G. Colaprico and D. Lafiandra, J. Cereal Sci. , 1 991 , 14, 35. 48. A.S. Tatham , J.M. Field, S.J. Smith and P.R. Shewry, J. Cereal Sci. , 1987, 5 , 203.
DISULFIDE BONDS OF a- AND V-TYPE GLIADINS
H. Wieser and S. MOller Deutsche Forschungsanstalt fur Lebensmittelchemie and Kurt-Hess-Institut ffir Mehl- und EiweiBforschung LichtenbergstraBe 4, D-85748 Garching, Germany
1 INTRODUCTION Gliadin, the alcohol soluble protein fraction of wheat flour and gluten, consists of numerous monomeric proteins. They can be classified into three different types (a-type, v-type, w type) according to the primary structure. Whereas W-type gliadins are mainly free of cysteine, most of the a- and v-type gliadins contain six and eight cysteine residues, respec tively. Two cysteine residues are located in domain
V, the others in domain III (designation
1 of domains according to Kasarda et al. ). Within these domains, a- and v-type gliadins show a high degree of sequence homology. Because of the absence of free sulfhydryl groups, it can be assumed that all cysteine residues are linked by intramolecular disulfide bonds. So far, no direct experimental proof for the locations of disulfide bonds has been available; therefore, two a-type gliadins and one v-type gliadin isolated from gluten have been investigated. 2 EXPERIMENTAL Gliadin was extracted from gluten of the wheat variety Rektor with 70 % (vIv) aqueous 2 ethanol adjusted to pH 5.5 with acetic acid and then separated by preparative RP-HPLC on C 16 h.
18
3 silica gel . Single gliadins were digested with th�rmolysin at 37°C and pH 6. 0 for
The
digests were
analysed
for
cysteine peptides
by
differential
RP-HPLC
2 (chromatography prior to and after reduction of disulfide bonds) on C l a silica gel . The cystine peptides detected were isolated, reduced and alkylated with 4-vinylpyridine. The resulting cysteine peptide derivatives were analysed for their amino acid sequences using a pulsed liquid protein sequencer. 3 RESULTS AND DISCUSSION Gliadin obtained from gluten of the wheat cultivar Rektor was separated by preparative RP HPLC into 15 a-type (peaks 1-15) and 8 V-type (peaks 16-23) components (Figure 1). Peak
64
Wheat Structure, Biochemistry and Functionality
3 (a3-gliadin), peak S ( as-gliadin) and peak 17 (V17-gliadin), which appeared pure on the basis of rechromatography on C silica gel, were selected for the analysis of disulfide bonds. s The proteins were digested with thermolysin at pH 6. 0 to minimise sulfhydryl/disulfide 2 exchange reactions, and the digests were analysed by differential RP-HPLC . Two cystine peptides (a3
23/26) were detected in the digest of a3-gliadin, three cystine peptides Th
(aSTh9/ 1 1 / 12) in the digest of as-gliadin and three cystine peptides (V17 9/ 1 1 / 17) in the Th digest of V 17-gliadin. After preparation and purification by RP-HPLC, these eight peptides were reduced and alkylated with 4 -vinylpyridine. A further HPLC separation demonstrated that the cystine peptides consisted of two or three fragments (cysteine peptides), which then were isolated and analysed for amino acid sequences. The sequences and linkage types are shown in Table 1 . Peptide a3
23 was composed Th
of three fragments connected by two disulfide bonds. The order of attachment to the 26 adjacent cysteine residues of the fragment a3 23-2 was not determined. Peptide a3 Th Th consisted of two fragments linked by one disulfide bond. The sequences determined were 4 identical with corresponding sequences of the a-type clone A1235 (cv. Cheyenne) . Thus, 4 I 120 ) and C2 1 are linked to the adjacent residues C 150 /e 5 1 and cysteine residues 120 (C 4 2 9 residue C 163 is linked to C .
16 17
21 22
5
1.5
7
4
1.0
8
20
13 9
11 18
6
3 0.5
23 •• • • • •• • • • • • • • •
20
Figure 1 Preparative RP-HPLC ofgliadin (cv. Rektor)
••
40
60
min
65
Wheat Protein Structure and Functionality
The cystine peptides aSTh 1 1 and aSTh 1 2 derived from as-gliadin have structures homologous to the peptides of a3 -gliadin. They were identical to the corresponding sequen ces of a-type clone A212 (cv. Cheyennel As a consequence, residues C 123 and C252 are linked to the residues c 1 53 /c 154, and residue c 1 66 is linked to residue C260. An additio
nal cystine peptide (aSTh9) detected in the digest of as-gliadin was homologous to peptide
aSTh 1 1 . The only difference was found at position 4 of the fragment 9-1 (E instead of Q). Glutamic acid has not been described at this position in the literature until now. It is possible that a glutamine residue at this position was deamidated during the preparation procedure, or that peak S of the gliadin separation contained two different proteins modified at least at this position. Table 1 Amino acid sequences and linkage types ofcystine peptides from a- and V-type gliadins
Cystine peptides
a3 Th 2 3
a 3 Th 2 6 --
- -
-----
aS Th 9
aS Th l l
aS Th 1 2 --------V 1 7 Th 9
V 1 7 Th l l
V 1 7 Th 1 7
Fragments
23-1
Sequences
23-3 23-2
26-1
I PCXD I
-
---
ttQQb
L
-
-----
12 - 2 --------
LPAMCN
tt
L QQb -----------------------LQC
I
9-2
VYVPPECS
11-1
11-3 11-2
LNPCKN I
ttQEb
LQQCKP
I
IWPQSDCQ
a See Fig. 2. b The order of attachment to CC was not determined.
Ce ,
cy
Cf 1Cf2
--------CW CZ
LQTLPTMCN
VMQQQ
CZ --------CW
CZ
L I PCRD I
Cf lCf 2
CW
VYIPPYCT 12 - 3
cy
CZ
I
- - -
17 - 2
-
SRCQA
12 - 1
Ce ,
CW
I
11-2
17 - 1
I
VYI PPYCT
11-1
9-1
I
VYI PPYCSTT --------- -------SRCEA
9-2
-
LPAMCN
FQI PEQSXCQA
26-2 ----------9-1
--
Linkage typea
I
Ce ,
cy
Cf l Cf 2 Cd Ce
66
Wheat Structure, Biochemistry and Functionality
a
- type
W C
I
I II I
I
:m
I
C TIl
"
cc-cf1 cf 2
y.
Z
I
I
cy
y - t ype I
I
:nr
"
I NI
y.
I
Cc - C f1 C f2 ---- C y Figure 2 Schematic disulfide bond structure of 0'- and V-type gliadins (designation of domains according to Kasarda et al. 1 and of cysteine residues according to Kohler et al. 6)
The thermolytic digest of V17-gliadin contained three cystine peptides. One of them (V17Th 1 1) was composed of three fragments linked by two disulfide bonds, each of the others (V17Th9, V17Th 17) consisted of two fragments and had one disulfide bond. Five out
of seven cysteine peptides (9-1, 9-2, 1 1-3, 17-1, 17-2) were identical to sequences present in V-type clone pTag143 6 (cv. Chinese Spring)5, the remaining peptides (1 1-1, 1 1 -2) were modified in one or two positions.
The results obtained until now indicate that the homologous cysteine residues of 0'- and V-type gliadins are connected by the same intramolecular linkage types (Table 1, Figure 2). Common are three disulfide bonds, which reflect one loop within domain III (cysteine residues CC/Cft or Cf2) and two loops between domain III and V (ef1 or Cf2/cY and CW /CZ). V-Type gliadins contain an additional loop within domain III (CdICe). It can be assumed that the intramolecular disulfide bonds of 0'- and V-type gliadins are not formed randomly but strongly directed. The two-dimensional models shown in Figures 3 and 4 give an indication of the structural features and relationship of 0'- and V-type gliadins within the domains III, IV and V. Remarkably, the six (Q1-type) and eight (V-type) cysteine residues are concentrated to a relatively small area. Two small rings and a big ring are formed by the three disulfide bonds present in the Q1-type. In the case of the v-type, the first ring of the 0' type is divided into two smaller ones by an additional disulfide bond. Comparing the different 0'- and V-type gliadins described in the literature, the sizes of the small rings are generally constant; the big ring, however, is variable in size.
Wheat Protein Structure and Functionality
67
Figure 3 Partial two-dimensional structure of OI.-type gliadin (domains III-V of clone A 123s4)
Corresponding linkage types have also been found in glutenin-bound V-gliadins (CcICfl or Cf2, CdICe, Cfl or Cf2IcY, CWICZ) and LMW subunits of glutenin (CCICfl or Cf2, CdICe, d1 or Cf2Icy)6,7. For reasons of homology, it has been proposed that these bonds
are also intramolecular. Compared with monomeric V-type gliadins, glutenin-bound V gliadins have an additional cysteine residue Cb * within domain I, which is linked to aggregated LMW subunits. For the aggregative nature of LMW subunits, the cysteine
68
Wheat Structure, Biochemistry and Functionality
200
Figure 4 Partial two-dimensional strncture of V-type gliadin (domains III- V of clone
p Tag14365)
* residues eb of domain I and eX of domain IV appear to be responsible. They are absent in
monomeric
Ci.-
and V-type gliadins. In contrast to intramolecular disulfide bonds, different
linkage types have been found for the intermolecular disulfide bonds of LMW subunits; * thus, eX is linked with eb of LMW subunits or glutenin-bound v-gliadins or with cY of y type HMW subunits7.
Wheat Protein Structure and Functionality
69
References 1.
D.D. Kasarda, T.W. Okita, J.E. Bernardin, P.A. Baecker, C.C. Nimmo, E.J.-L. Lew, M.D. Dietler and F.C. Greene, Proe. Natl. Aead. Sci. USA, 1984, 81, 4712.
2.
P. Kohler, H.-D. Belitz and H. Wieser, Z. Lebensm. Unters. Forseh. , 1991, 192, 234.
3.
H. Wieser, W. Seilmeier and H.-D. Belitz, ]. Cereal Sci. , 1994, 19, 149.
4.
T.W. Okita, V. Cheesbrough and C.D. Reeves, J. BioL Chem. , 1985, 260, 8203.
5.
D. Bartels, J. Altosaar, N.P. Harberd, R.F. Barker and R.D. Thompson, Theor. AppL
Genet. ,
1986, 72, 845.
6.
P. Kohler, H.-D. Belitz and H. Wieser, Z. Lebensm. Unters. Forseh. , 1993, 196, 239.
7.
B. Keck, P. Kohler and H. Wieser, Z. Lebensm. Unters. Forseh. , 1995, 200, 432. Acknowledgement
This work was supported by the FEI (Forschungskreis der Ernahrungsindustrie e.V., Bonn), the AlF and the Ministry of Economics, Project No.: 8684.
PURIFICATION AND CHARACTERISATION OF l Bx AND l By HIGH M r GLUTENIN SUBUNITS FROM DURUM WHEAT CULTIVAR LIRA
F. Buonocore, C. Caporale and D. Lafiandra Department of Agrobiology and Agrochernistry, University of Tuscia, Via S. Camillo de Lellis, 0 1 1 00 Viterbo, Italy
1 INTRODUCTION The glutenin fraction is essential for the viscoelastic properties of wheat flour doughs. This fraction is usually divided into two types of subunits depending on their electrophoretic mobilities in SDS-PAGE under fully reduced conditions. The subunits with the slowest mobilities are referred to as high M glutenin subunits and the group with r faster mobilities as the low M glutenin subunits. The high M glutenin subunits are one of the most widely studied group of wheat prolamins, mainfy because of their role in determining breadmaking quality of wheatl,2. They are encoded at the Glu-I loci on the long arm of group 1 chromosomes (lA, IB e l D). Molecular analyses have indicated that each locus consists of two tightly linked genes encoding a low M y-type subunit and a high M x-type subunit3.
In particular, two all�les were reported at the Glu�Bl locus possessing only the x-type subunit, namely subunits 7 and 20. More recently, based on reversed phase high performance liquid chromatographic analyses, it has been shown that subunit 20 is accompained by another subunit, termed 2Oy, whose chromatographic behaviour is typical of the y-type subunits4. Moreover, same chromatographic data allowed to hypothesize that subunit 20 possesses only two cysteine residues compared to the other x-type
subunits that usually contains four cysteine residues (five in I DxS only). This last hypothesis was confirmed by Morel and Bonicel5 by electrophoretic data. We report here the purification and characterization of the high M glutenin subunits present in the durum wheat cultivar Lira to confirm the presence of a y-type subunit accompanying subunit 20 and to determine number and position of cysteine residues in subunit 20.
2 EXPERIMENTAL 2. 1 Purification of subunits 20 and 20y High M glutenin subunits 20 and 20y were purified from the durum wheat cultivar Lira. They �ere extracted from flour with a procedure based on Marchylo et al. 6 and purified by RP-HPLC using the System Gold (Beckman) apparatus, with a model 1 26 solvent delivery system and a model 166 detector. Proteins were separated on a Vydac Cs
Wheat Protein Structure and Functionality
71
semi-preparative column at 50 °c with a 30 minutes linear gradient of 28-35% (v/v) aqueous acetonitrile containing 0.05% TFA at a flow rate of2.5 mVmin. Amino acid analyses were performed with the Pico-Tag Work Station and the N terminal amino acid sequencing with a pulsed-liquid amino acid sequencer (model 477A, Appli� Biosystems). 2.2 Determination of cysteine peptides in subunit 20
The purified subunit 20 was reduced and alkylated in a single step according to Kelso et al. 7. The reduction was performed adding tributylphosphine and the alkylation using the fluorogenic agent 7-fluoro-4-sulfamoyl-2, I ,3-benzoxadiazole (ABD-F)8; both reagent were added in lar e excess over the supposed number of -SH groups. The reaction was performed at 50 C for 10 min. The sample was promptly injected into the RP-HPLC system above mentioned modified by the addition of a spectrofluorescence detector with a xenon source (Shimadzu Fluorescence HPLC-Monitor RF-530) connected in series with the UV absorption detector. Excitation wavelenght was at 385 nm; emission was monitored at 5 1 5 nm. Elution conditions were the same as those used for the purification step. The peak corresponding to subunit 20 was collected and freeze-dried. The protein, alkylated with ABD-F, was then digested with trypsin in a ratio (w/w) 1 :25 at 37 °c for 6 hours. Peptides were fractionated by RP-HPLC, at room temperature, with a 200 min linear gradient of 5-35% aqueous acetonitrile containing 0.05% (v/v) trifluoroacetic acid at a flow rate of 1 . 5 mVmin, detecting both UV absorption and the fluorescence. Peaks showing fluorescence were collected and sequenced.
§
3 RESULTS 3 . 1 Amino acid compositions and N-terminal sequences of subunits 20 and 20y The amino acid composition of subunit 20 is slightly different from that presented by Tatham et al.9 for the same subunit purified from the durum wheat cultivar Bidi 17. The higher level of histidine, tyrosine and methionine and the lower level of proline and phenilalanine make the composition of subunit 20 from cultivar Lira more similar to that of subunit IBx7 present in bread wheat. The amino acid composition of subunit 20y from Lira is similar to that of y-type subunits 8 and 16 from durum wheat and consistent with that of the other y-type subunits. The N-terminal amino acid sequence of subunit 20 (34 residues) is identical with that of subunit 20 from Bidi 1 79 (Fig. 1 ), except that glutamic acid was found at positions 13 and 18 of subunit 20 from Bidi 1 7, while glutamine was recovered in subunit 20 from Lira, and that glutamine substitutes arginine in subunit 20 from Lira at position 3 1 . The former substitutions might result from experimental errors, the latter could be the result of a point mutation.
72
Wheat Structure. Biochemistry and Functionality 1
10
20
2 0a E-G-E-A- S -G-Q-L-Q-C-E -R-Q-L-R-K-R-Q-L-E-A-Y-Q-Q30
V-V-D-Q-Q-L-Q-D-V-S b 1
20
10
20
E- G-E-A- S -G-Q-L-Q-C-E-R-E - L-R-K-R-E-L-E-A-Y-Q-Q30
V-V-D-Q-Q-L-R- D-V- S Figure 1 . Comparison of N-terminaJ. amino acid sequences of subunits 20 from cuJtivar Lira f) andfrom cuJtivar Bid; J 7 f). Differences are bolded The N-tenninal amino acid sequence of subunit 20y (35 residues) is identical with that of the y-type subunit 89 (Fig. 2), except that glutamate was recovered at positions 1 1 , 1 3, 16 and 20 of subunit 8 and glutamine in subunit 2Oy, and more generally with that of the other y-type subunits. 1
10
20
2 0y E -G-E-A- S -R-Q- L-Q-C-Q-R-Q-L- Q-Q- S - S - L-Q-A-C -R-Q30
V-V- D-Q-Q- L-A-G-R-L- P B
1
10
20
E - G-E-A-S -R-Q-L-Q-C-E -R-E -L-Q-E - S - S -L-E-A-C -R-Q30
V-V- D-Q-Q-L-A-G-R-L-X Figure 2. Comparison of N-terminaJ amino acid sequences of subunits 20y and 8. Differences are bolded
3 . 2 Detennination of cysteine residues in subunit 20 Tatham et al.9 hypothesized that subunit 20 lacks two cysteine residues in the N terminal region in contrast with the other Bx-type subunits, which could be the result ot
two independent Cys to Tyr substitutions due to two point mutations. To detennine the number and the position of cysteine residues of subunit 20, the purified subunit was alkylated with ABD-F, which reacts with thiol groups and specifically labels the cysteine residues present in the proteins. Among the different peptides obtained after the digestion with trypsin of the alkylated subunit, only two showed fluorescence. These peptides were collected and sequenced. Peptides 1 belongs to the C-tenninal region of subunit 20; its amino acid sequence (Fig. 3 ) is, in fact, identical to the same region of
Wheat Protein Structure and Functionality
73
subunit IBx7 and very similar to that of the other x-type subunits. Peptides 2 (Fig.3) matches the N-ternrinal region of subunit 20. A- Q-Q-L-A-A-Q-L-P-A-M-C-R
peptide 1
�-A-Q-Q-L-A-A-Q-L-P-A-M-C-�- L-E-G-S -D-A-L-S- T-R-Qa E-G-E-A- S-G-Q-L-Q-C-E-R E-G-E-A- S - G-Q-L-Q-C-E- �-Qb
peptide 2
a Figure 3 . Amino acid sequences of fluorescent peptides of sgbunit 20. C-terminal sequence of subunit 7from nucleotide sequence of cloned gene. N-terminal sequence of subunit 20. The underlined amino acids are the cleavage sites of trypsin; the cysteine residues are bolded 4 CONCLUSIONS
Present results confinn that an expressed y-type subunit is associated with subunit 20. Moreover, it is definitively proved that subunit 20 possesses only two cysteines residues, one in the N-ternrinal region and the other in the C-tenninal domain. Owing to its structural characteristics, subunit 20 provides a valuable model to determine the influence of number and position of cysteine residues in the pattern of disulphide bond formation of the glutenin polymers.
References 1 . Payne, P. I., Corfield, K.G. and Blackman, lA, Theor. Appl. Genet. 1 979, 55, 1 53 . 2 . Payne, P. I., Corfield, K.G., Holt, L.M. and Blackman, lA, J. Sci. Food Agric. 1 98 1, 32, 5 1 . 3 . Harberd, N.P., Bartels, D . and Thompson, R .D., Biochem. Genet. 1 986, 24, 579. 4. Margiotta, B., Colaprico, G., D'Ovidio, R. and Lafiandra, D., J. Cereal Sci. 1993, 17, 22 1 . 5 . Morel, M.H. and Bonicel, l,."Wheat Kernel Protein: Molecular and Functional Aspects", Universita della Tuscia, C.N.R., Viterbo, p. 1 83, 1994. 6. Marchylo, B.A., Kruger, IE. and Hatcher, D.W., J. Cereal Sci. 1 989, 9, 1 1 3 . 7 . Kelso, G.l, Kirley, T.L. and Harmony, lAK, "Techniques in Protein Chemistry", Vol. II (J.J. Villafranca, ed.), Academic Press, New York, 1 99 1 . 8. Masci, S., Lafiandra, D., Porceddu, E., Lew, EJ.-L., Tao, H.P. and Kasarda, D.D., Cereal Chem. 1 993, 70, 58 1 . 9 . Tatham, AS., Field, 1M., Keen, IN., Jackson, PJ. and Shewry P.R., J. Cereal Sci. , 1 99 1 , 14, 1 1 1 .
FURTHER ANALYSIS OF THE CARBOHYDRATES ASSOCIATED WITH HIGH Mr SUBUNITS OF WHEAT GLUTENIN
K.
A. Tilley and 1. D. Schofield
Montana State University, Department of Plant, Soil and Environmental Sciences, Bozeman, MT 597 1 7, USA and The University of Reading, Department of Food Science and Technology, P.O. Box 226, Whiteknights, Reading RG6 6AP, UK.
INTRODUCTION The glutenin proteins of wheat have been studied intensively due to their direct involvement in the variation that occurs in the bread making potential amongst different cultivars. Many proteins are co- or post-translationally modified, and those modifications play vital roles in the structures of those proteins. Only recently have such modifications been detected within the structure of the glutenin proteins with the discovery that the high Mr glutenin subunits are glycosylated I . The sugars found associated with those subunits were glucose (Glc), mannose (Man) and N-acetylglucosamine (GlcNAc). It was assumed that, because of the presence of GlcNAc, the sugars were linked to the polypeptide backbone via a linkage to asparagine (N-linked). Such a mode of linkage is inconsistent with the sequences that have been deduced from the sequences of cDNA corresponding to the central domains of the high Mr glutenin proteins, however2. The sequences reported for the high Mr subunits do not include the necessary site for N-linked glycosylation, Asn-Xaa-SerlThr; in fact, asparagine residues are absent from the central repetitive domain. Recently, evidence was obtained indicating that the sugars associated with the high Mr glutenin subunits are bound via O-glycosidic linkages to serine and/or threonine (O-linkages) rather than through N-linkages3 Man, which was previously shown to be associated with high Mr subunits I , has been shown to be linked O-glycosidically (i.e. the carbohydrate moieties were covalently attached to the amino acids serine and/or threonine) to the backbone of high Mr. It remains to be seen whether mannose is linked to the proteins as single residues or possibly disaccharide or trisaccharide structures, which may include Man and/or G\CNAc. These data are consistent with the published sequences, and they help to rationalize the hypothesis that the high Mr glutenin subunits are glycoproteins with the published sequence data. The predicted glycosylation site is the repeat sequence Tyr-Tyr-Pro-Thr-Ser, which occurs several times throughout the central repetitive domain of high Mr subunits4.
Wheat Protein Structure and Functionality
75
2 METHODS AND RESULTS 2.1
Extraction and Lectin Analyses
Total glutenin extracts of the cultivar Chinese Spring were prepared from approximately 3 or 4 kernels, which had been freshly hand-ground. Selective extraction and fractionation by sodium dodecyl sulphate - polyacrylamide gel electrophoresis (SDS PAGE) were performed on the flour as described previously) . Lectin binding analyses, which were performed according to the procedure issued with the Glycan Differentiation kit (Boehringer Mannheim)', indicated positive reactions with Galanthus nivalis agglutinin (GNA) and with Datura stramonium agglutinin (DSA) as described previously),3. GNA is capable of binding both to N-linked terminal Man residues and to single O-linked Man residues6. DSA binds to terminal GaIB 1 �GlcNAC residues in heterosaccharide moieties linked N-g1ycosidically to asparagine or to single GlcNAc residues bound O-glycosidically to serine and/or threonine8. Galactose is not present in high M, glutenin subunits). Therefore, the lectin binding analyses, together with the amino acid sequence data reported previously, which indicated no N-linkage sites were present, suggested that the Man and GlcNAc were present as single sugar residues (or perhaps di- or trisaccharide moieties) linked O-glycosidically to serine and/or threonine residues. 2.2
Deglycosylation Using Enzymic and Chemical Methods
To investigate further the type of linkage by which the sugars were attached to the protein backbone, electroblots of SDS-PAGE fractionated high M, glutenin subunits were subjected to several specific deglycosylation procedures. When the blots were incubated with the enzyme N-Glycosidase-F (Oxford GlycoSystems) and the presence or absence of sugars was evaluated subsequently using the Glycan Detection system (Boehringer Mannheim), not all, if any, of the carbohydrate was removed from the proteins by this enzyme. Since N-Glycosidase-F cleaves N-glycosidic linkages specifically8, the results indicated that at least not all, if any, of the sugars associated with the high M, subunits were glycosidically linked to asparagine residues. The 13-elimination reaction specifically removes only carbohydrate moieties that are linked O-g1ycosidically. Electroblots of SDS-PAGE fractionated glutenin polypeptides were subjected to the 13-elimination reaction (2M NaBHJO. l M NaOH at 45°C for 1 6 h). Carbohydrate was detected using the Glycan Detection system. No carbohydrate was detected after the blots had been exposed to 13�elimination reaction conditions. A control blot was incubated with 2M NaBHJO. l M NaOH and stained for protein with Coomassie Brilliant Blue. The control indicated that protein remained on the blot after the incubation process. These results indicated, therefore, that the sugars associated with high M, glutenin subunits were likely to be linked O-glycosidically to serine and/or threonine residues. The enzyme 13-N-acetylhexosaminidase is capable of cleaving single GlcNAc residues from glycoproteins if those residues are linked O-glycosidically to serine and/or threonine but not N-g1ycosidically to asparagine9,1O. When electroblots of SDS-PAGE fractionated glutenin subunits were incubated with 13-N-acetylhexosaminidase (Oxford GlycoSystems) carbohydrate could not be detected using the Glycan Detection system indicating that all the carbohydrate had been removed from the glutenin polypeptides by the enzyme. A control blot, which was incubated with the enzyme buffer alone, gave a typical positive
Wheat Structure, Biochemistry and Functionality
76
reaction for carbohydrate with the Glycan Detection system. �-N-acetylhexosaminidase may be capable of removing single O-glycosidically linked Man residues as well as O-glycosidically linked GlcNAc residues although this has not been documented in the literature. The work with the deglycosylation methods, while intriguing, did not provide unequivocal evidence that the carbohydrates were involved in O-glycosidic linkages to the protein backbone. 2.3
Detection of O-linkages via �-Elimination and Alditol Acetate Derivatization
In order to provide more definitive evidence that the sugars associated with the glutenin polypeptides were linked to Ser/Thr residues, the following analyses were performed. Sugars were removed by �-elimination from electrophoretically purified glutenin polypeptides and their a1ditol acetate derivatives were analyzed at the Complex Carbohydrate Research Center, University of Georgia, by gas-chromatography-mass spectroscopy. The a1ditol forms of the sugars would be detected if they had previously participated in O-glycosidic linkages to the glutenin polypeptide backbone. For example, if Man had been O-Iinked directly to the polypeptide backbone, then mannitol would be detected, and if GIcNAc had been O-glycosidically linked to the polypeptide backbone, then N-acetylglucosaminitol would be detected. Recent results indicate that mannitol was detected providing direct evidence that Man was O-linked to the glutenin polypeptides. These results indicate that the glutenin polypeptides are true glycoproteins and provide evidence for the nature of the glycosylation type.
3
DISCUSSION
The exact sites of glycosylation are being investigated. However, we propose that these sites are likely to be the repeated Tyr-Tyr-Pro-Thr-Ser amino acid sequences, which occur several times throughout the central repetitive domains of the high M, subunits2. This site has also been predicted as a potential �-turn site in these proteins 10. These results fit extremely well with data obtained for other proteins, which are O-glycosylated. For example, typical O-glycosylated proteins contain high amounts of proline, serine and threoninel2 and have �-turns in their structure. Glutenin polypeptides contain high levels of Pro, Ser and Thr and contain large numbers of �-turns in their repetitive domains1o. Pro, Ser and Thr are common in reverse turns, which comprise four amino acid residues. O-glycosylation tends to occur in regions of the protein that exist as reverse (�) turns, but not necessarily coincident with the turnsJ3. Also O-glycosylation seems to be significantly enhanced if Pro occupies the - 1 or +3 position in the sequence13 In the case of glutenin, it seems likely that Thr may be glycosylated in the sequence Tyr-Tyr-Pro-Thr-Ser since Pro is in the - 1 position relative to Thr. The location of the sugar residues remains to be determined, however. Since �-turns are often located at the surface of proteins, these results are consistent with a post-translational model of O-glycosylation. If O-glycosylation takes place in the Golgi apparatus, as most data indicate, the protein has already been folded at this stage so accessibility to the glycosylation site would be a determining factor in determining the O-glycosylation site.
Wheat Protein Structure and Functionality
77
Another significant feature of many O-glycosylated proteins is that they commonly contain phosphorylated tyrosine residues in their structures10, 14. We have recently detected phosphorylated tyrosine in high Mr glutenin subunits4 . Glutenin subunits appear to be very highly phosphorylated as evidenced by the intensity of the binding reaction with an anti phosphotyrosine monoclonal antibody. It would seem likely that it is the Tyr residues involved in the repeat Tyr-Tyr-Pro-Thr-Ser that are phosphorylated, although that remains to be determined. For glycoproteins, in which GlcNAc and/or Man are linked O-glycosidically directly to the polypeptide moieties, the carbohydrates are typically present as single residues along the backbone of the protein rather than as branching structures containing other sugar residues or they may exist as di- or trisaccharides, in which the entire structure is made up of only Man or GlcNAc or a combination of the two 10, I4- 16 . The findings presented here are consistent, therefore, with the known amino acid sequences of high Mr subunits of glutenin and with the structures of other glycoproteins, in which Man and GlcNAc occur as single residues linked O-glycosidically to the hydroxyl groups in the sides chains of serine and/or threonine residues. The presence of O-glycosylation is a significant discovery as much of the debate regarding the glycosylation of glutenin subunits centres around the fact that the known glycosylation site for typical N-glycosidically linked carbohydrates (Asn-Xaa-SerlThr; where Xaa is any amino acid except Pro) has not been found in the sequences of high M. glutenin subunits published to date2. It is clear now that the sugars are linked to the polypeptide backbone in a rather unexpected way. Linkage of sugars through serine or threonine (O-glycosidic linkage) is not unusual. However, much less is known about this type of glycosylation than is known about glycosylation involving linkage to asparagine (N-glycosidic linkage), and analyses of these glycoproteins typically prove to be more difficult due to the fact that O-glycosidically linked sugars are often present in substoichiometric amounts.
References 1.
2. 3. 4.
5. 6. 7.
K. A. Tilley, G. L. Lookhart, R. C. Hoseney, and T. P. Mawhinney, Cereal Chem., 1 993 , 70, 602. N. G. Halford, J. Forde, O. D. Anderson, F. C. Greene and P. R. Shewry, Theor. Appl. Genet., 1 987, 75, 1 1 7. K. A. Tilley and J. D. Schofield, In 'Wheat Kernel Proteins - Molecular and Functional Aspects' . Universita Degli Studi Della Tuscia, Viterbo, Italy, 1 994, p. 2 1 3 . K . A . Tilley and J . D. Schofield, J. Cereal Sci., I n press. A. Haselbeck and W. Hosel, In 'Protein Glycosylation: Cellular, Biotechnological, and Analytical Aspects' Gesellschaft fur Biotechnologishe Forschung mbH, 1991, p. 1 7 1 . N. Shibuya, I. 1 . Goldstein, E. J. M . Van Damme, and W . J . Peumans, J. Bioi. Chem., 1 988, 263, 72 8 . J. F. Crowley, I. J. Goldstein, J. Amarp, and J. Lonngen, Arch. Biochem. Biophys. , 1 984, 231, 524.
S. Alexander and 1. H. Edler, Methods in Enzymol., 1 982, 179, 505. 9. N. G. Hanover, C. K. Cohen, M. C. Willingham, and M. K. Park, J. Bioi. Chem., 1 987, 8.
262, 9887.
10. S. P. Jackson and R. Tijian, Cell, 1 988, 55, 125.
78
Wheat Structure, Biochemistry and Functionality
A. Tatham, A. Drake, .and P. Shewry, J. Cereal Sci. , 1 990, 11, 1 89. B . C. O'Connell, F. K. Hagen and L. A. Tabak, J. Bioi. Chem., 1 992, 267, 250 1 0. 1 3 . I. B. H. Wilson, Y. Gavel, and G. von Heijne, Biochem J. , 1 99 1 , 275, 529. 14. E. P. Roquemore, A. Dell, H. R Morris, M. Panica, A. 1. Reason, L. -A. Savoy, G. 1. Wistow, 1. S. Zigler, B. 1. Earless and G. W. Hart, J. BioI. Chem. , 1 992, 267, 5 5 5 . 1 4 . C. RTorres and G. W. Hart, J. Bioi. Chem., 1 984, 259, 3 308. 1 5 . R S. Haltiwanger, W. G. Kelly, E. P. Roquemore, M. A. Blomberg, L. Y. Dong, L. Kreppel, T. Y. Chou and G. W. Hart, Biochem. Soc. Trans., 1 992, 20, 264. 1 6 . H. Nishimura, S. Kawabata, W. Kisiel, S. Hase, T. Ikenaka, T. Takao, Y. Shimonishi and S. Iwanaga, J. Bioi. Chem., 1 989, 264, 20320. 11. 12.
PRESENCE OF GLYCOSYLATED GLUTENIN FRACTIONS
POLYPEPTIDES
IN
GLIADIN
AND
M. Lauriere, I. Bouchez. , C. Doyen and G. Branlard* Laboratoire de Chimie Biologique. Centre INRA de Grignon, F-78850 Thiverval Grignon, France. *Station d' Amelioration des Plantes, INRA, Domaine de Crouelle, F-63039 Clermont Ferrand cedex 02, France.
1 SUMMARY
Glycans covalently bound to proteins, were investigated on gliadin or glutenin fractions, using specific chemical derivatization of glycans, anti-carbohydrate antibodies and lectins. Glycosylated proteins were evidenced in both gliadin and glutenin fractions. All high molecular weight glutenin subunits produced hydrazide conjugates after periodate oxidation; a reaction specific of bound carbohydrates. On the contrary, only some gliadins or low molecular weight glutenin subunits developed the same response or reacted with anti-carbohydrate antibodies. None of them specifically reacted with the tested lectins. Glycosylated polypeptides differed from one variety to an other and seemed to be present in low amount among wheat storage proteins. 2 INTRODUCTION The presence of carbohydrates along with proteins in gluten is known for a long timel. Most of these carbohydrates originate from starch or from the cell wall. They can be eliminated more or less easily from gluten. On the contrary, some carbohydrates are difficult, or impossible to separate from proteins, even after thorough purification, which raises the question of their covalent binding to proteins. When the amount of these sugars is compared to that of proteins, the calculated number of carbohydrate units is generally lower to the number of polypeptidic chains2,3. These observations lead to the assumption that wheat storage proteins are not glycosylated. This contrasts with legume storage proteins that also are synthesized on the secretory pathway, where most of the glycosylations occur, and which are often glycosylated4• The possibility that some isoforms of gliadins or glutenins are glycosylated cannot be excluded. The only way to detect them, is to evidence carbohydrates directly on electrophoretic separations of the protein subunits. The periodic acid Schiff or thymol sulfuric reagents always give negative results5,6. Lectins as concanavalin A, wheat germ agglutinin7, or Galanthus nivalis agglutininS, have already been described to react with wheat storage proteins but reactio�s are weak and difficult to interpret. Recently Tilley el al. S (and these proceedmgs) reported detection of carbohydrates bound to high molecular weight glutenin subunits (HMW-GS) using derivatization of
Abbreviations used: HMW-GS, high molecular weight glutenin subunit(s); LMW-GS, Low molecular weight glutenin subunit(s); PVDF, polyvinylidene difluoride; SDS PAGE, sodium dodecyl sulfate-polyacrylamide gel electrophoresis.
Wheat Structure, Biochemistry and Functionality
80
the glycan moiety after periodate oxidation according to Haselbeck and Hosel9 . The present work explores with the same method and by using specific anti-carbohydrate antibodies and lectins, the possibility of the presence of glycosylated wheat storage proteins. 3 METHODS Unless stated, reagents were of analytical grade and from Prolabo (Fr.). or from Sigma Chemical Co. (Saint Louis MO). Immobilon P a polyvinylidene difluoride (PVDF) membrane was from Millipore Corp. (Bedford, MA). Triticum aestivum cv. Capelle, Capitole, Chinese Spring and Courtot, were field grown.
3.1 Preparation of Gliadin and Glutenin Fractions Wheat grains without their embryo and their pericarp were ground in a ball mill. The flour (40 mg) was extracted without delipidation in Eppendorf tubes, with 0.5 ml of solvent under continuous gentle agitation for 30 min. Gliadins were extracted first with 65 % (w/v) ethanol at 20 °e, then glutenins with 35 % (w/v) I-propanol, 0. 1 M acetic acid, 5 % (v/v) 2-mercaptoethanol at the same temperature. Proteins were recovered from the centrifugated extracts, by overnight precipitation with 2 volumes of 7.5 % (w/v) NaCI at 4 °C, and centrifugation . Centrifugations were at 1 3 ,000 g for 5 min .
3.2 Electrophoretic and Blotting Techniques SDS-PAGE was according to LaemmlilO• In most experiments ready made 420 % gradient gels (Novex, San Diego, CA), were used. Semi-dry electroblotting on PVDF membranes of separated proteins, was according to Laurierell to ensure complete transfer of omega-gliadins and HMW-GS. Total proteins were stained on gels with Coomassie Blue according to Neuhoff et al. 12 and on blots with amido black lOB, according to Gershoni and Palade1 3
3.3 Detection of Carbohydrates on Blots Total glycoproteins were evidenced after periodate oxidation of proteins either in solution before the electrophoresis or after blotting, using the method of Haselbeck and Hosel9 . Complex N-glycans with xylose, which appear in the Golgi apparatus during protein targeting, were evidenced using anti-carbohydrate antibodies and anti-rabbit IgG conjugated to alkaline phosphatase (Biosys S. A . , Fr.), as already described by Laurierel4. Other glycan structures were searched using lectins, conjugated to digoxigenin from the Glycan Differentiation Kit (Boehringer Mannheim, Ger.) or conjugated to alkaline phosphatase from E. Y. Laboratories inc. (San Mateo, CA.). Each lectin was assayed according to the recommendations of the manufacturers. Adapted controls were included in each experiment, to test the specificity of the reactions.
Figure 1 Detection of glycoproteins in storage protein fractions of cultivated bread wheats. Analyses ofprolamin (P) and glutenin (G) fractions of wheat cultivars: Capelle, Capitole, Chinese Spring and Courtot, separated with gradient SDS-PAGE; (a), polyacrylamide gel stained with Coomassie blue; (b), blot processed according to Raselbeck and RlJsel9 for detection of total glycoproteins; (c) immunoblot with anti complex N-glycans containing xylose antibodies.
81
Wheat Protein Structure and Functionality
Capelle CapitoIe C.Spring Courtot p
Mr (kOa)
G
P
G
G
P
G
P
1 16.3 97.4 66.3
a
HMW GS
-
-
GLIADINS
55.4
+
36.5 31 .0
LMW-GS
-
21.5 1 4.4
_
P
Mr
(kOa)
1 1 6.3 97.4 66.3
b
55.4
G
P
G
P
G
P
G
_
-
HMW-GS
-
GLiADINS
_
+
36.5 31.0
LMW-GS
_
21 .5 14.4
P
Mr
(kOa)
1 1 6.3 97.4
C
_
-
G
P
G
P
G
P
G
HMW-GS
66.3
-
55.4
-
GLIADINS
31 .0
-
LMW-GS
21 .5
-
+
36.5
1 4.4
Wheat Structure, Biochemistry and Functionality
82
4 RESULTS AND DISCUSSION
4.1 Assay of Gliadin and Glutenin Fractions Using Lectins Gliadin and glutenin preparations of hexaploid wheats were separated by SDS PAGE and blotted on PYDF membranes. Blots were overlayed with the following lectins: Galanthus nivalis agglutinin, which reacts with mannose present in high mannose N-glycans; wheat germ agglutinin, which reacts with the core mannose6( 1-4)N-acetylglucosamine6(1-4)N-acetylglucosamine characteristic of N glycans; Datura stramonium agglutinin, which binds specifically to galactose13(1-4)N acetylglucosamine in complex and hybrid N-glycans or N-acetylglucosamine in 0glycans; Dolichos bijlorus agglutinin specific of terminal non-reducing N acetylgalactosamine of both N- and O-glycans; Jacalin and peanut agglutinin, primarily specific of O-glycans terminated with 13-D-galactose or in the case of the peanut lectin, with the disaccharide galactose 13(1-3) N-acetylgalactosamine. No reaction was observed between these lectins and the proteins present in the extracts of the four wheat varieties tested (data not shown). These results differ from those of Tilley et al·s who observed reactions with Galanthus nivalis agglutinin and Donovan and Baldo7 who observed reactions with several lectins, among which only wheat germ agglutinin reacted more specifically.
4.2 Detection of Glycans Covalently Bound to Proteins Among Gliadins and
Glutenins
Gliadin and glutenin preparations, oxidized with �riodate and derivatized with digoxigenin-hydrazide, according to Haselbeck and Hose19, were separated using SDS PAGE and blotted onto PYDF membranes. Digoxigenin labelled proteins were detected on blots using anti-digoxigenin antibodies conjugated to alkaline phosphatase. Numerous protein bands were evidenced in both preparations (Figure 1 b) . Their molecular weights were similar to those of prolamins and glutenins. Except for HMW GS, their distribution upon SDS-PAGE did not match to the total protein pattern evidenced by Coomassie Blue staining (Figure l a), suggesting that they were minor components. These components differed from one variety to an other. They were genotype dependent. Some of them were common to several genotypes. It is noteworthy that for each variety studied, the bands evidenced in the prolamin fraction appeared also in the glutenin fraction, but to a lesser extent. The similarity of their pattern suggested that they corresponded to the same components, with unequal distribution between prolamin and glutenin fractions. These components were found also in gliadin or LMW-GS fractions further purified by chromatographic techniques (data not shown). This makes unlikely that they were unrelated contaminants. Work is in progress to determine to which storage protein sub-group(s) they belong.
4.2 Detection of Glycans Covalently Bound to HMW-GS HMW-GS were separated using linear SDS-PAGE, blotted and either stained with amido black or oxidized with periodate and processed according to Haselbeck and Hosel9. The figure 2 shows that all the HMW-GS of the four varieties, stained by amido black, could be oxidized and derivatized with digoxigenin hydrazide conjugate. This reaction is generally considered as characteristic of bound carbohydrates; it shows that HMW-GS behave as glycoproteins. The absence of N-glycosylation sites in the published sequences, suggests a probable O-glycosylation of these glutenins.
83
Wheat Protein Structure and Functionality
Mr (kDa)
1 2 3 4 1
2 3 4
1 1 6.3 97.4
66.3 a
b
Fi&ure 2 Direct detection on blots of glycans linked to HMW-GS of cultivated bread wheats: (a), blot processed according to Haselbeck and HiJseI9,' (b), blot stained with amido bklck; 1-4, wheat cultivars: (1) Chinese Spring, (2) Capitole, (3) Capelk, (4) Courtot.
4.3 Assay of gliadin and glutenin fractions using anti-xylose containin&-glycan antibodies Gliadin and glutenin fractions were blotted from gradient SOS-PAGE as previously, and overlayed with antibodies reacting with complex N-glycans modified with xylose14 that are characteristic of proteins targeted through the Golgi apparatus. Numerous glycoproteins were evidenced in the glutenin fraction of each variety (Figure 2). Their molecular weights were in the range of those of HMW-GS and LMW-GS. Much less glycoproteins was detected among prolamins. Some of them seemed to be specific of this fraction. They migrate preferentially in the alpha-, beta- and gamma gliadin region. Glycoproteins reacting with the antibodies are normally part of the total glycoproteins evidenced by digoxigenin hydrazide derivatization. More bands were observed in the glutenin fraction than by digoxigenin hydrazide derivatization, without evident matching. This suggested that antibody detection was even more sensitive than digoxigenin hydrazide derivatization, and that glycoproteins bearing complex N-gI)'cans with xylose are in very few amounts. This low level questions about the identity of these glycoproteins: are they isoforms of glutenin or gliadin polypeptides, with glycosylation sites in their sequences, or contaminating membrane proteins that often bear these types of epitopes? To answer to these questions, would bring new information abOut the diversity of proteins that participate to the formation of gluten. 5 CONCLUSION There are proteins in gliadin and glutenin fractions that show specific reactions of glycoproteins. Among them, the HMW-GS were clearly identified. Their lack of N glycosylation site leads to hypothesize an O-glycosylation of these proteins. The other proteins evidenced behaved as prolamins or glutenins. They were present in low level in the varieties studied. Some were conjugated to N-glycans with xylose, which means that they were processed in the Golgi apparatus. They were numerous in the glutenin fractions. More work is needed to precise to which protein sub-group they belong.
Wheat Structure, Biochemistry and Functionality
84
References 1 . C . W. Wrigley and J. A. Bietz, 'Wheat: chemistry and technology ' , Y. Pomeranz ed. , Am. Assoc. Cereal Chern . : St Paul, MN 3rd ed. , 1988, Vol. 1 , Chapter 5, p. 159. 2. J. E. Bernardin, R. M. Saunders and D. D. Kasarda, Cereal Chern. , 1976, 53, 612. 3. T. Terce-Laforgue, L. Charbonnier and J. Mosse, Biochirn. Biophys. Acta, 1980, 625 , 1 1 8. 4. M. J. Chrispeel s, Ann. Rev. Plant Physiol. Plant Mol. Bioi. , 199 1 , 42, 2 1 . 5 . G . Danno, K . Kanazawa and M . Natake, Agric. Bioi. Chern. , 1978, 42, 1 1 . 6. A. Graveland, P. Bosveld, W. J. Lichtendonk, H. E. Moonen and A. Scheepstra, l. Sci. Food Agric. , 1982, 33, 1 1 17. 7. G. R. Donovan and B. A. Baldo, l. Cereal Sci. , 1987, 6, 33. 8. K. A. Tilley, G. L. Lookhart, R. C. Hoseney and T. P. Mawhinney, Cereal Chern. , 1993, 70, 602. 9. A. Haselbeck and W. Hosel, Glycoconjugate 1. , 1990, 7, 63. 10. U. K. Laemmli, Nature, 1970, 227, 680. 1 1 . M. Lauriere, Anal. Biochern. , 1993, 212, 206. 12. V. Neuhoff, N. Arold, D. Taube and W. Ehrhardt, Electrophoresis, 1988, 9, 255. 13. J. M. Gershoni and G. E. Palade, Anal. Biochern. , 1982, 124, 396. 14. M. Lauriere, C. Lauriere, M. J. Chrispeel s, K. D. Johnson and A. Sturm, Plant Physiol. , 1989, 90, 1 1 82.
IDENTIFICATION OF DIMERS FORMED BY THE LOW MOLECULAR WEIGHT GLUTENIN SUBUNITS BELONGING TO THE D GROUP Masci S. l , Egorov T.A· l ,2 , Kasarda D.D. 3 , Porceddu E. l and Lafiandra D. l I Dipartimento di Agrobiologia ed Agrochimica, Universita della Tuscia, Via S.Camillo de Lellis, 01 100 Viterbo, Italy 2Group of Analytical Proteins and Peptide Chemistry,
Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, UI. Vavilova 32, 1 1794 Moscow, B-334, Russia 3 U.S. Department of Agriculture, Agriculture Reserach Service, Western Regional Research Center, 800 Buchanan St. , Albany CA 94710
1 INTRODUCTION An increased amount of glutenin subunits is generally associated with improved quality characteristics because these subunits contribute positively to the amount and size of glutenin polymers. However, the presence of gliadin-type sequences in glutenin polymers of both breadl and durum wheat2 and the uneven number of cysteines found in some y- and a.-gliadin type clones3 , 4, 5 , makes it reasonable to suggest that these particular subunits may act as glutenin chain terminatorsl by having only one cysteine residue available for forming intermolecular disulphide bonds, and, in this way, having a negative influence on quality. For the same reason, D low molecular weight glutenin subunits, which have ro-gliadin type sequences6 , and likely possess only one cysteine residue7, may also contribute negatively to gluten quality. Because intermolecular disulphide bonds in glutenin polymers play a key role in quality and are poorly characterized, to some extent because of the great size of these aggregates, dimers of D subunits represent a simpler system for their study. Here we report a procedure for the identification and purification of dimers of D low molecular weight glutenin subunits.
2 MATERIALS AND METHODS Proteins were extracted from 50 g of flour of the bread wheat cv. Chinese Spring with 250 m1 of 70% ethanol with gentle stirring fot 2 hrs at room temperature, so as to have a starting fraction richer in the smallest polymers. No reducing agent was used. To confirm the presence of naturally formed dimers of D subunits, ImM iodoacetic acid (IAA) was once added in the extraction solution (70% ethanol), in order to avoid possible disulphide interchanges during stirring . Because the results were comparable, IAA was omitted in the successive experiments. After centrifugation at 10.000 RPM for 10 min, the supernatant was freeze-dried. Approximatively 3 g of protein were obtained (about 60% extraction). 300 mg of these proteins was solubilized in 60 m1 of a solution containing 4M Urea, and an ampholyte mixture (Pharmacia) that was 0.67%
Wheat Structure, Biochemistry and Functionality
86
ampholyte with pH range 2.5-4, 0.67 % ampholyte with pH range 4-6, and 0.67% ampholyte with pH range 5-7. This mixture was subjected to free flow isoelectrofocusing (Rotofor, Bio-Rad) for 4 hrs at 12 W power constant. Because D subunits are among the most acidic storage proteins, the dimers they form should be present in the most acidic fractions. 4 �l (5-30 �g) of each of the 20 Rotofor fractions was analyzed with a Mini SDS PAGE under both reducing and non reducing conditions. Fractions containing bands in the molecular weight range of D subunit dimers (about 100 Kd) were checked on two dimensional SDS-PAGE (unreduced vs. reduced) after extensive dialysis against O. I M acetic acid and freeze-drying. These fractions were also used to purify D subunits dimers by size exclusion (SE)-FPLC by using the column Protein Pak Glass 300SW (8.0 x 300 mm) (Waters). The eluent was 50% acetonitrile containing 0 . 1 % trifluoroacetic acid, and the flow rate was 0.45 mVmin.
3 RESULTS The ftrst Rotofor separation gave a ftnal pH range from 3.6 to 7 (Figure 1). The ftrst and the last fractions were not taken into consideration because they are in contact with the electrodes. C8 1
2'
3
..
5
6
7
6
9
10
CS 11 12 13 14 15 16 17 18 19
20
I
I pH lI....;ent 2.7 3.0 3.1 4.1 4.3 4.5 4.7 4.9 5.1 5,3
U U
1.0 6.2 6.4
""
.8
7.0 7.1
U
Figure 1 SDS-PAGE separation of the first Rotofor fractions of the 70% ethanol soluble proteins from Chinese Spring (eS) flour. In the upper panel, fractions have been reduced with added 1 % DIT. The first traclc in each gel represents the electrophoretic paltem ofthe total 70% ethanol soluble proteins of Chinese Spring as a reference. The pH value of each fraction is reponed at the bottom.
Wheat Protein Structure and Functionality
)
CS1
87
2 3 4 5 1 7 • • 10
CS11 12 13 14 11 11 17 11 1. 20
pH grIIdIent 3.3 ... 1 U .... 4.7 4.1 4.' 1.0 1.1 U 1.3
5.4 5.5 5.1 1.7 1.1
I.'
e.2 e.1 1.1 •.,
Figure 2 SDS-PAGE pattern 0/fractions obtained lJy re-submitting fractions 5-11 to Rot% r separation.
Unreduced
Figure 3 Two-dimensional (unreduced vs. reduced) SDS-PAGE separation o/proteins present in fractions 8-15 0/ the second Rot% r. The only proteins present below the diagonal have a mobility corresponding to D type 0/ low molecular weight glutenin subunits.
Wheat Structure, Biochemistry and Functionality
88
Because fractions 5- 1 1 were richer in D subunits, while low and high molecular weight glutenin subunits were present in a lesser proportion (see the reduced fractions), they were combined and re-separated by means of the Rotofor system, without adding further ampholytes. This procedure produced a narrower pH range (4.5-6.8), allowing a better separation. Figure 2 shows the SDS-PAGE pattern of this latter Rotofor separation. Fractions 8- 15 containined dimers of D subunits and ro-gliadins, as shown by two-dimensional SDS-PAGE (Figure 3) Separation of D subunits dimers from ro-gliadins was performed by SE-FPLC on the freeze-dried fractions 8-15. A typical chromatogram is shown in Figure 4 along with the SDS-PAGE pattern of the collected SE fractions.
0 ..J Q. Ll-t
W fn
1 �
(;:)
M e, "-
or, '-'J
,
z
Figure 4: In the upper panel, the size exclusion chromatographic separation of the same proteins used for the gel in figure 3, shows the separation of dimers from monomers. Peak 1, in fact, co"esporuis to dimers of D subunits, while peak 2 cOn/ains w-gJiadins (gel shown in the lower panel).
89
Wheat Protein Structure and Functionality
4 CONCLUSIONS The presence of dimers formed by the D subunits of low molecular weight glutenin in wheat endosperm was demonstrated by the presence of bands in the unreduced Rotofor acidic fractions, corresponding to a molecular weight of about 100 Kd.
These bands, after reduction, were identical in their electrophoretic migration to D subunits. Based on the observation that three D subunits are present in the bread wheat cultivar Chinese Spring, one coded by the B genome and two by the D genome8, we
expect six different possible dimers, corresponding to all the possible combinations of the
three bands.
The procedure here reported allowed to distinguish at least 4 bands in
the unreduced fraction. D subunits of low molecular weight glutenins are present only in those bread wheat cultivars with Chinese Spring-type ID-encoded oo-gliadins9 .
It bas been hypothesized
that they have a negative correlation with quality because they likely act as chain terminators of the glutenin polymers6, 9, 10 . Varieties possessing good bread-making
this The presence may favour the
properties have larger amounts of the more insoluble glutenin proteins, and insoluble
material consists of aggregates of higher
molecular weightll,12.
of chain terminator proteins such as the gliadin-like glutenin subunits,
decrease this ratio. The ability of D subunits to form the presence of dimers of D subunits might therefore contribute to the poor quality of the Chinese Spring-type bread wheat
formation of oligomers that
intermolecular disulfide bonds as indicated by
cultivars. Moreover, study of the disulfide bonds formation in D subunit dimers might contribute to the understanding of gluten
structure .
5 REFERENCES 1 . E.J.L.Lew, D.D. Kuzmicky and D.D. Kasarda, Cereal Chem. , 1992, 69, 508 2. Masci, E.J.L. Lew, D. Lafiandra E. Porceddu and D.D. Kasarda Cereal Chem. , 1995 72, 100 3. Okita, V. Cbeesbrough and C.D. Reeves, J. Bioi. Chem. , 1985, 260, 8203 4. Scheets and C. Hedgoth, Plant Sci. , 1988, 57, 141 5. D'Ovidio, M. Simeone, S. Masci, E. Porceddu and D.D. Kasarda Cereal Chem. , 1995, in press ,
,
,
Lafiandra, E. Porceddu, E.J.L. Lew, H.P. Tao and D.D. Kasarda Cereal Chem. , 1993, 70, 581 7. Masci, F. Buonocore, D.D. Kasarda, E. Porceddu and D. Lafiandra "Wheat Kernel Protein: Molecular and Functional Aspects", Universita della Tuscia,
6.
Masci, D.
,
,
C .N.R. , Viterbo, p. 2(J7 8. Jackson, L.M. Holt and P.I. Payne, Theor. Appl. Genet. , 1983, 66, 29 9. Masci, E. Porceddu and D. Lafiandra, Biochem. Genet. , 1991, 29, 403 10. Masci, E. Porceddu, G. Colaprico and D. Lafiandra, J. Cereal Sci. , 1 99 1 , 14, 35 1 1 . R.A. Orth and W. Bushuk, Cereal Chem. , 1972 , 49 , 268 12. R.B. Gupta, K. Khan and F. MacRitchie, J. Cereal Sci. , 1993, 18, 23.
COMPOSITION AND STRUCTURE OF GLUTEN PROTEINS
A. Graveland, M.H. Henderson, M. Paques, PA Zandbelt Unilever Research Laboratory V1aardingen P.O. Box 1 1 4 3 1 30 AC Vlaardingen The Netherlands
1 INTRODUCTION Wheat flour has many diverse end-uses, whether it is for human food, animal feed or industrial use. In companies, such as Unilever, in which the role of flour based and flour improving products is increasing rapidly, technological innovation is essential to safeguard long term growth. The basis for innovation is on the one hand, a better understanding of the product systems and on the other, sound knowledge of and response to market trends. This report relates to wheat flour as the raw material for bakery products and especially for bread. The complexity of this material will be examined and an attempt made to show how, using sophisticated techniques, the functional properties of flour can be determined, and how, on basis of that information, the correct choice of raw material can be made. Wheat flour is the preferred raw material for the production of yeast leavened bread because of its gas retention capacity. Doughs from other cereals lack the ability to retain gas because of the absence of gluten proteins. The main question is 'why does gluten have this property and why does it vary amongst wheat cultivars?' Both gluten quantity and quality are important. Reconstitution studies have shown that the gluten proteins are mainly responsible for quality differences amongst different varieties. The structural and physical characteristics of the glutenin fraction have been a particular focus for research l . To gain a better understanding of the structure-functionality relationships of gluten proteins, we have attempted to characterise the glutenin aggregates/polymers by establishing a new fractionation system, particularly for glutenin polymers. The different glutenin fractions were analysed by SDS-PAGE, gel filtration chromatography and reversed phase-high performance liquid chromatography (RP-HPLC). The structures of some glutenin fractions were also studied by transmission electron microscopy (TEM).
2 EXPERIMENTAL AND RESULTS 2.1
Isolation of Gluten Protein Fractions and Their Subunit Compositions
A fractionation procedure has been developed for the gluten proteins, during which no denaturation of the proteins occurs, in order to obtain information about the composition and structure of glutenin polymers.
91
Wheat Protein Structure and Functionality
First of all, the albumin and globulin fractions were extracted from flour using O. I M NaCI. After centrifugation, starch and dilute acetic acid were added to the wet residue and the mixture mixed into a dough. The pH of this artificial dough must be 3 .0. The mixing-step at pH 3.0 is necessary to disrupt all intermolecular interactions, such as non-covalent entanglements, between the glutenin polymers and to ensure their complete disaggregation. The mixed artificial dough was then suspended in dilute acetic acid at pH 3 . 5 . After centrifugation at 1 000 x g a precipitate of starch and acetic acid-insoluble glutenin (Res. 1) was obtained. Re-centrifugation of the supernatant at 20,000 x g resulted in a gel-layer (Res.2) at the bottom of the centrifuge tube. Both fractions (Res. 1 and Res.2) are designated here as 'gel-protein' because they form a gel in dilute acetic acid as well as in 1 .5% (w/v) SOS. Four glutenin fractions (Res.3, ResA, Res.5 and Res.6 6) were precipitated by adding sequential amounts of NaCI to the supernatant. Gliadin and aggregates, comprising low M, glutenin subunits, remained in the supernatant (Res.7). The subunit compositions ofthe fractions were analysed by SOS-P AGE under reducing conditions (Figure 1). Res.2 to 5 were glutenin polymers, which contained high M, glutenin subunits. Res.2 had a relatively high proportion of x-type high M, subunits and Res. 5 a relatively high proportion of y-type subunits. The proportion of medium M, subunits increased from Res.2 to Res.5. ResA and 5 contained small amounts of gliadin, but most of the gliadin occurred in Res.7. Res. 1 and 2, as well as Res.3 and 4, contained high-, medium- and low M, glutenin subunits. Although the four fractions had different subunit compositions, they were designated collectively as 'glutenin I'
Figure 1 SDS-PA GE patterns ofgluteninfractions I, II,
III and of the gliadinfraction
Wheat Structure. Biochemistry and Functionality
92
Res.5, containing a relatively high proportion of y-type high Mr subunits, was separable into two main fractions on a Sepharose CL-4B column, one containing high Mr subunits, especially y-type high Mr subunits, and medium Mr subunits, and the other containing only low Mr subunits (Figure 1). The glutenin in the first fraction was designated 'glutenin II' and that in the second 'glutenin III'. Res.6 6 and 7 comprised only glutenin III and gliadin, which were separable on a Sepharose CL-4B column. The ratios of high Mr subunits to medium Mr subunits plus low Mr subunits in the above mentioned glutenin fractions were determined by dissolving the fractions in 1 . 5% (w/v) SDS/5% (v/v) 2-mercaptoethanol and adding ethanol to a final concentration of 70% (v/v) to precipitate the high Mr subunits selectively; the medium- and low Mr subunits remained in solution. Protein in the fractions was determined as Kjeldahl nitrogen . . The glutenin I sub-fractions contained the highest proportions of high Mr subunits and glutenin II the lowest; glutenin III contained no high- or medium Mr subunits (Table I). The molecular weight characteristics of glutenin III (Res.6) were determined using 2D electrophoresis. The results demonstrated that this fraction comprised a restricted range of polymers differing in polymer size (results not shown). The subunits of glutenin III were identical to glutenin I low Mr subunits on the basis of their reactivities with monoclonal antibodies specific for low Mr subunits of glutenin I. These experiments showed that glutenin polymers could be differentiated into three distinct fractions: • Glutenin I: relatively high proportions of high Mr subunits, especially x-type (gel protein), insoluble in SDS • Glutenin II: relatively low proportions of low Mr subunits (mainly y-type), more medium Mr subunits and low Mr subunits • Glutenin III: only low Mr subunits and no medium Mr subunits or high Mr subunits
Table 1 Subunit Compositions of Glutenin Polymer Fractionsfrom Hereward Flour
Fraction
Molecular Structure
Subunit Composition High Mr (%)
Medium Mr (%)
Low Mr (%)
50 45 40
2
R2
R4
39
3 4
47 52 60 60
network network n.d. linear chain
Glutenin II R5
20
5
75
linear chain
Glutenin III R6 R7
--
1 00 1 00
spherical globules spherical globules
Glutenin I RI
R3
-
3
-
--
93
Wheat Protein Structure and Functionality 2.2
Structure of Glutenin Polymers
It is well-established that, the gluten proteins, and especially the glutenin polymers, determine the rheological properties of a dough. In 1 985 we proposed a model for the structure of glutenin polymers2. In this model of glutenin polymers the high M, glutenin subunits are linked together via head-to-tail interchain disulphide bonds to form a linear backbone. The low M, glutenin subunits form clusters, which are linked via disulphide bonds to the linear backbone. There is now considerable evidence to show that the composition and the relative proportions of the high M, glutenin subunits account for a substantial proportion of the variation in the breadmaking performance of wheat. It is plausible, therefore, to assume that the length of the glutenin polymer backbone may be determined by the type, composition and proportions of the high M, glutenin subunits),4. To obtain further insight into the structure of the different groups of glutenin polymers we carried out experiments using transmission electron microscopy (TEM). The different glutenin polymer fractions described above were suspended in a dilute acetic acid and examined by TEM using a negative staining technique (Figures 2, 3 and 4). Glutenin I fractions Res. I and Res.2 (gel protein), which had relatively high proportions of high M, glutenin subunits (see above), comprised a network of elongated strands with spherical globules alongside (Figure 2). These fractions therefore appeared to consist of a huge network or aggregate of polymers, in which the strands (backbone) consisted of high M, subunits and the spherical globules (clusters) low M, subunits. The main differences in the structure between the gel proteins from different flours were in the compactness and ;ize of the aggregates, and in the distribution of the globules along the strands.
Figure 2
rEM ofglutenin I polymers/aggregates or 'gel-protein ' (network structure)
.
94
Figure 3
Wheat Structure. Biochemistry and Functionality
TEM ofglutenin /-B (concatenous structure)
The Res.3 and 4 fractions of glutenin I had more linear structures (Figure 3). Those glutenin I polymers had the appearance of concatenations. It may be hypothesised that those glutenin I polymers are the precursors of the gel-protein polymer types. The glutenin I polymers may, therefore, be categorised into two different types: fraction A (Res. l + Res.2), polymers having a network structure (glutenin I-A) and a fraction B (Res.3 + Res.4), polymers having a linear chain structure (glutenin I-B). It is envisaged that, in a flour particle, glutenins I-A and I-B are likely to be interconnected very strongly with each other, forming large compact and folded aggregates. During dough mixing these aggregates become hydrated, disaggregated, unfolded and stretched. When the glutenins I-A and I-B in a dough are fully unfolded and stretched there will be an optimal intermolecular interaction between the glutenin polymers. It is further envisaged that, during the mixing of a dough, glutenin I-A, having a network structure, may be broken down into linear fragments (glutelljn I-B) and that, during subsequent resting of the dough, reassembly of glutenin 1-B takes place resulting in the re-formation of glutenin I-A. It could also be demonstrated by TEM, that the aggregates of glutenin I-A and B could have different conformations. Depending on the concentration of the glutenin I in a dilute acetic acid solution and depending on the pH or the presence of small amounts of salt, the large aggregates could be converted from a network structure into large compact spheres. The acetic acid soluble glutenin II, which contained a higher proportion of low M, glutenin subunits than the acetic acid insoluble glutenin I and a higher proportion of y-type high Mr glutenin subunits, had a linear structure of spherical globules, which were linked together (Figure 4). It is plausible to envisage that the spherical globules comprise low M, and medium M, subunits (which were shown to be present in glutenin II by SDS-PAGE: Figure 1 ) linked together by y-type high M,-subunits. The glutenin III fraction, which contained only low M, subunits, appeared in the TEM as discrete spherical globules that differed in size. The average diameter of those globules was about 20 nm, corresponding to a molecular weight in the order of 500,000. It is reasonable to hypothesise that the aggregates of glutenin I, as well as the acetic acid soluble glutenin II, are present in protein bodies in flour in the form of spheres and that, in a dough, they are unfolded and stretched as a consequence of mixing. It is also
Wheat Protein Structure and Functionality
Figure 4
95
TFM ofglutenin If (concatenous structure)
plausible that those different conformations of the gel-proteins are present in dough. Conformational changes in the gel proteins would undoubtedly have a big effect on dough properties. When the gel proteins in a dough are fully stretched, thus having a network structure, there would be an optimal intermolecular interaction between the glutenin aggregates. Directly after mixing of a dough, the gel-proteins are likely to be fully stretched. This would explain the relatively high maximum resistance of a developed dough to extension. During dough resting, the network structure of the gel proteins would return to a spherical structure. The gel-proteins with a spherical structure would have fewer intermolecular interactions, resulting in a dough with lower extensibility. It seems likely that the glutenin II polymers would be present in fuIly stretched linear form in a fuIly developed dough. 2.3
Variation in the Proportions of Glutenin Polymer Types Among Wheat Flours
The relative proportions of the different glutenin polymer types depended strongly on the type of flour (Table 2) The strong flour, Fresco, had a relatively high proportion of glutenin I (gel-protein), a lower proportion of glutenin III and even less gliadin, whereas the weak flour, Ritmo, had a relatively low proportion of glutenin I and higher proportions of glutenin III and gliadin. The medium strong flour, Hereward, was intermediate between those extremes in terms of the relative proportions of the different glutenin polymer types. 2.4
Effect of Different Glutenin Polymer Types on the Rheological Properties of Dough
Dough made from the strong flour (Fresco) had a much higher resistance to extension than a dough from a weak flour (Ritmo). Addition of glutenin I (1% on flour basis) to a dough of Ritmo flour had a large effect on the resistance of the dough. The addition of glutenin II had a far smaller effect, and addition of glutenin III did not increase resistance. In other words the proportion of glutenin I in any particular flour appeared to be the main determinant of the rheological properties of doughs made from that flour.
96
Wheat Structure, Biochemistry and Functionality
Table 2 Glutenin Polymer and Gliadin Compositions of Flours of Different Quality as a Proportion (%) of Total Gluten Protein
Fraction
Fresco
Hereward
Ritmo
R4
25 14 6 18
17 2 7 21
12 7 5 31
Glutenin II R5
7
6
4
Glutenin III R6 R7
3 2
3 2
4 2
Gliadin
25
32
35
Glutenin I RI R2
R3
2.5
Changes in the DilTerent Glutenin Polymer Types During Dough Mixing and Resting
Another essential factor determining the viscoelasticity of a dough is the size of the glutenin polymers. During dough mixing, disaggregation of the large aggregates, as well as breakdown (depolymerisation) of the fully-stretched glutenin I-A polymers to glutenin I-B polymers takes place. During resting, reassembly (polymerisation) of the glutenin I-A polymers from glutenin I-B polymers occurs. These processes also affect the changes in the rheological properties of a dough during mixing and resting. Table III shows the changes in the composition of gluten proteins as a consequence of mixing. The breakdown and reassembly of the glutenin polymers are due to the reductive cleavage of disulphide bonds and the reformation of disulphide bonds through re-oxidation of SH-groups, respectivell,6. These processes can be followed by monitoring the solubility of the glutenin polymers in SDS. The large acetic acid insoluble glutenin I-A fragments (gel proteins), which are present in the flour, are also insoluble in SDS. During mixing those polymers or aggregates become soluble and during resting they again become insoluble in SDSM The rate of breakdown and the degree of reassembly are important parameters in relation to gluten quality. Different flours have their own individual and characteristic breakdown! reassembly curves. In a dough made from a weak flour, there is rapid breakdown of glutenin I and hardly any reassembly, whereas in a dough made from a strong flour, the breakdown of the glutenin polymers is slow. Thus, the rate of breakdown and reassembly of the glutenin aggregates of a particular flour is an important parameter for characterising the quality of the gluten and also that of the flour. The degrees of breakdown and reassembly, respectively, during processing of a dough, determine the ultimate size of the glutenin I-A polymers and also the rheological properties of a dough. To obtain more information about the breakdown of glutenin I-A polymers,
Wheat Protein Structure and Functionality
97
the glutenin fragments from a overmixed dough were isolated and fractionated using the acetic acid dispersion and salt precipitation procedure described above. Overmixing resulted in the acetic acid-insoluble gel-protein becoming soluble in acetic acid. All the solubilised glutenin resulting from overmixing was precipitated in the first step of the salt fractionation procedure. The other fractions remain unchanged. Examination of the fractions by TEM confirmed that the glutenin I-A polymers were broken down to smaller glutenin I-B fragments and that the glutenin II and III polymers were unchanged. During dough mixing, therefore, only the acetic acid-insoluble glutenin I-A or gel protein is broken down into smaller linear glutenin I-B fragments. Using the same fractionation and analysis procedures, it was also shown that, during dough resting, those glutenin I-B fragments could be converted back into acetic acid-insoluble glutenin I-A polymers. It is likely that the structure of this reassembled glutenin I-A network will differ considerably from that of the original glutenin I-A network. In addition to structural changes in the acetic acid-insoluble glutenin I-A polymers during mixing and resting, the ratio and the size of the different glutenin polymer types plays an essential role in the intermolecular interactions between those glutenin polymers. The larger the glutenin I-A polymers are after reassembly during dough resting, the stronger the intermolecular interactions will be. Since the gas-retention capacity of a dough is determined mainly by the gluten network, it is evident that this is determined, on the one hand, by the concentration of the different glutenin polymer types and, on the other, by the conformation and the size of the glutenin I-A polymers after breakdown and reassembly in a fully developed dough. In general, wheat flours suitable for bread-making contain large glutenin I-A polymers, which are broken down rapidly, but also in those types of flour reassembly of the glutenin I-A polymers takes place rapidly. If breakdown proceeds too rapidly, it may easily lead to overmixing, and the formation of glutenin I-B fragments that are too small. This results in a very slack dough, which is difficult to handle, but with a reasonable gas-holding capacity. If the breakdown is too
Table 3 Glutenin Polymer and Gliadin Compositions oj Flour and Dough (Hereward) as a Proportion oj Total Gluten Protein Fraction
Flour
Dough
R3 R4
17 12 7 21
3 6 16 32
Glutenin II R5
6
7
Glutenin III R6 R7
3 2
4 2
Gliadin
32
33
Glutenin I R1 R2
98
Wheat Structure, Biochemistry and Functionality
slow or if there is no breakdown at all, this will lead to discontinuities in the gluten network and, in turn, to poor gas-holding capacity. 3 DISCUSSION
The baking performance of a wheat flour is primarily related to flour protein content and composition and dough mixing. Amongst other factors, adequate gluten quantity and quality are essential for the quality of bakery products. A generally accepted model for gluten in a fully developed dough is that of a framework of large glutenin polymers. The monomolecular gliadins are located between, where they act as plasticisers and weaken the intermolecular interaction between the glutenin polymers. Relationships between various quality parameters of gluten and end-use quality have been analysed here in attempts to understand the basis of the functional quality of wheat flour. A fractionation procedure, involving acetic acid extraction and selective salt precipitation, was used to produce a number of glutenin polymer fractions, which differed in subunit composition and size. The results of transmission electron microscopy experiments showed that the acetic acid-insoluble glutenin polymers, which contained high proportions of high M, subunits, had a network structure, whereas the acetic acid-soluble glutenin polymer fraction, which had a relatively high proportion of low M, subunits, has a concatenous structure. Addition of gliadin to a dough decreases the number of intermolecular interactions between the glutenin polymers, which results in a more viscous or extensible dough. Addition of glutenin, in contrast, increases the number of intermolecular interactions and makes the dough more elastic and less extensible. The effects of glutenin addition on dough properties were shown here to depend strongly on the type of glutenin polymer. Glutenin I aggregates had much more effect on the dough properties than glutenin III, the so-called low M, glutenin subunit clusters. Important structural changes occurred during dough mixing in the acetic acid-insoluble glutenin I-A polymer fraction such that those polymers were depolymerised to acetic acid-soluble glutenin I-B polymers. The other glutenin polymer types present in the original flour were unaffected. It is concluded that the quality of gluten, which in turn determines the viscoelastic properties of dough, is determined by (a) the proportions of the different glutenin polymer types, (b) the sizes of the different types of glutenin polymer, and (c) structural changes in the glutenin I (gel-protein) polymer type during processing.
4 REFERENCES 1 . P.R. Shewry, N.G. Halford and A.S Tatham, 1. Cereal SCi., 1 992, 15, \ 05 . 2. A . Graveland, P . Bosveld, W J . Lichtendonk, J.P. Marseille, J.H.E. Moonen and AJ. Scheepstra, 1. Cereal Sci. , 1985, 3, 1 . 3 . P.K.w. Ng, C. Xu and W . Bushuk, W . Cereal Chem. , 199 1 , 68, 3 2 1 . 4. L . Gao, P.K.w. Ng and W . Bushuk, W . Cereal Chem. , 1 992, 69, 452. 5. A. Graveland, Getreide, Mehl Brot, 1988, 42, 3 5 . 6. A. Graveland, P. Bosveld, W J . Lichtendonk and J.H.E. Moonen, Biochem. Biophys. Res. Commun. , 1980, 93, 1 1 89.
TIME-TEMPERATURE SUPERPOSITION FOR NETWORKS FORMED BY GLUTEN SUBFRACTIONS
Amalia Tsiami, Arjen Bot, Wim G.M. Agterof, Aris Graveland and Thijs Henderson Unilever Research Laboratorium Vlaardingen Olivier van Noortlaan 120 NL-3 133 AT Vlaardingen The Netherlands
1 INTRODUCTION
The rheological properties of a dough are of paramount importance for its performance during baking. For this reason, many investigators have studied the rheology of this material using complete dough systems. However, due to the complex nature of dough it is very difficult to obtain results which allow unambiguous interpretation in terms of microscopic or mesoscopic phenomena taking place in the dough. Another approach is the separation of the dough system into its components. This route has been followed by many investigators as well. One of the conclusions from their work is that the main component of dough, starch, does not gelatinize before the baking stage. After gelatinization, starch dominates the rheological behaviour of the baked product. Before gelatinization however, starch granules act as inert filler particles. The component that determines the rheology of the dough most before baking is the most abundant protein fraction, the so-called gluten. Gluten forms a class of proteins which customary is subdivided in glutenins and gliadins according to differences in solubility. In this paper, we will present our first results that relate the molecular weight of glutenin fractions to their rheological behaviour over a wide range of frequencies and temperatures. It will be shown that different fractions have different functionalities. Our approach is similar to that by Comec et al. , who studied the relation between molecular weight and rheological properties at room temperature. ! Such work is a first step to achieve a more quantitative relation between the physical properties of the gluten and the rheology of a dough. 1 . 1 Time-Temperature Superposition
A thermoreversible gel is a dynamic structure, that may behave differently depending on the time scale under study : a gel behaves as a viscous fluid on very long time scales and as a strong gel on short time scales. This is illustrated in Figure 1 , which shows the frequency dependence of the shear modulus G for a typical polymer system. The general interpretation of this dynamic rheological spectrum is that the modulus consists of two contributions: 2 (i) Glassy modes (or Rouse modes) at high frequencies. These are coordinated movements of several backbone atoms and bond rotations in a single polymer, and can be described by a power-law dependence on the frequency w: G' cx G" cx w(3·dr)12 , where df is
100
Wheat Structure. Biochemistry and Functionality
the fractal dimension of the polymer. 3
(ii) Network modes at low frequencies. There , a cross-over from viscous behaviour at low frequencies to elastic behaviour at higher frequencies can be observed. For thermorheologically simple materials, these modes are a function of the product of the frequency and a temperature dependent shift factor aT ' Different expressions for this shift factor have been proposed , the simplest of which is the Boltzman factor e-U/RT • Here U is the activation energy of the associations between network chains,
R is the gas constant and
T is the absolute temperature. In a dynamic rheological experiment only a limited frequency window is accessible experimentally . However, it is possible to shift this frequency window over the full spectrum shown in Figure 1 by performing measurements at different temperatures. This procedure is called time-temperature superposition and will be applied in the present experiments . 2 Experiments
on
synthetic
polymers showed that an increase
1
of the molecular weight of the
o
polymer results in a widening of the range of frequencies for which
-1
the polymer acts as a ge1.4,5 This is
-2
illustrated in Figure 1 . The rheolo
-3
gical behaviour of gluten may be
-4
pictured
as
behaviour weight
of
the
sum
narrow
subfractions,
of
.�
-5
the
molecular where
G"
-6
the
high molecular weight fractions
G'
L-��__���__���__��
-8 -7 - 6 -5 - 4 - 3 -2 - 1
0
2
will show a wider plateau than the low molecular weight fractions . In this paper we will proof this for fractions
of glutenin.
Since
no
phase transitions should occur to apply
time-temperature
super
Figure 1 Dynamic rheological spectrum for a polymer system. Solid lines, high molecular weight; dotted lines, low molecular weight (after Groot and Agterof3) .
position, we studied the effect of temperature on glutenin. This will give a better understanding of the thermal behaviour of wheat protein. Schofield and coworkers suggested that denaturation and setting of the protein ( - 50 °C) contributes significantly to the rheological properties of the dough, and the resulting final product.6•7 Changes between 75-90 °C are due to weakening of non-covalent bonds, with a reduction in G ' values.8 Above 90 °C there i s a n increase o f cross-linking o r polymerization of the protein.
2 MATERIAL AND METHODS Glutenin fractions were isolated from wheat flour (Hereward and Soissons) by washing out the water soluble proteins, dissolution of the remaining sample in a solution of acetic acid (pH 3 . 9) , and precipitation by sequential addition of NaCl.9 To standardize the ionic strength of different fractions, all samples were brought to a NaCI concentration of 0 . 03 molll afterwards . Precipitated protein was collected and stored frozen at -20 °C . Rheological tests were carried out using a Carrimed-500 CSL with cone and plate geometry
(diameter 60
thermocouple within
mm,
angle 2°) .
The
temperature
± 0 . 1 °C of the required temperature.
was
controlled
with a
For the superposition
experiments , the sample (Hereward) was equilibrated for 15 min at each new temperature ,
101
Wheat Protein Structure and Functionality
which was found sufficient because the modulus was stable for at least 1 h afterwards. A fixed peak strain of 0.03 was applied during a frequency sweep over the range 0 .01-30 Hz. Preliminary data showed that the linear range for stress-strain is up to a strain of 0.05 for glutenin subfractions. The particle size distribution was measured using a Malvern system 4700c sub-micron particle analyzer with a 128 channel 7032CE Multi 8 7032 CE Autocorrelator, a Spectraphysics laser model 127 operating at A =632. 8 nm and an output power of 25 mW, and a spectrometer goniometer with computer control. As a detector a Malvern PCS5 photomultiplier was used.
3 RESULTS AND DISCUSSION
3 . 1 Size of Glutenin Subfractions Dynamic Light Scattering ,....., (DLS) demonstrated that the � 40 ,------, present fractionation method RS = separates the glutenins according to .g molecular size (see Figure 2) : *E polymers in class R3 have sizes 20 ell :a higher than 4 ILm; in class R4 sizes are in the range 0. 2-4 ILm; in fractions R5 and R6, which were o L-������L_�� collected with higher salt concen 101 102 103 tration, even lower molecular sizes were observed. Gel electrophoresis Particle size (nm) after reduction with mercapto ethanol showed that R3 contains higher amounts of high molecular Figure 2 Particle size distribution of glutenins weight subunits, while R4 contains according to light scattering data. more low molecular weight subunits. 9 60 To relate the relative ...... = abundance of these fractions to the 50 'd I\) strength of different flours, we ... :os carried out a fractionation for a b'o 40 strong (Soissons) and a weak -;; 30 '0 (Hereward) flour. The major ... 20 difference (Figure 3) was found � � between the occurrence of fractions '-' 10 R2 + R3 and R4. The gliadin � 0 content was not investigated. The R2/R3 R4 R5 R6 R7 strong flour had higher amount of high molecular weight glutenin and the weak flour a higher Figure 3 Concentration of each fraction to weak concentration of R4. Therefore, we (open column) and strong (hatched column) flour. will only describe the two most important fractions in the present
]
102
Wheat Structure, Biochemistry and Functionality
paper,
R3 and R4.
400 ,-------� 3.2 Effect of Heating on Glutenin To
apply
time-temperature
superposition it is show
that no
important to
phase
transitions
,-.. ..
�
C,
(,
is used. In Figure 4, a temperature
1
moduli for a glutenin fraction (R4, 12%
w/w)
is
presented .
At
a
G'
•
o
o •
. o
• o
•
• o
o
L--__�__��__�__�_____'
o
20
60
40
80
1 00
Temperature (OC)
temperature of 1 °C the glutenin has
..
•
10
occur in the temperature range that scanning of the storage and loss
•
0
100
> G" and with increasing
temperature
G'
and
G"
show the
4 The effect of heating of glutenin system (R4, 1 2 %). (Modulus has been extrapolated at zero polymer. However, at - 50 °C, G' peak strain, frequency 1 Hz), (e ) G ', (0) G ". is suddenly higher than G". This
expected behaviour for a melting
Figure
confirms that changes occur in the glutenin at higher temperatures. Some investigators found that the temperature at which structural changes of protein start is much higher, and that changes in the rheological properties at lower temperatures ( - 60 °C) were due to starch gelatinization.1O In the present experiment, however, starch gelatinization can be excluded as the origin of the changes because the starch content of the glutenin solution is only 0. 1 % . In addition, the temperature at which the changes occur is much lower than the gelatinization temperature of starch. Differential Scanning Calorimetric (DSC) studies did not show any thermal changes due to starch gelatinization or glutenin denaturation. Irreversible changes in the rheology of gluten at - 50 °C have been observed by other groups as well . 6•7, 1 1-13 To apply time-temperature superposition successfully, one should therefore distinguish two cases : (i) samples which have not been exposed to temperatures higher than 30 °C (called non-heated samples), and (ii) samples which have been heated at 70 °C for 1 5 min and measured at the temperatures indi-cated
(called
heat-treated
10'
samples) .
3 . 3 Non-Heated Glutenin Frac
tions R3 and In
103
R4
Figure
5,
a
102
dynamic
101
rheological spectrum obtained by
.-------�
,-_.. ..... ... .._ .... ... . . . . . .. . ..... • <::CJ'Xl 0 0
�
O O O I$(b QPlJt>
100 ��������--� 1 0" 10-4 1 0-3 1 0-2 10-1 1 00 1 0 1 102 103
time-temperature superposition is presented . The concentration of the solution was 1 3 % . The reference
Frequency (Hz)
temperature for the frequency-axis is 20 °C . The activation energy for the
network
aSSOCiatIOns
is
approximately 14 kJ/mol. Fraction R3 shows properties of a strong gel, and a plateau over a wide
Figure 5 Non-heated glutenin fraction (R3, 13%); 30 (e ) G ', (0) G "; 20 0e ( Ito ) G ', (.6.) G "; lO oe ( + ) G ', ( 0 ) G "; O. l oe (_) G ', (D) G ", Reference
°e
temperature is 200e (Peak strain 0. 03) .
Wheat Protein Structure and Functionality
103
range of frequencies can be seen. 1 04 ,------, This indicates that R3 is a high molecular weight fraction, which is in good agreement qualitatively 1 02 with the DLS data. This fraction is responsible for the elastic proper 101 ties of the full gluten mixture. 1 00 In Figure 6, the dynamic rheological spectrum is presented 10-1 �,������ for the fraction R4 (lower 10-4 1 0 -3 1 0 .2 10-1 100 1 0 1 102 1 0 3 1 0 4 molecular weight) . The activation energy of network associations is Frequency (Hz) 22 kJ/mol in this case. A vertical shift (G' , Gil) was applied, using a Figure 6 Non-heated glutenin fraction (R4, 11 %); factor of 2 for every 10 °C. The 30 °C(e) G', (0) G "; 20 °C (A) G ', (.6.) G "; 10 glutenin system behaves as a weak °C, (+ ) G', (0) G il; 0. 1 °C (_) G ', (D) G ". network. The spectrum covers Reference temperature is 20°C (Peak strain 0. 03) wide frequency range (several decades). However, the system does not seem to reach pure viscous behaviour, because the slopes of the curves at low frequencies for G' and Gil are 0.72 and 0.65, respectively, instead of 2 and 1 as for pure viscous solutions. This might be caused by polydispersity of the samples.s
3.4 Heat-Treated Gluten Fractions R3 and R4 Looking now at the data for the heat-treated sample fraction R3 (Figure 7) , there is a significant change of the system compared to the non-heated sample. The dynamic spectrum for the heat-treated sample shows distinct glassy modes. The slope of the modulus at high frequencies is 0.23 (from Gil). The fractal dimension 10' ,--------, of the polymer derived from the slope is 2 . 5 , which indicates that 104 the solvent is quite poor. The 103 activation energy calculated from the shift factor is 20 kJ/mol. 3 102 In Figure 8, the effect of 101 heating on glutenin fraction R4 is presented which is more pronoun 1 0 0 ������� ced than the effect on R3 . At low 10-' 10-4 10-3 1 0 -2 10-1 1 00 1 0 1 102 103 frequencies a plateau can be Frequency (Hz) observed, while at high frequen cies the glassy modes can be seen. At high frequencies the values of Figure 7 Heat-treated glutenin fraction (R3, 13%; storage and loss modulus are heated at 70 °C); 70 °C (e) G ', (0) G "; 50°C (A) equal. The fractal dimension in this G', (.6.) Gil; 20°C, ( + )G', ( 0 ) Gil; O. l °C (_) G', case is 2 .0, which is the value for (D) G ". Reference temperature is 20°C (Peak strain' polymers in an ideal solvent. The 0. 03) . activation energy for the network associations in this case is 14
104
Wheat Structure. Biochemistry and Functionality
kJ/mol, which is lower than for R3 .
102 c-----�
The changes in R4 upon heating are by far the most 101 significant observed in the present samples. We see a change from a system which does not show any plateau region (i .e. a very low molecular weight polymer) to a ���. 10-1 ����� system with a clear plateau region 10-3 10-2 10-1 100 1 0 1 102 103 (i.e. a much higher molecular weight polymer) . We are unable to Frequency (Hz) demonstrate these changes using DSC . This might indicate that the Figure 8 Heat-treated glutenin fraction (R4, 1 1 %; effect is due to hydrophobic heated at 70 °C); 70 0e (e ) G ', (0) G "; 40 0 e ( + ) associations which result in an G ', ( 0 ) G "; 20 0e (_) G ', (D) G "; o. J oe (.. ) G ', entropy gain, but not in any change (.6.) G ". Reference temperature is 20 0e (Peak strain in enthalpy. DSC cannot detect 0. 03) . such chang e s . From o u r rheological experiments i t i s clear that the changes start at approximately 40-50 0c. The nature of this thermal change has not been established, but it is likely that the heat treatment generates denaturation or irreversible association of protein. . .
o 0
4
0
CONCLUSIONS
We demonstrated that time-temperature superposition can be applied to glutenin samples . This enables the determination of the dynamic rheological spectrum over a wider range of frequencies than the frequency window of the experimental set-up . To apply time temperature superposition successfully, we distinguished two cases, the non-heated and the heat-treated samples. The non-heated samples undergo a thermal transition in the temperature range 40-50 0c. This transition is probably related to extensive association of glutenins. Irreversible changes in the rheology of gluten at 50 °C were observed before.6•7• 1 1- 1 3 The fact that other investigators only observed thermal changes at higher temperatures, may be related to the fact that often commercial gluten is used which was treated thermally during the drying process. The study of two different glutenin fractions showed that: (i) The high molecular mass fraction R3 behaves as a strong gel if non-heated, and this fraction contributes to the elastic behaviour of a dough. The network of the heat-treated sample changes towards the glassy modes (the end of the plateau region), showing a plateau at low frequencies. With heating, the number of rheological effective linkages increases. (ii) Fraction R4, which has lower molecular mass, forms a weak network and contributes mainly to the viscous properties which could be essential for proofing of the dough. The dynamics of the network changes to the glassy modes on heating. The glutenin starts to denature at T > 40 °C which results in an increase of the rheologicaUy effective linkages. -
In our experiments we found an activation energy of network associations of 14-22 kllmol
Wheat Protein Structure and Functionality
lOS
for both glutenin fractions. This is considerably lower than the values obtained by Matsumoto, who found 1 25 kJ/mol from stress relaxation-time experiments. 14 It has been observed that the network of the heat-treated gluten R4 is weaker than the network of the R3 . Fraction R3 will give the elastic properties to the dough during baking that can support the lamellar films against the CO and water pressure, which will prevent 2 the collapse of the bread foam due to the breaking of the bubbles. This could be an explanation why a strong flour (rich in R3) does not collapse during the baking process. These results indicate the viability of the approach to relate the rheological properties of glutenin fractions to their molecular weight. However, further work on mixtures will be needed to be able to predict quantitatively the rheological behaviour of a dough from its gluten composition. Acknowledgement: We would like to thank L.L. Hoekstra for technical assistance and R . D . Groot for fruitful discussions. This work was supported financially by the E.E.C. Human Capital and Mobility Program.
References 1. 2. 3. 4. 5.
6. 7. 8. 9. 10. 11. 12. 13. 14.
M . Cornec, Y . Popineau, I . Lefebvre, J. Cereal Sci. , 1994, 19, 1 3 1 . R.G. Larson, ' Constitutive Equations for Polymer Melts and Solutions' , Butterworths, London, 1988. R.D. Groot, W.G.M. Agterof, Macromolecules, 1995, 28 (in press). S. Onogi, T. Masuda, K. Kitagawa, Macromolecules, 1970, 3, 109. T. Masuda, K. Kitagawa, T . Inoue, S . Onogi, Macromolecules, 1970, 3, 1 16. I . D . Schofield, R.C. Bottomley, M.F. Timms, M.R. Booth, J. Cereal Sci. , 1983, I, 241 . I . D . Schofield, R.C. Bottomley, G.A. LeGrys, M.F. Timms, M.R. Booth, ' Gluten Proteins ' , eds. A. Graveland, I.H.E. Moonen, TNO, Wageningen, 1984, p. 8 1 . H . Levine, L . Slade, ' Dough Rheology and Baked Product Texture' , eds. H . Faridi, I.M. Faubion, Van Nostrand Reinhold, New York, 1990, p. 157. A. Graveland, M.H. Henderson, M. Paques, P.A. Zandbelt, Proceedings 'Wheat Kernel Proteins, Molecular and Functional Aspects' , Viterbo, 1994, p. 55. A . C . Eliasson, K. Larsson, ' Cereals in Breadmaking ' , Marcel Dekker, New York, 1993, chapter 7 , p. 325 . R. Bale, H.G. Muller, J. Food Technol. , 1970, 5, 295 . G. Attenburrow, D.I. Barnes, A.P. Davies, S.1. Ingman, J. Cereal Sci. , 1990, 12, 1. A.H. Bloksma, Cereal Foods World, 1990, 35, 237 . S. Matsumoto, ' Food Texture and Rheology ' , ed. P. Sherman, Academic Press, London, 1979, p. 291 .
THE ROLE OF GLUTEN IN THE HEAT-INDUCED CHANGES THAT OCCUR IN DOUGH RHEOLOGY DURING BAKING
A. Nakonecznyj *, S. 1. Ingman* and 1. D. Schofieldt *Unilever Research Colworth Laboratory, Colworth House, Shambrook, Bedfordshire MK44 I LQ, UK and tThe University of Reading, Department of Food Science and Technology, PO Box 226, Whiteknights, Reading RG6 6AP, UK.
I INTRODUCTION Wheat flour dough is a viscoelastic material ' . During baking, chemical and physical interactions occur at the molecular level to cause changes in a dough's viscoelastic nature thus influencing final baked product structure. The temperature-induced interactions have been attributed to starch gelatinisation2,3 , protein crosslinking4,5 and water redistribution between starch and protein fractions4,6. Although these processes may occur concurrently during heating, the quantitative contribution each of them makes to the rheological properties of a dough is not known. The aim of this work was to determine how starch free gluten crosslinks during heating in order to assess how that process contributes to the rheological properties of dough. A method of preparing dough samples with varying protein/starch (PIS) ratios was adopted, which retains the main dough structure, causing minimal processing and damage. Previous experiments have been cited7.' 2 describing methods for reconstituting doughs by mixing commercially or laboratory prepared wheat protein and wheat starch. Such reconstituted doughs may not be truly comparable to original, native doughs, and may not achieve a homogenous gluten network. Dough and gluten rheological characteristics were evaluated as a function of temperature, using dynamic mechanical testing at small deformation. Gluten-protein crosslinking on heating was also monitored by SDS extractability methodsI 3 , and correlated with rheological data. 2 MATERIALS AND METHODS 2.1
Dough Sample Preparation
Dough from single variety, Mercia wheat flour (62% water absorption) was mixed in a Brabender Do-Corder to optimum development as measured by peak torque. Test samples of varying PIS ratios were prepared by progressively washing out starch from the dough (Fig. I ). Samples were taken at various stages of washing out and were frozen and freeze dried. Freeze-dried samples were milled to 'flour' using a Retsch mill (250 mm screen) and re-hydrated to 'doughs' on the Brabender Do-Corder by mixing until peak torHue. Protein content (N x 5 .7) was determined using the Foss-Heraeus Macro N technique ' 4 . 2.2
Rheological Measurements
Measurements of rheological changes during heat setting were performed on doughsl glutens of varying PIS ratio by heating from 25-JOO°C in a Rheometries RDA II rheometer. Measurements were made using parallel plate geometry with a gap setting of
107
Wheat Protein Structure and Functionality
•
RETAIN MAIN DOUGH STRUCTURE, ElJT INCREASE PIS RATIO
•
MINIMAL PROCESSING AND DAMAGE
ROUR +
WATER
•
WASHING OUT STARCH
DOUGH
I
l' +
STARCH WASHING
Figure 1
1
FRACTION
1
I
I
1 FRACTION +
STARCH WASHING
2
I
1, I FRACTION 3 I
2
+
STARCH WASHING
3
I FRACTION n I +
STARCH WASHING n
Schematic diagram ofthe methodfor preparing samples ofdifferent PIS ratio
2-3 mm. The strain was 0.2% and the frequency I Hz. After loading onto the rheometer, samples were allowed to relax for 30 min prior to making the measurements. A heating rate of 1 .5°C/min was used plus a 'soak' time of 30 s. Temperature is controlled by the use of a convection oven in the Rheometrics rheometer. Thus, a Moisture Loss Reduction (MLR) chamber was built to reduce drying out of samples at high temperatures (Fig. 2).
Oven
Dough Sam ple
011
o < .. "
Oven
Oscillation
Figure 2
Schematic representation ofthe Moisture Loss Reduction chamber (MLR)
108
Wheat Structure, Biochemistry and Functionality
2.3
SDS Extractability of Protein
Mercia dough samples were placed between two metal plates separated by a rubber gasket, with a thin thermocouple inserted into the dough. The samples were rested for min and then uniformly heated to a range of temperatures between - 1 00°C. Once the sample had reached the desired temperature, as measured by the thermocouple, it was removed from the plates and quenched into liquid N2. Samples were freeze-dried and milled. Milled samples g) were extracted with SDS solution w/v; mL) for h with occasional stirring. The mixture was centrifuged min at rpm), and the UV absorbance of the supernatant was measured at 280 nm, against a SDS blank 1 3. The extractability of the dough protein was determined from a calibration curve constructed from unheated Mercia dough sample.
30
40
(2%, 20 30,000
(20
3 3.1
(0. 1
24
RESULTS AND DISCUSSION
Rheological Measurements on Dough Heat Setting
3�
On heating Mercia dough has shown an increase in G' above 50°C (Fig. indicating the occurrence of a major physicochemical process(es), as previously reported . At higher PIS ratios, this rapid G' increase - 80°C) was considerably reduced, implying that the G' change is predominantly due to starch (gelatinisation). Although, the G' increase from 50°C was not as prominent for gluten-like samples (PIS ratios > 1 ) in comparison to dough, G' was observed to increase quite sharply at temperatures near and above 70°C (Fig.
(50
3 ).
200,000 100,000
�
., ::;) oJ ::;) 0 0 :E (J >=
� w
50,000
10,000
----- ------
.
_
-·
�
.
·-
--
--. .· . '
'* • • * . . . . .. . . . . . • 20
OOUGH 1
___
3.2
---------- - -
.
2,000
Figure 3
--
0 , · " . - - o-c'* - - - - - - - - -'- ·
® .�" .. ·l- :�- . . !Q} * � * '* .
5,000
1 ,000
- - .- - -
--------------
20,000
··t·
� DOUGH 2
____
..
DOUGH 3
0
50
. ..
-
. •
TEMPERATURE ('e)
DO� "
U
DOUGH 5
.*-
•
•
.
50
DOUGH 6
•
roo DOUGH 7
--
DOUGH 8
120
•
Temperature induced changes in G ' ofdoughs/glutens varying in PIS ratio
Theoretical Prediction of Gluten Heat Setting
In order to predict the contribution of gluten on dough heat setting properties G' values
Wheat Protein Structure and Functionality
109
for PIS doughs, at selected temperature intervals, were plotted against protein content (Fig, 4), Data between 40 and 60°C nicely fitted a power regression curve in the form of:-
b y = ax while data = 70°C conveniently fitted exponential curves in the form of:
y = aix y = G' modulus values; x = protein content; a, b = constants for selected isotherms,
where:
100,000
Ii
�
•
30,000 �Cl, - - - - -ti - - - - - - - - - - - - - �-�:
10,000
2 U �
. . .. >',*:
_
3,000
!w
1 ,000 300
20
0 4O'C
Figure 4
5O'C
-0 ..
40
TOTAl % PROTEIN (calc, at 0%
8O'C G
70'C
---
*- - -
60 mOisture) SO'C
.. .
. . . -
80 9O'C
----
100
100'C
Regression analysis ofG ' versus dough/gluten protein content
A regression analysis based on the data was carried out to predict a theoretical heat setting curve for pure gluten (Fig, 5), The results of this analysis confirmed that the G' increase above 70°C was due to gluten, 3.3
Protein Crosslinking as Determined by Extractability in SDS Solution
Extractability in SDS, which was used as a measure of temperature-induced protein cross linking in doughlgluten 1 3 , began to fall at about 70°C (Fig, 6), Above 70°C less protein was extracted, indicating that crosslinking had probably taken place, These observations complement those on rheological changes in G' on heating, 4 CONCLUSION
By progressively lowering the starch content of a dough by means of the washing procedure adopted here, it was possible to produce doughs of varying protein/starch (PIS)
1 10
Wheat Structure, Biochemistry and Functionality
1,000,000
!
100,000
§:
Ul ::::> ...J ::::> C
�
0 >=
10,000
5w
I
._---- ----.--
1,000 20
40
60
TEMPERATURE
('c)
80
100
120
Predicted theoretical effect ofheat on pure gluten
Figure 5
100 <J> 0 <J> a;
�
�
�
w z
�'" Q, :I:
80
g
40
z 0 ;:: '" 0 Q,
20
0 0
is �
� Q,
•
60
a
Figure 6
20
40
60
TEMPERATURE
80 ('c]
100
120
Changes in the SDS extractability of dough/gluten protein after heating to du.Terent ten1peratures
ratios, while retaining a dough-like structure with a continuous gluten network, These samples were then used to predict gluten heat setting rheology, Using a regression analysis based on the rheological data of the doughs of increasing PIS ratio, the
Wheat Protein Structure and Functionality
111
rheological changes during heat setting o f pure gluten were determined. The main heat setting rheological changes were shown to commence at -70°C and to continue increasing to temperatures beyond 95°C. References 1. 2. 3. 4. 5.
6.
7. 8. 9. 1 0. 1 1. 12. 13. 14.
R . K. Schofield. and G. W. Scott Blair, Proc. Roy. Soc. (London), 1 932, 138, 707. A. H. Bloksma and W. Nieman, J. Texture Studies, 1 975, 6, 343. P. C. Dreese, 1. M. Faubion and R. C. Hoseney, Cereal Chern. , 1 988, 65, 348. G. A. LeGrys, M. R. Booth, and S. M. Al-Bagdadi, In 'Cereals, a Renewable Resource', Eds L. Munck and Y. Pomeranz, American Association of Cereal Chemists, St. Paul, Minnesota, 1 980, p. 243. R. Bale and H. G. Muller, J. Food Technol. , 1 970, 5, 295. A.-C. Eliasson, J. Cereal Sci. , 1 983, 1 , 1 99. G. E. Hibberd, Rheol. Acta, 1 970, 9, 50 1 . J. R. Smith, T. L. Smith and N. W. Tschoegl, Rheol. Acta, 1 970, 9, 239. A. S. Szczesniak, 1. Loh and W. R. Mannell, J. Rheol. , 1 983, 27, 537. L. L. Navickis, R. A. Anderson, E. B. Bagley and B. K. Jasberg, J. Texture Studies, 1 982, 13, 249.
A. Abdelrahman and R. Spies, In ' Fundamentals of Dough Rheology', Ed. H. Faridi and J. M. Faubion, American Association of Cereal Chemists, St. Paul, Minnesota, 1 986, p. 87. S. Cavella, L. Piazza and P. Masi, Ita!' J. Food Sci. , 1 990, 4, 235. 1 . D . Schofield, R . C. Bottomley, M . F. Timms and M . R . Booth, J. Cereal Sci. , 1 983, 1, 24 1 . D. Smith, Analytical Proc. , 1 99 1 , 28, 320.
1.
BIOCHEMICAL CHARACTERISATION OF WHEAT FLOUR PROTEINS USING GEL CHROMATOGRAPHY AND SDS-PAGE
E.L. Sliwinski1.2, T. van Vliee & P. Kolster' , ATO-DLO, P.O.Box 1 7, 6700 AA Wageningen, the Netherlands 2 WAU, Dairying and Food Physics Group, P.O.Box 8 1 29, 6700 EV Wageningen, the Netherlands
INTRODUCTION The study of wheat gluten proteins is hampered by the poor solubility of these proteins. To overcome this problem, often sonication in combination with appropriate buffers is used, although it is known that with this technique covalent bonds in proteins could be broken. A method has been optimized to extract total protein from wheat flour without the use of sonication or reducing agents. Results of a study will be presented in which the dissolved gluten proteins are separated by gel chromatography and the composition of fractions is determined (HMWILMW glutenin subunit-ratio, presence of disulfide bonds). 2
MATERIALS AND METHODS
A sample of the wheat variety Soisson was obtained from Meneba BV. Soisson is a wheat variety with good breadmaking potential and strong dough properties (table 1 ) .
Table 1 Some properties of Soisson flour protein content (% dry matter) damaged starch (% dry matter) ash content (% dry matter)
l OA 7.6 0.46
Ext: H (BU' s) Ext: L (BU's) Ext: A (BU's)
590 1 56 1 25
Proteins were extracted from flour and from freeze-dried dough in a 2% SDS/50 mM TrislHCI, pH 8.0 buffer (Bottomley et aI, 1982). The flour was carefully suspended in this buffer and left gently shaking for 24 hrs. After centrifugation the dissolved protein was studied by gel chromatography using a Superose-6 column, SDS-PAGE and laser-scanning densitometry.
1 13
Wheat Protein Structure and Functionality 3
RESULTS
From the defatted flour 92% of the total nitrogen was extracted. 94% of total nitrogen was extracted from defatted flour after a mixing and freeze-drying procedure.
AU's
25 20 15 10 5 0 -5 20
25
30
35
40
45
50
55
time in min
Figure 1 A typical elution pattern of extracted Soisson flour protein M
2
3
4
5
6
7
8
9
10
11
12
M
Wheat Structure. Biochemistry and Functionality
1 14
Figure 2 SDS-PAGE-pattern of fractions obtained by gel chromatography of Soisson protein. Upper photo: unreduced samples; lower photo: reduced samples. Numbers refer to fractions. Using SDS-PAGE under unreduced conditions large protein polymers are shown that cannot enter the gel or result in a smear (figure 2., upper foto). The protein composition after reduction with B-mercapto-ethanol of these fractions is shown on the gel on the lower photo. Using this gel the HMWILMW-ratio of the glutenin subunits of the separate fractions obtained by gel chromatography is determined by laser-scanning densitometry. Table 2 Ratio between HMW and LMW glutenin subunits
fraction HMWILMW-ratio
0.36
2
3
4
5
0.34
0.26
0.20
0.22
It can be concluded that the higher the molecular weight of the polymeric proteins the higher the HMWILMW-ratio.
4
CONCLUSION
These results show that for a successful interpretation of elution-patterns the use of SDS-PAGE in combination with laser-scanning densitometry is very useful. With this method the ratio between groups of gluten proteins of flour and gluten of various varieties with similar protein content and a large range in dough properties will be studied. Bottomley et aI, 1. Sci. Food Agr., 1 982, 33: 48 1 -49 1 .
Wheat Protein Composition and Quality Relationships
STRUCTURAL DIFFERENCES IN ALLELIC GLUTENIN SUBUNITS OF HIGH LOW Mr
AND AND THEIR RELATIONSHIPS \-\lITH FLOUR TECHNOLOGICAL
PROPERTIES
D. Lafiandra l , S Masci l , R. D'Ovidio l , T. Turchettal, B. Margiotta2 and F. MacRitchie3 IDepartment of Agrobiology and Agrochemistry, University of Tuscia, 0 1 1 00 Viterbo, 2Germplasm Institute, C.N.R., Bari, Italy 3 C . S.I.R.O. Division of Plant Industry,
Italy
North Ryde, Australia
1 INTRODUCTION It is widely accepted that glutenins, which are polymeric proteins whose subunits are held together by disulfide bonds, are the major determinant of dough strength and elasticity l,2; when disulfide bonds are broken by reducing agents and the resulting mixture separated on SDS-PAGE, two groups are found which have been termed high- and low molecular weight glutenin subunits, being encoded by genes at the complex loci on the long and short arms of the homoeologous group 3, respectively3,4.
1 chromosomes and designated Glu-1 and Glu-
Correlation studies have stressed the relative importance of certain subunits compared
to others, but the mechanisms by which certain allelic subunits confer superior dough properties is not fully understood and is matter of intensive investigations. Qualitative effects may be related to differences in the amount of subunits produced by' the different alleles or result from differences in their structure which can affect their ability to form polymers with other high or low Mr subunits.
Major structural features, of both high and low Mr glutenin subunits, which are
supposed to play a role in determining allelic differences are number and position of cysteine residues and the presence of a repetitive domain; these aspects will be reviewed in this presentation.
2
STRUCTURAL CHARACTERISTICS OF HIGH Mr GLUTENIN SUBUNITS
Bread wheat cultivars possess . from three to five high Mr glutenin subunits, as
determined by sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS-
PAGE): one or none encoded at the Glu-A l complex locus, one or two at the
GJu-Bl
locus and two at the Glu-Dl locus. Molecular analyses have indicated that each complex locus contains two tightly linked genes, one encoding a higher Mr subunit designated
as x
type and the other encoding a lower Mr y-type subunit. Absence of subunits in some cases
has been proved to be due to gene silencing. DNA sequencing of genes encoding high Mr
glutenin subunits has revealed structural features of these proteins, in fact the presence of three distinct structural domains has been reported in both x- and y-type subunits: a central repetitive domain flanked by non repetitive N- and C-terminal domains5-7
Wheat Structure. Biochemistry and Functionality
118
1
2
3
4
5
15
7
8
8
10
Figure 1 S1JS-PAGE separation of high Mr glutenin subunits on 10% concentration gel (upper) and 10% concentration gel containing 4M urea (lower).
x- and y-type subunits differ in number and type of repeat motifs. Both contain in fact hexa- and nona-peptides, but only x-types possess tripeptides. Analyses by polymerase chain reaction
(peR)
of novel subunits of unusually high
Gill-A 1
Mr
present at the
Glu-DI
and
loci have demonstrated that the repetitive central domain is responsible for observed size variation8 .9 This supports a previous suggestion that the repetitive block structure of the central domain provides the basis for a more rapid evolution and divergence by duplication and or deletion of whole blocks, or several blocks of residues, by unequal crossing over, whereas unrepetitive domains evolved by a combination of single amino acid substitutions and small insertion and/or deletions ! ! . According to Tatham et aL ! 2 these repetitive sequences appear to form a loose spiral supersecondary structure which is based on repeated f3-turns, and this spiral nay be
intrinsically elastic and responsible for gluten elasticity.
1 19
Wheat Protein Composition and Quality Relationships
Table 1 Characteristics ofhigh Mr glutenin subunits§ SuhlUlit
Cultivar
Dx5
Cheyenne Hope Yamhill Cheyenne Cheyenne
Axl
Dx2 Ax2*
Bx7
Molecular Weight
Nwnber of residues
N-terminal
Domain
Repetitive
Domain
C-terminal
Domain
Cysteine residues
88128
827
89
696
42
5
87680
809
86
681
42
4
87022
817
88
687
42
4
86309
794
86
666
42
4
82865
770
81
647
42
4
Bx 1 7
L86-69
80750
734
81
61 1
42
4
By9
Cheyenne Ch. Spring Cheyenne Cheyenne
735 1 8
684
104
538
42
7
68650
639
1 04
493
42
7
67476
627
1 04
481
42
7
63027
581
1 04
435
42
6
Dyl2
DyIO Ay (silent)
§Modified from Shewry et aJ7; data for subunit
1 7 are from Reddy and AppelslO
SDS-PAGE separations, have been extensively used to characterize different high
Mr 1 ) and to assess their relationship with flour breadmaking properties. DNA sequencing of high Mr glutenin subunit genes have made it possible to deduce correct molecular weights of corresponding subunits (Table 1 ). Such data have indicated that molecular weight of high Mr glutenin subunits, as determined
glutenin subunit alleles (Fig.
by their relative mobility in SDS-PAGE, are overestimated; additionally discrepancies between the migration of certain subunits and their molecular weight have also been
observed. For instance the migrations of allelic pairs I Dx2I 1 DxS and I Dy I O/1DyI2 have been shown to be anomalous13 In fact subunit I DxS has higher mobility than the smaller allelic subunit I Dx2; similarly subunit l Dy l O has lower mobility than the larger subunit I Dy I 2. Other discrepancies have appeared with the complete sequences published for genes corresponding to subunit 1 and 2* encoded at the Glu-A l locus. Mobilities on SDS PAGE of these two components are in fact slower than subunit S encoded at the Glu-Dl locus (Fig. 1 ), though molecular weight of this latter is larger than subunits 1 and 2*' Goldsborough et aP4 suggested that anomalous relative mobility of subunits 10 and 1 2 i s due to conformational differences between the proteins, because the anomalous behaviour is destroyed by the addition of a strong denaturant, such as 4M urea, to the SDS-containing gels. Even though the relative mobility of pairs SI2 and 1 0/ 1 2 is correct when 4M urea is added to SDS-PAGE, anomalies have been observed for other subunits like subunits I and 2 1 5 Moreover under the same conditions By-type subunits migrate faster than Dy subunits though the Mr of the former is larger than the latter (Fig. I ). This
suggests that full denaturation for all high Mr subunit is not accomplished in 4M urea, and
that conformational differences between allelic subunits still exist. In accordance with this Field et al. 16 reported that subunit 20 was incompletely denatured in 6M guanidinium chloride, though denaturation appeared complete when a stronger chaotropic agent, such as guanidinium thiocyanate was used. Conformational changes can be observed in detail using transverse gradient gel electrophoresis (TGGE) in which a gradient of urea, from 0 to 8M, perpendicular to the direction of migration, is formed 1 7 (Fig. 2). Observation of these separations shows differences between x- and y-type subunits, and helps in clarifying some of the anomalies observed in one dimensional gels with a constant 4M urea concentration.
1 20
Wheat Structure, Biochemistry and Functionality
o
U R E A•
8M P 1 20
Figure 2 Transverse gradient gel electrophoresis of high Mr glutenin subunits present in
two different bread wheat cultivars
Unfolding patterns, as seen on TGGE, are different for x- and y-type subunits. It appears that x-type subunits have a slow and continuous change of mobility across the urea gradient whereas y-type have a sudden change as urea concentration increases. The mid point of the unfolding transition is different for Dy and By subunits and this accounts for anomalous mobilities observed between these homeoallelic subunits in 4M urea. The unfolding pattern reveals that as urea concentration increases, the mobilities of subunits 1 0 and 1 2 are strongly affected becoming slower compared to larger subunits 7+8 and 1 7+ 1 8 present at the Glu-Bl locus. Further increase i n urea concentration results in these latter alleles being more affected in order of mobility in accordance with molecular weight of the subunits. A peculiar behaviour is seen for subunits 1 and 2*. Both reverse their migration compared to subunits 4 and 5 as urea concentration increases, but whereas the order is in agreement with molecular weights for the pair 5 and 2* this is not the case for pair 4 and I , the latter being larger than the former. From these observations it i s difficult to firmly assess what are the factors for different conformational changes' among different allelic subunits. Several features of high Mr glutenin subunits can affect conformation and their differential behaviour under denaturing conditions and in presence of SDS . As mentioned
FIG
121
Wheat Protein Composition and Quality Relationships
earlier, a striking difference between x- and y-type subunits is represented by the presence of a tripeptide motif which is present only in the former type of subunits but not in the latter; also the number of repeats is different between allelic subunits. This variation can affect and stabilize certain conformations compared to others, resulting in differential behaviour of certain alleles toward strong denaturating agents. The other important feature of high Mr glutenin subunits is the number and distribution of cysteine residues as they play major role in the formation of glutenin polymers. Three and five cysteine residues are present in the N-terminal region of x- and y-type subunits respectively, whereas one only is present in the C-terminal part of the molecule. In addition an extra cysteine residue is present in the repetitive domain toward the C-terminal region in y-type subunits, except Ay-type subunits, and near the N-terminal region in the Dx type subunit 5 . Recent studies have demonstrated that variation i n the number of cysteine residues of high Mr glutenin subunits can occur and is detectable by RP-HPLC separations. In fact comparative analyses of reduced and reduced and alkylated subunits, using 4-vinylpyridine as alkylating agent, revealed a differential effect of the alkylation on proteins encoded at different loci and on x- or y-type subunits, according to their different number of cysteine residues1S, Such analyses on subunits encode.d at the Glu-Bl locus, allowed Margiotta et aI· 18 to postulate that subunit 20 would have a lower number of cysteine residues, on the basis of its chromatographic behaviour compared to subunits 7 and 1 7 which have been shown to possess four cysteine residue (Table 2). This was supported by results of Tatham et al. 19 who reported, on the basis of N-terminal studies, that two cysteine residues present in the N-terminal region of subunit 20 had been replaced by two tyrosine residues and postulated that subunit 20 possess only two cysteine residues. The same chromatographic studies also gave strong support to the existence of a By-type subunit associated with subunit 20 which was termed 20y. The number of cysteine residues in subunit 20 was recently confirmed and their relative positions assessed20,21 The presence of one cysteine residue in the C- and the N-terminal regions was established (Fig. 3).
Table 2 Retention times (min) oj reduced and reduced and alkylated high Mr glutenin subunits encoded at the Glu-B I locus. Time difference was calculated (a) and this difference was expressed as % oj the retention time ojreduced subunits (b)
SublUlit
Reduced
Reduced Alkylated
Time difference (8)
% (b)
Cysteine number
7
67.9
35.9
32.0
47.1
4
17
68.9
36.5
32.4
47.0
4
13
61.1
30.9
30.2
49.4
50.0
34.7
1 5.3
30.6
50. 1
42.4
7.7
1 5.4
6
20
n.d. n.d. 2
1 22
Wheat Structure, Biochemistry and Functionality
Dx5
�
1
.... fWpetltlYe 1Iom.1n �� I--�-----------------------------� � �
7
7m
1
�7 ���� ���� Bx20 �-----�----'�__ __ __ __ __ __ __ __ __
1
m
Figure 3 Representations of high Mr glutenin subunits Dx5, Bx7 and Bx20. Linked bars represent intramolecular disulfide bridges
3
EFFECT
ON
QUALITY
CHARACTERISTICS
OF
STRUCTURAL
DIFFERENCES IN HlGH Mr GLUTENIN SUBUNITS
It appears always more evident that cysteine residues play a major role in affecting dough viscoelastic properties. At the
Glu-D1
locus the two allelic pairs
5+ 1 0
and
2+ 1 2
have been associated with good and poor technological properties respectively. The absence of recombination between the two pairs has prevented any conclusion about the relative importance of the x- and the y-type subunits. Comparison of the DNA sequences of subunit
10
and
12
led Flavell et al 22 to suggest that a more regular pattern of J3-turns in
the central repetitive domain of subunit
as a consequence of a higher proportion of
10,
consensus-type repeats, was responsible for providing better elastic properties to this subunit with a consequent effect on dough elasticity. On the other hand Greene et aI . 1 3 in considering the difference between the pairs
2/5
on the one hand and
pointed out that the additional cysteine residue present in subunit
2
5
1 01 1 2
on the other,
compared with subunit
would affect the dough system more profoundly since it would promote a differential
cross-linking, thus endowing dough with increased strength. Very recently Gupta and MacRitchie2 3, using several biotypes and a set of recombinant inbred lines, showed that superiority of the allelic pair locus and of
1 7+ 1 8
over
20
at the
Glu-B1
5+ 1 0
over the
2+ 1 2
at the
Glu-D1
loci was essentially due to the significantly
greater size distribution of polymeric proteins, associated with
5+ I 0
and
1 7+ 1 8,
as
indicated by the proportion of % of unextractable polymeric protein in the total polymeric protein and confirmed that dough strength is primarily controlled by the proportion of the larger sized or unextractable polymers. These authors reported that there was no difference in the quantities of the pairs
5+ 1 0
vs
2+1 2
and
1 7+ 1 8
vs
20
(now known to be made of
two subunits) in the total reduced polymeric proteins, suggesting that contrastating effects of these subunits are caused by a factor other than quantitative differences between them. The observed differences in polymerizing capacity of the pair
2+ 1 2
5+ I 0
compared to the pair
has to be ascribed to differences in their structure; e.g., the extra cysteine residue of
subunit
5 vs 2 as suggested by Greene et
al. 13
A similar explanation can be offered to explain the results obtained comparing pairs
1 7+ 1 8 vs 20.
As subunits
18
and
20y
should be structurally very similar, like all the y-type
subunits, the observed qualitative differences, between the pair
1 7+ 1 8
versus the pair
Wheat Protein Composition and Quality Relationships
1 23
20+2Oy, are most likely the result of structural differences between subunits 1 7 and 20. The most important difference between the two pairs of subunits is the absence of two cysteine residues in subunit 20 compared to subunit 1 7+ 1 8, in particular, the former lacks the second and the third cysteine residue in the N-terminal region. This, as also speculated for subunits 2 and 5, might have a profound effect on glutenin polymer formation and on their size distribution. Recently, Kohler et al 24 found that in x-type subunit 7 the first and the second cysteine residues are involved in an intra-molecular disulphide bond and, hence, should not affect glutenin polymer formation; moreover, the third and the fourth cysteine residues, present respectively in the N- and C-terminal regions, are very likely involved to form inter molecular disulphide linkages. It is very likely that the two cysteine residues of subunit 20 are involved in intermolecular disulfide linkages, the only difference with subunit 7 being the absence of an intra-molecular disulphide bond and the position of the cysteine residue in the N-terminal region possibly involved in an inter molecular disulphide bridge. If this is the case, the differences in the amount of insoluble glutenin polymers observed by Gupta and MacRitchie23 remain puzzling, unless the particular position and environment of the cysteine residue in the N-terminal domain of subunit 20 affects the formation of glutenin polymers and their size distribution. Less clear is the influence that the central repetitive domain and the structure that it can adopt might have on dough properties. Andrews and Skerritt25, based on antibody studies, postulated that certain amino acid sequences contributed more effectively to dough strength. The sequences they identified are those that would promote the formation of /3-tum secondary structure, with a greater proportion of these epitope sequences associated with greater dough strength. As suggested by Kasarda 1 /3-spiral regions might interact with one another, perhaps through side by side alignment of the spirals. In this respect subunits possessing a larger repetitive domain, such as 2 .2, 2.2*, 1 2 l > or 2 . 1 * (Fig. I), might have a different influence on dough properties compared to allelic subunits with a smaller repetitive domain. Investigation on the contribution of single high Mr glutenin subunits to the functional properties of a dough using the 2g-Mixograph, in which purified high Mr glutenin subunits have been incorporated into the dough, have shown a significant positive correlation between subunit molecular weight and mixing time26. Preliminar studies incorporating subunits 2.2, 2.2*, 1 2 1 have shown that they have positive intluence on dough mixing properties compared to smaller allelic subunits 2 or 12.
4 LOW Mr GLUTENIN SUBUNITS AND MUTATED GLIADIN COMPONENTS Differently from high Mr subunits, low Mr subunits, due to their complexity and heterogeneity, have been less characterized, though their effect on flour technological properties and results of their characterization are being produced in an attempt to claryfY their role in glutenin structure. Low Mr glutenin subunits are usually subdivided into B, C and D subunits based on their mobilities in SDS-PAGE and their isoelectric points27•28 Most subunits are included in the B group which are the most basic of the major storage proteins and have lower mobilities than <X.-, /3- and y-gliadins; the C group has a wide range of isoelectric points and mobilities in SDS-PAGE similar to that of <X.-, /3- and y-gliadins.
1 24
Wheat Structure, Biochemistry and Functionality
The D group includes the most acidic subunits and possesses the lowest mobilities among the low Mr subunits. DNA sequences reported for low Mr subunits have shown that they are closely related to y-gliadins as they have similar structure and identical number of cysteine residues (eight). Disposition of cysteine residues are, however, different; in tact in y-gliadins cysteine residues are all located in the large C-terminal domain, whereas in low Mr subunits one cysteine is present in the short N-terminal region29 N-terminal sequence studies have indicated the existence of two main types of low molecular weight glutenin subunits30,3 1 . The sequence of the most abundant type begins with serine (LMW-s) whereas the complete sequence is available only for the least abundant type whose N-terminal sequence starts with methionine (LMW-m). Both type of sequences were found in the B-group of low molecular weight glutenin subunits, whereas N-terminal sequences of the C-group corresponded mainly to y- and a-type gliadins. Strong similarities exist between the LMW-s and LMW-m type of sequences, the major difference between them is the absence of the cysteine residue at position 5 in the LMW-s type compared to the LMW-m, though it has been speculated that additional cysteine might be in a different position32. In recent years it has appeared always more and more clearly the presence, in the glutenin complex, of subunits with N-terminal sequences corresponding to those of monomeric gliadins32. Masci et al.33 found that of the two biotypes present in the bread wheat cultivar Newton, differing in their I D encoded ro-gliadins, gliadins which resembled the electrophoretic patterns of Chinese Spring (CS) and Cheyenne (CNN), only the first one possessed two l D-coded D-type low Mr glutenin subunits. Purification and determination of N-terminal amino acid sequences of these two subunits revealed homologies with I D coded ro-gliadins present in Chinese Spring. Moreover, when these subunits were treated with a fluorogenic reagent (ABD-F), which specifically alkylate sulfhydryl groups, both subunits were fluorescent contrary to what is observed for ro-gliadins34 This led Masci et al.34 to postulate that D subunits were very likely formed as a consequence of a mutation of an ro-gliadin gene (or genes), such that one or more cysteine codons was produced. Similarly to D subunits, that are clearly related to ro-gliadins from which they differ by the presence of cysteine and that makes them part of the glutenin fraction, a- and y-gliadins also may behave like glutenin subunits if the number and/or the position of the cysteine residues allow the possibility to form intermolecular disulphide bonds. a- and y-gliadin type sequences have in fact been found in the residue of both bread and durum wheat32,35 In particular, the y-gliadin type sequences found present a cysteine in position 26, not present in the true y-gliadins. This extra cysteine has also been reported in the nucleotide sequence of y-gliadin clones by Scheets and Hedgcoth36 and recently by D'Ovidio et a1 37 and it is likely to be involved in intermolecular disulphide bonds because the other eight cysteines, known to be involved in intramolecular disulphide bonds, are normally present. The possibility that these kinds of y-gliadin may be part of the glutenin fraction has also been shown by Kohler et al. 24 who found a disulphide bond between two peptides with sequences belonging to low-molecular weight glutenin subunits and y-gliadin respectively. However, the cysteine residue present in the y-gliadin peptide did not correspond to the one present in position 26, but to position 8 1 , in which a phenylalanine is usually reported.
1 25
Wheat Protein Composition and Quality Relationships
S STRUCTURAL DIFFERENCES OF LOW Mr GLUTENIN SUBUNITS AND THEIR EFFECT ON QUALITATIVE PROPERTIES Correlative studies have contributed to establish relationships between different low Mr allelic type and flour technological properties. As far as qualitative differences between LMW-s and LMW-m type are concerned, no data is available but again the role of cysteine residues and their position is very likely to be of extreme importance in their contribution to glutenin polymer formation as already stressed for the high Mr glutenin subunits. Lew et aJ32, comparing the structural differences between low Mr subunits and y-gliadins, have hypothesized that the cysteine residues forming intermolecular disulfide bonds are positioned in the N- and C-termini for the LMW-m-type sequences. Because LMW-s-type do not have any cysteine residue at the N-terminus, at least in the first fifty arninoacid residues, is not clear what makes them chain extenders, how they likely act because of their predominance in the best quality wheat. According to them, the presence of cysteine residues at the N- and C-termini might restrict interactions of the repeating sequence region located in the N-terminal half of the molecule, whereas their presence at only the C terminus might leave this region available to interact with equivalent region of other molecules. A possible relation with quality of the two different types of low Mr subunits comes from results of Masci et al. 35 who have found that between the two biotypes of the durum wheat cultivar Lira, one possessing the y-gliadin 42 and the associated LMW- I , and the other possessing the y-gliadin 4S and LMW-2, the latter possessed a higher amount of LMW-s type compared to the former. It has been hypothesized that mutated gliadins having an odd number of cysteine residues may act as chain terminator and tend to limit the molecular weight distribution of glutenin polymers, with consequent negative effects on quality characteristics such as dough strength1 . Though this has yet to be experimentally proved, some hints of the negative effects of mutated gliadins comes from the work of Masci et al. 32. These authors reported that the two biotypes, present in the bread wheat cultivar Newton, one possessing and the other not possessing D subunits of low Mr differ also in quality characteristics, as assessed by the SDS sedimentation test. Because the biotype without D subunits presented higher values of SDS-sedimentation volume, these authors suggested, for these subunits, a similar role to that proposed for certain (l- and y-type glutenin subunits as the effect on quality is concerned. These subunits present in fact an extra cysteine residue compared to the ancestral (l- and y-type gliadins due to a mutation of a serine codon that makes them able to link intermolecularly and to act as chain terminators. Table 3 SE-HPLC separation ojproteins extractedfrom the two biotypes, present in the
bread wheat cultivar Newton, differingjor the absence (CNN-type) or presence (CS-type) oj the D subunits
Peak I (%) Newton CNN Newton CS
51.1 5 1 .3
Peak 2 (%) 4 1 .7 39.6
Peak 3 (%) 7.2 9.2
UPP (%) 53.0 50.0
126
Wheat Structure, Biochemistry and Functionality
Separation of proteins present in the two biotypes, on SE-HPLC, according to Gupta et a) 38, indicated no difference in the amount of total polymeric glutenin (% Peak I ) between the two biotypes, whereas a slightly larger amount of unextractable proteins (% UPP) was associated with the CNN-biotype compared to the CS-biotype.
6 CONCLUSIONS Biochemical and molecular studies are contributing to the elucidation of structural differences among allelic subunits of high and low Mr glutenin subunits in order to establish the role these differences have in affecting flour functional properties. Whereas there is increasing confirmation of the importance of the number and position of cysteine residues in both types of glutenin subunits, the role of length and structure adopted by the central repetitive domain needs further investigation. To this end, novel genes are being produced and drastic changes in the structure of corresponding polypeptides generated. For instance high Mr glutenin subunits varying in the length of the repetitive region have been constructed. Further incorporation of these modified genes into wheat, with established transformation procedures, will offer an additional approach to explore structure functionality relationships.
References D.O. Kasarda, 'Wheat is Unique', Am. Assoc. Cereal Chem., St Paul, MN, 1 989, p. 277. F. MacRitchie, Adv. Food Nutr. Res., 1 992, 36, 1 . P.I. Payne, Ann. Rev. Plant Physiol. , 1 987, 38, 1 4 1 . R B . Gupta and K.W. Shepherd, Proc. 3rd Int. Workshop Gluten Proteins, (R Lasztity and F. Bekes, eds.), 1 987, p. 1 3 . 5. P.I. Payne and G.J. Lawrence, Cereal Res. Commun. , 1 983, 1 1 , 29. 6. N P. Harberd, D. Bartels and R D. Thompson, Biochem. Genet. , 1 986, 24, 579. 7. P.R. Shewry, N.G. Halford and A S . Tatham, J. Cereal Sci., 1 992, 1 5, 1 05 . 8 . R. D'Ovidio, E. Porceddu and D. Lafiandra, Theor. Appl. Genet., 1 994, 88, 1 75 . 9. M. Tahir, A Pavoni, G.F. Tucci, T. Turchetta and D. Lafiandra, Theor. Appl. Genet. , In press. 1 0. P. Reddy and R. Appels, Theor. Appl. Genet. 1 993, 85, 6 1 6. 1 1 . P.R Shewry, N.G. Halford and A S . Tatham, Oxford Surveys of Plant Molecular and Cell Biology, 1 989, 6, 1 63 . 1 2 . A S . Tatham, P . R Shewry and B.1. Miflin, FEBS Letts., 1 984, 177, 205 . 1 3 . Greene, F.e., Anderson, 0.0., Yip, R.E., Halford, N.G., Malpica-Romero, J-M. and Shewry, P.R. Proc. 7th Int. Wheat Genet. Symp. IPSR, Cambridge, 1 988, p. 73 5 . 1 4. A.P. Goldsbrough, N.J. Bulleid, R B . Freedman and R B . Flavell, Biochem. J., 1 989, 263, 837. 1 5 . D. Lafiandra, R D'Ovidio, E. Porceddu, B. Margiotta and G. Colaprico, J. Cereal Sci., 1 993, 18, 1 97. 1 6. 1M. Field, A S . Tatham and P.R Shewry, Biochem. J , 1 987, 247, 2 1 5 . 1 7. D.P. Goldenberg and T.E. Creighton, Anal. Biochem., 1 984, 138, 1 .
1. 2. 3. 4.
.
Wheat Protein Composition and Quality Relationships
127
1 8 . B. Margiotta, G. Colaprico, R D'Ovidio and D. Lafiandra, J. Cereal Sci. , 1 993, 1 7, 22 1 . 1 9. A S . Tatham, lM. Field, IN. Keen, PJ. Jackson, and P.R Shewry, J. Cereal Sci. , 1 99 1 , 1 4, I l l . 20. M.H. Morel and l Bonicel, Proc. Wheat Kernel Proteins, 1 994, p. 1 83 . 2 1 . F . Buonocore, C. Caporale and D . Lafiandra, J. Cereal Sci. , 1 995, I n press. 22. RB. Flavell, AP. Goldsbrough, L.S. Robert, D. Schnick and R.D. Thompson, Bio/Technology, 1 989, 7, 128 1 . 23 . RB. Gupta and F . MacRitchie, J. Cereal Sci. , 1 994, 1 9, 1 9. 24. P. Kohler, H.-D. Belitz and H. Weiser, Z. Liebenm. Unters. Forsch., 1 993, 1 96, 239. 25. lL. Andrews and lH. Skerritt, J. Cereal Sci. , 1 994, 19, 2 1 9. 26. F. Bekes, O.D. Anderson, PW. Gras, RB. Gupta, A Tam, C.w. Wrigley and R AppeJs, 'Improvement of Cereal Quality by Genetic Engineering', (RJ. Henry and lA Ronalds, eds.), 1 994, p. 97. 27. p.r. Payne and KG. Corfield, Planta, 1 979, 1 45, 83. 28. Al Jackson, L.M. Holt and P.I. Payne, Genet. Res. Camb., 1 985, 46, 1 1 . 29. P.R Shewry, MJ. Miles and A S. Tatham, Prog. Biophys. Molec. Bioi. , 1 994, 61, 37. 30. D.D. Kasarda, H.P. Tao, P.K. Evans, AE. Adalstein and S W. Yuen, J. Exp. Bot. , 1 988, 39, 899. 3 1 . H.P. Tao and D.D. Kasarda, J. Exp. Bot. , 1 989, 40, 899. 32. E.lL. Lew, D.D. Kuzmicky and D.D. Kasarda, Cereal Chem. , 1 992, 69, 508. 33. S. Masci, E. Porceddu, G. Colaprico and D. Lafiandra, J. Cereal Sci. , 1 99 1 , 1 4, 35. 34. S . Masci, D. Lafiandra, E. Porceddu, EJ.-L. Lew, H. Peggy Tao and D.D. Kasarda, Cereal Chem., 1 993, 70, 58 1 . 35. S . Masci EJ.-L. Lew, D. Lafiandra, E. Porceddu and D.D. Kasarda, Cereal Chem., 1 995, 72, 1 00. 36. K Scheets and C. Hedgcoth, Plant Sci. 1 988, 67, 1 4 1 . 37. R D'Ovidio, M . Simeone, S . Masci, E. Porceddu and D.D. Kasarda, Cereal Chem. , 1 995, In press. 38. RB. Gupta, K Khan and F. MacRitchie, J. Cereal SCi. , 1 993, 1 8, 23.
CAPILLARY ELECTROPHORESIS: A STATE-OF-THE-ART TECHNIQUE FOR WHEAT PROTEIN CHARACTERIZATION
1. A. Bietz', G. L. Lookhartb, S. R. Beanc and K. H. Suttond •
b C
d
Food Physical Chemistry, USDA-ARS, National Center for Agricultural Utilization Research, 1 8 1 5 North University, Peoria, IL 6 1 604 U.S.A. USDA-ARS, U.S. Grain Marketing Research Laboratory, 1 5 1 5 College Ave., Manhattan, KS 66502 U.S.A. Dept. of Grain Science and Industry, Kansas State University, Manhattan, KS 66506 U.S.A. New Zealand Inst. for Crop and Food Research, Ltd., Private Bag 4704, Christchurch, New Zealand
1 INTRODUCTION It has long been recognized that wheat is critically important to humanity, and that many of its important properties, such as its role in breadmaking, are closely associated with its gluten proteins. Knowledge of gluten's composition is thus useful in evaluating wheat quality, and for identifying genotypes during breeding and marketing. Gluten's unique functional properties also permit many nonfood applications. Gluten is extremely heterogeneous and complex, however, demanding powerful analytical methodsl. Many methods of chromatography and electrophoresis can be used to analyze gluten. Until recently, however, electrophoresis techniques have not advanced as rapidly as those of chromatography [especially high-performance liquid chromatography (HPLC)2]. Most electrophoresis procedures have been manual, labor-intensive, and slow, and results are difficult to quantify. In recent years, however, methods of capillary electrophoresis (CE) have evolved that significantly enhance resolution and reproducibility of electrophoresis, while reducing analysis time and permitting accurate quantitation. Commercial CE instruments are now available, and CE has been shown applicable to proteins3• CE is, in principle, a simple technique. A tube connects two buffer reservoirs, to which high voltage is applied. A means is provided to introduce samples, and the capillary is cooled to dissipate heat and maintain constant temperature. Proteins may be detected on-column, based on UV absorbance. A computer provides system control and data acquisition. The chemistry behind CE separations is a little more complex. Protein mobilities depend both on net charge, reflecting amino acid compositions and buffer pH, and on electroendosmosis, which moves buffer and solutes toward the cathode. Net mobility is thus the sum of these forces. Mobility and selectivity vary with buffer pH, and even electrically neutral molecules can be separated. Many further modifications are possible. The capillary surface can be modified to change its adsorptive characteristics. Detergents, denaturants, or organic solvents can be added to the buffer. Sieving media can be introduced into the capillary. Column dimensions, temperature, or voltage can be varied. Thus, although CE is a simple method in principle, many variables affect separations, making myriad types of separations possible. For these reasons, we have begun to develop and apply CE methods for separation of wheat gluten proteins. Progress to date is here reviewed and summarized.
2 CE OF GLIADIN Wheat proteins were first fractionated more than 35 years ago by a process analogous to CE, moving boundary electrophoresis4• In this method, proteins migrate in an open tube under the influence of an applied electric field. The success of this method strongly suggested that CE should be applicable to gluten proteins. Indeed, the first CE separations of gliadins extracted
129
Wheat Protein Composition and Quality Relationships
10
Figure 1 CE in pH 9.0 0.06M sodium borate buffer, containing 20% ACN and 1% SDS, of Centurk wheat proteins extracted with 30% ethanol. From Biett.
15
20 Minutes
25
30
35
Figure 2 CE in pH 2.5 phosphate buffer, containing polymeric additive, of 30% ethanol-soluble Centurk wheat proteins. From Bietz6•
with 30% ethanol, done in an alkaline borate buffer containing sodium dodecyl sulfate (SDS) and acetonitrile, had resolution roughly comparable to that of RP-HPLC (Figure 15•7). Separations were rapid, automatic, easily quantified, and complemented other methods. Wheat varieties were readily differentiated by their CE patterns. Reproducibility was a serious problem with this buffer, however - migration times gradually increased from run to run. Protein adsorption or insolubilization can change current, column dimension, or electroosmotic flow, causing migration times to vary. This can be a real problem for gluten proteins because of their interactive and aggregative tendencies, and their low solubility in aqueous buffers. This reproducibility problem, although controllable by extensive between-run washes, prompted testing of alternate CE buffer systems. An acidic phosphate buffer containing a cellulose derivative separated ethanol-soluble wheat proteins better than did the first buffer system (Figure 2). With this buffer, later-eluting proteins are primarily gliadins, while proteins eluting early « 1 0 min) are albumins and globulins, which migrate rapidly due to high charge densities at low pH. Run-to-run reproducibility with this system was excellent, both for migration times and injection volumes. Comparison of analyses by CE and reversed-phase high-performance liquid chromatography (RP-HPLC) for the same protein extracts showed that both methods could differentiate most wheat cultivars - even ones closely related - but that resolution of CE was slightly higher. This was confirmed by CE of gliadin peaks from an RP-HPLC separation: CE frequently resolved multiple components from a single isolated peak. Thus, the real advantage of CE is that it complements RP-HPLC, providing another high-resolution method of protein fractionation. Werner et al.8 developed still another system for gliadin fractionation. They used an acidic aluminum lactate buffer and a coated capillary that prevented proteins from adsorbing to the silica. Good separations resulted, which easily differentiated wheat varieties. Obviously many possible types of gliadin CE separations exist; we may still not yet know the best methods.
3 IMPROVEMENTS IN CE METHODS Recent studies of Lookhart and Bean9 significantly improved CE separations of gliadins under acidic conditions. By optimizing temperature, voltage, injection time, and extraction conditions, and by reducing capillary length and diameter, excellent and reproducible gliadin separations were achieved in an acid phosphate buffer in about ten minutes, less than half the time previously required (Figure 3). In another recent studylO, Lookhart and Bean modified capillary cleaning protocols and added 20% acetonitrile or detergents (such as lauryl
1 30
Wheat Structure, Biochemistry and Functionality 10 "'" IDcaplllry l
y
B
-_ a -
TIme, min
Figure 3 CE (pH 2.5 phosphate buffer) of 30% ethanol-soluble TAM 1 07 proteins on 50 11m and 2 0 11m capillaries. From Lookhart and Bean9•
2
4
I \ ,
. .
Minutes
8
10
Figure 4 CE (pH 2.5 phosphate buffer) of Shawnee gliadins. Migration times for each protein type were identified by CE of individual peaks from a RP-HPLC separation of gliadin. From Lookhart and Bean12•
sulfobetain) to the buffer. These further improved resolution and reproducibility of many CE separations in an acid phosphate buffer system. To be widely used and accepted, CE results must be reproducible between laboratories. Bietz and Lookhart recently tested this by comparing the same samples with similar instruments and procedures in two laboratoriesll. While results between laboratories generally agreed well, elution times sometimes shifted significantly when different lots of the same commercial buffer were used. Constant buffer pH and ionic strength are critical for satisfactory reproducibility. Clearly, individual lots of commercial buffers may vary in pH or ionic strength; homemade buffers, prepared entirely by gravimetric and volumetric methods, are probably preferable. We are now beginning to understand the basis of CE separations better, and can begin to relate CE data to results of other methods. Lookhart and Beanl2 isolated gliadin peaks by RP-HPLC, and then characterized them by gel electrophoresis and by CE. Multiple components were often resolved by CE from single HPLC peaks, again showing the complementary nature of CE and RP-HPLC. In addition, this study showed the order in which ethanol-soluble wheat proteins elute upon acid CE (Figure 4): albumins and globulins elute first, followed by (X - and p -gliadins, y -gliadins, and finally by w -gliadins. This order of mobility is the same as in acid gel electrophoresis, showing that protein charge is the primary determinant of mobility in acid CEo
4 APPLICATIONS OF CE As noted above, one major reason for analysis of gluten proteins - especially gliadins - is to differentiate varieties. Such analyses may be especially valuable in breeding programs, and during marketing for identifying and selecting wheats having desirable functional characteristics. Each of the above-described CE procedures readily discriminates among wheat cultivars, even ones very closely related, based on their differing gliadin "fingerprints." A typical example, showing CE patterns of gliadins of several hard red spring wheat varieties using the rapid acid phosphate analysis system of Lookhart and Bean9, is shown in Figure 5 . Many qualitative and quantitative differences exist among the .patterns. In a related application, Bietz and Schmalzried7 used CE to differentiate U.S. hard red spring and hard red winter wheat classes. Examination of CE results for many wheats revealed apparent differences between peak distributions for gliadins from wheats of these two classes.
131
Wheat Protein Composition and Quality Relationships 50
40
}
30 20 '0
11"". "n
Figure 5 CE (pH 2.5 phosphate buffer) of gliadins from hard red spring wheat varieties. From Lookhart and Bean9•
·' 0 '---,.120-�-!: ' 5-�-'c 30:--� 25-�--:' 0 -�--'Minutes
Figure 6 Averaged acidic CE separations of gliadins from 16 hard red winter and 16 hard red spring wheat varieties. Differences in peak distributions indicate characteristic class-related differences. From Bietz and Schmalzrietf.
This became much more apparent when the averaged data sets were compared, however (Figure 6). Most hard red winter wheats contain much more late-migrating proteins - probably y- or w -gliadins - than do hard red spring wheats. Many other applications for CE are already emerging. For example, the ability to quantify CE data accurately permits analysis of effects of environment on wheat protein synthesis. Lookh art has found that amounts of early-eluting albumins and globulins in acid phosphate CE patterns are greater in wheats grown under hot, dry conditions. Such quantitative differences may help explain, and be predictive of, the lower baking quality of such wheats. Lookhart has also identified specific late-eluting peaks in electrophoregrams of gliadins from wheat varieties containing rye translocations that reliably indicate y -secalins, coded by rye genes in translocated chromosome segments. CE also gives useful separations of other wheat protein classes. As shown in Figure 2, rapid, high-resolution separations of albumins and globulins can be achieved simultaneously with analyses of gliadins in an ethanol extract. CE is also useful for evaluating the nature and composition of proteins sequentially extracted from wheat. For example, Shomer et alt3 used CE to compare proteins sequentially extracted with 80% ethanol and O. I M acetic acid from Israeli and U.S. spring and winter wheat varieties. Other yet-unpublished studies, both at our Peoria and Manhattan laboratories, have achieved good CE separations of reduced glutenin subunits by acid phosphate CEo These examples show that excellent CE separations are now possible for each major wheat polypeptide type.
5
CE OF HIGH MOLECULAR WEIGHT (HMW) GLUTENIN SUBUNITS
Analysis of wheat glutenin, especially its unique HMW subunits, is of special interest because of the relationship of the composition of HMW glutenin subunits to breadmaking quality14.1S. Werner et alB first used CE to separate glutenin's HMW, quality-associated subunits using the Applied Biosystems ProSort system. This method provides a sieving matrix that separates protein-SDS complexes primarily based on size, as in SDS-polyacrylamide gel electrophoresis (PAGE). Excellent resolution of HMW glutenin subunits occurs, permitting their identification and relation to quality characteristics. Werner16 recently provided an excellent example of how this method of glutenin HMW subunit analysis can be used. Total storage proteins were extracted from wheat, and analyzed at different dilutions of ProSort sieving matrix, causing migration rates to vary. Ferguson plots of the resulting data revealed molecular weights of HMW glutenin subunits that closely
132
Wheat Structure, Biochemistry and Functionality
0.00. ,----------
0.015
Olano
0.010
OJ''''
0.005
E c ...
O.oo:J
" .
�
0.000
0.010
0.005
0.000
�.-�.-�.-�.-�.-�,-�.-�,
I
10
12
Karamu
����-L�-L�����L-�
ElcdroehtioII Ti_(min)
Figure 7 Size-based CE separation, by modified ProSort method, of HMW glutenin subunits of the wheat varieties Karamu and Tritea.
10
Electroelution Time (min)
12
14
Figure 8 Size-based CE separation, by modified ProSort method, of HMW glutenin subunits of the wheat varieties Dtane and Karamu.
matched those from DNA sequence analyses. Results suggested that the anomalously high molecular weights typically found for HMW glutenin subunits upon SDS-PAGE may result from decreased binding of SDS, possibly due to subunit glycosylation 17. Sutton recently modified the ProSort method to examine HMW glutenin subunits of New Zealand wheats. Use of a 95:5 mixture of ProSort buffer and methanol, combined with enrichment of the HMW subunits by a precipitation step, gives improved separations. An example, showing a standard mixture of eight HMW subunits from the varieties Karamu and Tritea, is shown in Figure 7. Excellent resolution of all HMW subunits results, with no overlap from earlier-eluting low MW subunits. Sutton previously used RP-HPLC to characterize HMW glutenin subunits of New Zealand varieties18• Otane, of high baking quality, and Karamu, of poor baking quality, were studied in detail. Both varieties had HMW subunits 2+1 2 and 7+8 (according to standard SDS-PAGE nomenclature), but Otane also contained subunit 2*. RP-HPLC also showed that the subunits designated "8" in these two varieties are different, and that Otane has more subunit 7, which may contribute to its better performance. Sutton recently compared these results with those of CE using the modified ProSort method. CE, however, like SDS-PAGE, did not differentiate subunit 8 in these two varieties (Figure 8). Quantitative results from CE agreed closely with those of RP-HPLC, however. Thus, SDS-PAGE, RP-HPLC, and CE each provide different analyses of HMW glutenin subunits. This comparison provides another example of the complementary nature of CE and RP-HPLC, and reminds us that all methods are and will remain highly useful. Sutton also used CE to characterize nonstandard HMW glutenin subunits in European varieties provided by Dr. Domenico Lafiandra. SDS-PAGE had shown the presence of HMW Glu- 1 D subunits designated 2.2* in the line MG3 1 5 and 2.2 in MG7249. Upon CE using the modified procedure, these subunits migrated much slower than did "normal" HMW glutenin subunits: 2.2* had an apparent MW of ca. 3 1 0 kD, and 2.2 eluted at a position corresponding to ca. 330 kD. The MWs and elution order of these subunits were reversed between SDS-PAGE and CE, however, possibly due to differences between sieving characteristics of the two methods. This study again emphasizes the complementary nature of CE to other separation methods.
6 CONCLUSIONS Capillary electrophoresis, though recently introduced, has already been shown valuable for fractionation and characterization of wheat proteins, and for identifying wheats and predicting
Wheat Protein Composition and Quality Relationships
133
their functional properties. CE methods are rapid, versatile, sensitive, and offer high resolution. Most important, however, CE is the first electrophoresis procedure to be automated, it is the first electrophoresis procedure for which accurate quantitation is readily achieved, and it provides separations complementary to those of other protein fractionation methods. CE does, of course, have some disadvantages, and has not yet been optimized for all applications - but these problems are being overcome as our understanding of CE methodology grows. Clearly, CE has become a valuable addition to other methods of wheat protein analysis.
References 1 . C. W. Wrigley and J. A. Bietz, "Wheat Chemistry and Technology," Y. Pomeranz, ed., Amer. Assoc. Cereal Chemists, St. Paul, MN, 1 988, Vol. J, Chapter 5, p. l 59 . 2. F. R. Huebner and 1. A. Bietz, "High-Performance Liquid Chromatography of Cereal and Legume Proteins," Amer. Assoc. of Cereal Chemists, St. Paul, MN, 1 994, p.97. 3. 1. P. Landers, R. P. Oda, T. C. Spelsberg, 1. A. Nolan and K. 1. Ulfelder, BioTechniques, 1 993, 14, 98. 4. R. W. Jones, N. W. Taylor and F. R. Senti, Arch. Biochern. Biophys., 1 959, 84, 363. 5. J. A. Bietz and E. Schmalzried, Cereal Foods World, 1 992, 37, 555. 6. J. A. Bietz, "Gluten Proteins 1993", Association of Cereal Research, Detmold, Germany, 1 993, p.404. 7. J. A. Bietz and E. Schmalzried, Food Science and Technology, 1 995, 28, 1 74. 8. W. E. Werner, J. E. Wiktorowicz and D. D. Kasarda, Cereal Chern., 1 994, 71, 397. 9. G. Lookhart and S. Bean, Cereal Chern., 1 995, 72, 42. 1 0. G. L. Lookhart and S. R. Bean, Cereal Chern., submitted. 1 1 . J. A. Bietz and G. L. Lookhart, Cereal Foods World, 1994, 39, 603. 1 2. G. Lookhart and S. Bean, Cereal Chern., in press. 1 3 . I. Shomer, G. L. Lookhart, R. Vasiliver and S. Bean, 1. Cereal Sci. , in press. 14. J. A. Bietz and J. S. Wall, Cereal Chern. , 1 972, 49, 4 1 6. 1 5 . P. I. Payne, Ann. Rev. Plant Physiol. , 1 987, 38, 1 4 1 . 1 6. W . E . Werner, Cereal Chern. , 1995, 72, 248. 17. K. A. Tilley, G. L. Lookhart, R. C. Hoseney and T. P. Mawhinney, Cereal Chern., 1 993, 70, 602. 1 8 . K. H. Sutton, 1. Cereal Sci. , 1 99 1 , 14, 25.
ELECTROPHORETIC AND CHROMATOGRAPHIC CHARACTERIZATION OF GLU-A l ENCODED HIGH Mr GLUTENIN SUBUNITS
B. Margiotta\ M. Urbano·, T. Turchetta2, G. Colaprico· • Gerrnplasm Institute, C.N.R., Via Amendola 1 65/A, 70 1 26 Bari, Italy 2 University of Tuscia, Department of Agrobiology and Agrochemistry, 0 1 1 00 Viterbo, Italy
1 INTRODUCTION Variation at the Glu-l loci has been studied extensively in recent years primarily because of the effects produced by corresponding encoded high U glutenin subunits on flour technological properties. At the Glu-A l locus in particular, three alleles have been described by Payne and Lawrence designated as a, b and c and respectively known as 1 , 2 * and null, the latter corresponding to a silent gene, which does not code for a detectable protein on SDS-PAGE. New allelic variants at the same locus have been identified subsequently by SDS-PAGE analysis of various Triticum species2-4. The characterization of new allelic variants detected at the Glu-A l locus in hexaploid and tetraploid wheat by a combination of electrophoretic and chromatographic techniques, is reported in this communication.
2 MATERIALS AND METHODS Several durum and bread wheat cultivars and lines maintained at the Germplasm Institute were used. SDS-PAGE analysis was carried out on 1 0% polyacrylamide gels according to Payne et aI., and 1 0% urea SDS-PAGE were prepared following the procedure reported by Lafiandra et a1. 6 . Two-dimensional electrophoretic separations, were carried out according to Holt et aC, combining isoelectric focusing (IEF) or non-equilibrium pH gradient electrophoresis (NEPHGE) in the first dimension with SDS-PAGE in the second. Transverse gradient urea gels were performed following the procedure reported by Goldenberg and Creighton8 with some modifications. High Mr glutenin subunits prepared as described by Marchylo et al. 9 were also analysed by RP-HPLC.
3 RESULTS 3. 1 One-Dimensional SDS-PAGE
SDS-PAGE separation of different high Mr glutenin subunits encoded at the Glu-A l locus is shown in Figure 1 . The mobility of the novel subunits (Figure la and Ib, lanes 3 ,
135
Wheat Protein Composition and Quality Relationships
1
2
3
4
5
B
2
3
4
5
6
P1
Z.l·
I)
b)
Figure 1 . One-dimensional SDS-PAGE (10%) separation of high M, glutenin subunits from hexaploid and tetraploid genotypes a) and in the presence of urea 4M b). 1, PK15684 (2. 1 *, 7+8, 2**+ 10�; 2, Drago (1, 6+8); 3, Fenix biotype b (1 ', Bx+ 15); 4, Duramba (2 *, 13+ 16); 5, MG 826 (2 *" Bx*+By); 6, MG 2984 (2 *2, 20). 5, 6) are compared with those of subunits I (lane 2), 2 * (lane 4) and 2. 1 * (lane I ) described recently by Tahir e t al. \0. The durum wheat cultivar Fenix has subunit l ' described by Branlard et ae, which had a mobility slightly different from subunit 1 . Two subunits with greater mobility than subunit 2 * , indicated as 2 * \ and 2 * 2, were found in some T. durum lines. Separation of the same subunits in 4M urea gels, is shown in Figure lb. The presence of urea in the gels had different effects on the mobilities of different subunits. In particular the differences among 2 * , 2 * \ and 2 *2 were enhanced. 3.2 RP-HPLC Analyses
The results of RP-HPLC separations of reduced and reduced/alkylated subunits from each genotypes carrying the different IA allelic subunits are reported in Table I . The order of elution of reduced and reducedlalkylated subunits was: 2. 1 * , I , 2 * , I ', 2 * \, and2 * 2.These analyses indicate that allelic variants can be separated into two groups: the first, including 2. 1 * , I , 2 * and l ' having longer retention times in both the reduced and reduced and alkylated forms and the second with subunits 2 * . and 2 * 2 having lower retention times.
Wheat Structure, Biochemistry and Functionality
136
Table I. Comparison oj the retention times oj reduced and reducedlalkylated subunits and the retention time differences.
Glu-AI
Subunit x
Reduced (min)
Reduced and alkylated
60.9
J��2 48.6
J�l�
60. 8
46.4
14.4
2*
60.0
45.7
1 4. 3
I'
59.2
45.6
1 3 .6
32.3
24.9
7.4
_ _ _______________________________
2. 1 *
_ _
Time Difference
��
���
________________
���
___________
__________
_____.
12.3
___________
1}
______.
3.3 Two-Dimensional Separations of High Mr Glutenin Subunit Variants Encoded on Chromosome la
Two dimensional electrophoretic separations (IEF x SDS-PAGE and NEPHGE x SDS-PAGE) of new allelic variants were also performed (Figure 2). The new subunits had different isoelectric points from allelic subunits 2. 1 * , 2 * and 1 . In particular, subunits 2 * . and 2 *2 were more basic than 2 * and 1 , and subunit 2 * 2 was detected only by using NEPHGE x SDS-PAGE. 3.4 Transverse Gradient Gel Electrophoresis (TGGE)
The conformational behaviour of different high Mr glutenin subunits was examined in transverse gradient urea gels. All lA subunits analysed showed a similar electrophoretic transverse gradient profile with a midpoint transition at approximately 6M urea. Interestingly, the migration of subunit 2. 1 * at 4M urea concentration was greater than that of the smaller subunit 2 * *. This may be ascribed to incomplete unfolding of subunit 2. 1 * (Figure 3a) at urea concentrations between 4M and 8M. The patterns for subunits 2 * . and 2 * 2 (Figure 3c) reflect the same differences in Mr with respect to subunit 2 * (Figure 3b), 1 and I ' (Figure 3b and d). The equilibrium midpoint of the transition for these subunits was at approximately 6M urea and was the same for all subunits.
4 DISCUSSION The combination of different chromatographic and electrophoretic techniques provided additional information on gluten subunits encoded at the Glu-l loci. Further heterogeneity was revealed with alleles differing in size, surface hydrophobicity and charge. The importance of these differences with regard to their effects on gluten structure and flour functionality remains to be established.
137
Wheat Protein Composition and Quality Relationships
Ilf
•
..
I)
fr
-
r
-
I ..
...
h
L
Figure 2. Two-dimensional electrophoresis (IEF x SDS-PAGE) oj high M, glutenin subunits present injIour mixtures: PK 15684 + MG 7249, a); MG 826 + Cheyenne, b); Fenix biotype a + Fenix biotype b c). The high Mr glutenin subunits present in all the cultivars and lines are indicated
REFERENCES I.
P. 1 . Payne and GJ. Lawrence, Cereal Research Comm, 1 983, 11, 29. J.G. Waynes, P. 1 . Payne, Theor Appl. Genet., 1 987, 74,7 1 . G. Branlard, J.C. Autran, P.Monneveux, Theor.Appl. Genet., 1 99 1 , 78, 3 5 3 . B. Margiotta, G . Colaprico, R . D'Ovidio, D. Lafiandra, J Cereal Sci. , 1 993 , 17, 22 1 . P. 1 . Payne, L.M. Holt, C.N. Law, Theor. Appl. Genet. , 1 98 1 , 60, 229. D. Lafiandra, R. D'Ovidio, E. Porceddu, B Margiotta, G. Colaprico, J. Cereal Sci. , 1 993, 18, 1 97. 7. L.M. Holt, R. Austin, P. l . Payne, Theor. Appl. Genet. , 198 1 , 60, 237. 8. D.P. Goldenberg and T.E. Creighton, Anal. Biochem., 1 984, 138, I . 9. B A Marchylo, I.E. Kruger, D.w. Hatcher, 1. Cereal Sci., 1 989, 9, 1 1 3 . 10.M. . Tahir, A . Pavoni, G.F. Tucci, T. Turchetta, B. Margiotta, i n "Wheat Kernel Proteins", CNRlUniversity of Tuscia, 1 994, p.253. 2. 3. 4. 5. 6.
1 38
Wheat Structure. Biochemistry and Functionality
I
i lE A (II
... I
I
i lE A 'II
.. I p
II
cl
Figure 3 . Transverse gradient urea gels (O-8M urea): Pk-15684 a); Solitaire b); MG 2984 + MG 826 c); Fenix biotype a+ Fenix biotype b d).
BMW AND LMW SUBUNITS OF GLUTENIN OF Triticum tauschii, THE D GENOME DONOR TO HEXAPLOID WHEAT.
M. C.Gianibelli, 1,3, R.B. Gupta, 2 and F. MacRitchie 1 1.CSIRO Division ofPlant Industry, Grain Quality Research Laboratory, North Ryde, NSW, 2 1 13, Australia. 2.CSIRO, Division ofPlant Industry, GPO Box 1 600,Canberra, ACT 260 1 ,Australia. 3.Permanent Address: Facultad de Cs. Agrarias y Ftales, Cat. Cerealicultura, UNLP, P.O.Box 3 1 , 1900, La Plata, Argentina.
1 INTRODUCTION The wild grass Triticum tauschii (Aegilops squarrosa 2n=2x=14, DD) is considered to be the D genome donor to Triticum aestivum 1,2 being a potentially rich source of variation for agronomically important traits 3 . The endosperm storage proteins of hexaploid wheat are important components because of their influence on the baking quality characteristics of the flour. This protein consists of two major fractions: gliadins and glutenins. Gliadins are monomeric proteins whilst glutenins are polymeric aggregates of High-Molecular-Weight (BMW) or A subunits and Low Molecular-Weight (LMW) or B and C subunits held together by disulphide bonds. Allelic variations in both glutenin subunits are important in controlling dough properties. Changes of up to 80% in dough resistance to extension and up to 25% variability in extensibility can be accounted for by LMW and BMW glutenin subunits together 4 . Studies on the composition of BMW glutenin subunits and gliadins (endosperm proteins) have been reported S,6 on 60 and 79 lines respectively. However, no research has been conducted on the composition of LMW glutenin subunits in T. tauschii. This could be due to the fact that these proteins ,when separated by SDS-PAGE, overlap with monomeric proteins making it difficult to distinguish them. The recent development of the technique of one-step one-dimensional SDS-P AGE of reduced and alkylated proteins 7 permits a clear resolution in the LMW area (B and C subunits). The present paper describes the variation in BMW and LMW glutenin subunits in a collection of Triticum tauschii. ,
2 MATERIALS AND METHODS A collection of 1 7 1 Triticum tauschii accessions belonging to the botanical varieties typica (97), meyeri (24), strangulata (20) and intermediate (30) with origins in Turkey, Iran, Afghanistan, Pakistan, Azerbaijan and Turkmenia, were studied. Chinese Spring and Hartog were included as controls for BMW glutenin subunits for the alelles 2+12 and 5+10 of Triticum aestivum and one accession of Triticum macha for the allele 2. 1+13. Controls for LMW subunits were: Gabo (lBL- IRS), Chinese SpringiGabo (IAL-IRS; lBL-IRS), Halberd (IBL- IRS), Hartog (IAL-IRS; IBL-IRS) and Norin-61A. BMW and LMW glutenin subunits were analysed by one-step SDS-PAGE 7 . This electrophoretic method separates the glutenin subunits A (HMW), B and C (LMW), without overlapping of albumins, globulins and gliadins. , As reported previously S 6 , the BMW glutenin subunits have been designated by the superscript " both for the Glu-D'1 locus and for the first reported Glu-IY3 locus. Superscript I has been used to distinguish gene symbols of the D genome of T. tauschii from its homologous gene loci in the D genome of hexaploid wheat.
Wheat Structure, Biochemistry and Functionality
140
3 RESULTS
AND
DISCUSSION
3.1 High Molecular Weight glutenin subunits
A wide variation in HMW glutenin subunit composition was found between different accessions of Triticum tauschii in the collection under study. Forty different alleles were observed , resulting from the combination of different x and y-type subunits. The frequencies of these alleles are presented in Table 1 . Table 1 : Frequencies ofA, B and C glutenin subunit patterns of Triticum tauschii Band Pattern A
Frequency
Band Pattern B
Frequency
Band Pattern C
Frequency
2 + 10
26
1
36
1. 5 + 10.1
24
2
23
2
16
2 + 10.1
23
3
15
3
12
1. 5 + 10
12
4
12
4
12
2 + 12.2
9
5
9
5
9
3 + 10
8
6
8
6
9
2 + 12
7
7
7
7
8
5 + 10
6
8
7
8
8
1.5 + 10.2
9
7
9
7
5 + 12
5 5
10
6
10
7
3 + 10.1
4
11
6
11
4
12
5
12
4
2.1 + 10.2
3
1
17
1.5 + 12.2
3
13
5
13
4
2 + 12.3
2
14
4
14
4
2
15
3
15
1 + 12
2
16
2
16
1 + 10.1
2
17
2
17
1 + 10
3
3
3
2.1 + 10
2
18
2
18
3
1.5 + 12
2
19
2
19
3
3 + 12
2
20
2
20
2
4 + 12
2
21
21
2
4 + 12.2
2
22
22
2
null - l0
23
23
2
2.1 + 12.2
24
24
2
25
25
2
1.5 + 1 1
26
26
2
1.5 + 10.3
27
27
2
2 + 11
28
28
2
2 + 12.4
29
29
2
2 + 12.1
30
2
2 - null
31
1
3 + 10.2
32
1
2.1 + 12.3
3 + 12.2
33
4 + 10
34
4 + 10.2
35
5 + 11
36
5 + 10.1
37
5* - null
39
5 + 12.2
5* + 1 2
38 40 41 42 43
Wheat Protein Composition and Quality Relationships
14 1
The larger number of alleles found (40) ,compared with the results of Lagudah and Halloran ' and William et al. 6 , could be due to the larger screening performed, the presence of five new bands and more recombination between x and y-type subunits. In contrast with the huge polymorphism found in the Glu-lY1 in T. tauschii, the Glu-Dl locus in T. aestivum encoded a lesser number of allelic variants 8,9. Although the alleles 2+ 12 and 5+ 10 are the most common in bread wheat cultivars, their frequency in the T. tauschii accessions is much lower. Only 1 3 accessions presented these alleles and most of them belonged to spp. strangulata var. strangulata. Eight subunits of the slow mobility x-type were identified and have been numbered I, 2.1, 1.5, 2, 3, 4, 5, 5 * in order of ascending mobility',6. From them 2. 1 and 1.5, have been previously observed in T. tauschii ',6 . Subunit 1 , with lower mobility than 2 . 1 , is first reported in this study in T. tauschii and its mobility is slightly less than subunit 1 of hexaploid wheat coded by the Glu-Al locus. The other subunit that has not been reported previously is 5*. This subunit has hi&her mobility in SDS PAGE than subunit 5 in T.tauschii and bread wheat. Recent studies in a bread wheat variety (Fiorello) show a 5 * subunit with higher mobility than 5 ; when we compared our subunit 5 * with that from Fiorello , it appears to have similar mobility. In agreement with Lagudah and Halloran and William et al ',6 the subunit 2.2 , the highest molecular weight glutenin subunit of bread wheat, was not observed in this collection , adding more evidence to the hypothesis of Payne et al. 11 that subunit 2.2 is the result of a rare unequal crossing-over with another gene which coded for a HMW glutenin subunit. Among the y-type, ten (10) subunits were observed, which were named 1 0.3, 10.2, 10. 1, 10, 1 1, 1 2, 12. 1, 12.2, 12.3 and 12.4 in accordance with their relative mobilities. The subunits 10.3, 10.2 and 10. 1 could correspond to those named 1 0.3, 1 0.2 and 10. 1 by Lagudah and Halloran '. In our study, 10.1 has only slightly higher mobility than the subunit 10. The small difference in molecular weight observed in our SDS-PAGE could be a result of minor mutations and/or deletions that affect protein charge and/or size. The subunit 10.3 is the y-type found in T.tauschii with higher molecular weight and it has slightly less mobility than subunit 8, coded by the Glu-B 1 locus in hexaploid wheat. Subunit 12.2 has the same mobility as subunit t2 ,,6. Both papers reported this subunit as associated with another subunit, called t l , which has similar relative mobility to subunit 10. Along with the x-type (2. 1 , 1 . 5, 2 and 3), they form a complex of three subunits of high molecular weight 6. In our study, no accessions showing three HMW glutenin subunits were found although 17 accessions with the subunit 12.2 (t2) were encountered. The subunit with 12** (t2) was not accompanied by a corresponding subunit similar to t 1 . Recently, Mackie 12 found that the subunit t l did not precipitate with 60% propan-1-01 as the other HMW subunits 13 and was also not soluble in NaCI, therefore not belonging to albumins or globulins. However this protein was present in the unreduced ethanol extract of storage proteins. This indicates that the t 1 subunit is not a HMW glutenin subunit in spite of its high molecular weight, due to the absence of intermolecular disulfide bonds and should be considered a monomeric protein 12.The protein extraction method that was used in this study first eliminates all the monomeric proteins , i.e. those that do not possess disulfide bonds in their structure. This is the reason why it is unexpected for t 1 protein to be present in our gels. Subunits 12. 1 and 12.3 showed lower and higher mobility respectively when compared with 1 2.2 .However, the other new y-type found, subunit 12.4, is very different to the other subunits of this group with a molecular weight markedly less than those reported previously for HMW glutenin subunits. This large difference in molecular weight may be explained by a loss of nucleotides corresponding to the repetitive domain of the coding genes. This is in agreement with the findings of D'Ovidio et aI. 14 that the differences in size of the allelic subunits detected at the Glu-D1 locus in hexaploid wheat is due to the variation in the central repetetive domain.
142
Wheat Structure, Biochemistry and Functionality
Figure 1 HMWglutenin subunit (A) patterns in Triticum tauschii lines. The controls (from
left side) are
T.
macha (lst lane), Fiorello (9th lane) and Chinese Spring (J2th lane).
Interestingly, there was one accession that was null for x-type and similarly two were null for y-type. The lack of expression of Glu-D1] has not been previously reported. However, Payne et al. IS and Margiotta et al. 9 have found null forms in Nepalese bread wheat landraces. This lack of subunits was explained as a deletion of the gene 9 or as a silencing of the encoded gene for x-type subunits of the hexaploid wheat 14.
3.2 Low Molecular Weight glutenin subunits
Genes coding for LMW glutenin subunits are located on the short arms of group 1 chromosomes IA, IB and lD (Glu-3 loci). The D genome of T. tauschii is genomically identical to that of the D genome of hexaploid wheat 16. Lagudah and Halloran 17 have located the G/u}] and GIi-'] on the long and short arms respectively of the ID chromosome. Because of the linkage between GIi-] and Glu-3 in hexaploid wheats, it may be assumed that the Glu-1J locus is located , as the homologous Glu-3 locus, on the short arm of the ID chromosome in T tauschii. . This group of proteins has been subdivided i n B and C glutenin subunits, i n accordance with their relative mobility in SDS, the B group being the one with higher molecular weight and therefore, lower mobility.
Wheat Protein Composition and Quality Relationships
143
This group of proteins has been subdivided in B and C glutenin subunits, in accordance with their relative mobility in SDS-PAGE, the B group being the one with higher molecular weight and therefore, lower mobility. 3.2. J B Subunits. An extensive variation in the number and relative mobility of these subunits was observed in the material under analysis. Twenty nine different patterns were identified, while in T. aestivum, genes belonging to the Glu-D3 locus coded only for five 18. different patterns The number of bands varied from 1 to 4 ; a wider variation in mobility than those corresponding to Glu-D3 in hexaploid wheat was observed. (Some of them appear in Fig. 2) In some accessions , strongly stained bands could be observed , which may be the result of two or more bands with similar mobility and therefore similar molecular weight. Consequently, more genes are involved in those accessions . Other subunits with the same mobility and different staining could be also the result of differences in gene expression. A very sharp difference in the frequency of the patterns has been observed in the collection (Table 1 ) . Around 43 % of all the lines belonged to three major groups ( pattern # 1 : 2 1 .05%; pattern # 2 : 1 3 .45% and pattern # 3 : 8.77%) 3. 2. 2 C Subunit. Forty three different patterns were observed (some of them appear in Figure 2) for C subunits, higher than that observed in the B zone. This compares with the results reported in bread wheats 18 where only three different pairs of bands were recognised for the Glu-D3 locus in the faster mobility area. A greater number of genes are involved in the Glu-113 gene cluster. Components of LMW in most of the accessions were located in all regions of LMW patterns as occurs with the bands controlled by the D genome in polyploid wheat. Faster and slower bands were also detected in the C zone. A number of subunits ranging from 2 to 6 with a relatively wide difference in mobility was observed for the C subunits. Bands with different staining intensity were found, as previously described for B subunits. Despite the large variability observed in LMW subunits, the number of band combinations found in LMW glutenin subunits of T. tauschii is much lower than the expected number of such combinations on the basis of random association (29 B-subunits x 43 C-subunits = 1 247 combinations) indicating that genes coding for these bands are closely linked. The polymorphism of proteins controlled by gene clusters, as is the case of the proteins of wheat endosperm, could be explained by the following : 1 ) the number of active genes present in the gene cluster; 2) the number of alleles of each active gene; 3) the combination of the different alleles of active genes resulting in different band patterns. 4) recombination which occurs at low frequency might further increase the number of combinations. It is not possible to consider each of these patterns as allelic variants because hybridologic studies have not yet been done. Any of the cases mentioned before could happen given the 1 06 different patterns for LMW subunits ( B and C bands together ) found in the collection. A maximum number of9 subunits for LMW was present in T. tauschii (three B subunits and six C subunits). However, only a maximum of 5 subunits was found in the Glu-D3 b allele of hexaploid wheat. In the latter case, the lesser number of bands could be the result of the dyploidisation process which can cause gene inactivation and gene dosage compensation due to differential gene expression, both of which have been involved in the evolutionary process of polyploid wheats . Galili et af. 19 and Ciaffi et af. 20 have suggested this as the cause of gene inactivation for HMW glutenin subunits coded by the A genome. The high polymorphism found for LMW glutenin subunits (Glu-1f3 loci) should be useful genetic markers for genotype identification. More importantly, allelic differences in LMW gutenin subunits have been shown to be significantly related to flour qualities in bread 2 , 2 and durum wheat 23,24 . New LMW glutenin subunits could improve technological quality for bread flour. Recently, Cox et a1. 25 have reported a successful method for transferring genes from T. tauschii directly to hexaploid wheat.
144
Wheat Structure. Biochemistry and Functionality
Figure 2: LMW glutenin subunit (B and C) patterns in Triticum tauschii lines. The controls from left are Chinese Spring (1st lane), Halberd (2nd lane), Gabo ( 1 3th lane), Gabo l AL. I RS/I BL. I RS (14th lane) and Hartog l AL. IRS/lBL. I RS ( 1 5th lane). References
1 . H. Kihara, Agric. Hort. 1 944, 19, 889. 2. E. S. McFadden and E. R. Sears, J. Hered., 1 946, 37, 8 1 . 3 . R . AppeJs and E . S . Lagudah, J. Plant Physiol., 1 990, 17, 253 . 4. R. B . Gupta and F. MacRitchie, J. Cereal Sci., 1 994, 19, 19. 5. E. S. Lagudah and G. M. Halloran, Theor. Appl. Genet., 1 988, 75, 592. 6. M. D. H. M. William, R. 1. Pena, A. Mujeeb-Kazi, Theor. Appl. Genet., 1 993, 87, 257. 7. R. B. Gupta and F. MacRitchie, J. Cereal Sci., 1 99 1 , 14, 105. 8. P. R. Shewry, N. G. Halford and S. Tatham, J. Cereal Sci., 1 992, 15, lOS. 9. B . Margiotta, G. Colaprico, R. D'Ovidio and D. Lafiandra, J. Cereal Sci., 1 993, 17, 22 1 .
Wheat Protein Composition and Quality Relationships
145
10. D. Lafiandra, R. D 'Ovidio, E. Porceddu, B. Margiotta and G. Colaprico, 1. Cereal Sci., 1 993, 18, 197. 1 1 . P. I. Payne, L. M. Holt and G. 1. Lawrence, 1. Cereal Sci., 1983, 1, 3 . 1 2 . A . Mackie, PhD Thesis, University of Sydney, 1994. 1 3 . B. A. Marchylo, 1. E. Kruger, D. W. 1. Hatcher, 1. Cereal Sci., 1989, 9, 1 13. 14. R. D'Ovidio, E. Porceddu and D. Lafiandra, Theor. Appl. Genet., 1994, 88, 1 75. 15. P. I. Payne, L. M. Holt, E. A. Jackson, C. N. Law, Philos. Trans. R. Soc. London Ser. B., 1984, 304, 359. 16. G. Kimber and Y. H. Zhao, Can. 1. Genet. Cytol., 1983, 25, 5 8 1 . 1 7 . E. S. Lagudah and G . M . Halloran, Theor. Appl. Genet., 1989, 77, 8 5 1 . 1 8. R . B.Gupta and K . W. Shepherd, Theor. Appl. Genet., 1990, 80, 65. 1 9. G. Galili, T. Felsenburg, A. A. Levy, Y. Altschuler, M. Feldman, Proc. 7th. Int. Wheat Genet. Symp., Cambridge UK., 1988, p. 8 1 . 20. M . Ciaffi, D. Lafiandra, E . Porceddu and S . Benedettelli, Theor. Appl. Genet., 1993, 86, 474. 2 1 . R. B. Gupta , K. W. Shepherd and F. MacRitchie, 1. Cereal Sci., 1 989, 10, 169. 22. R. B. Gupta, 1. G Paul, G. B. Cornish, G. A. Palmer, F. Bekes and A. 1. Rathjen, 1. Cereal Sci., 1994, 19, 9. 23 . 1. C. Autran, B. Laignelet and M. H. Morel, Biochemie, 1987, 69, 699. 24. M. Ruiz and 1. M. Carrillo, Plant Breeding, 1995, 114, 40. 25. T. S. Cox , R. G. Sears, R. K. Bequette and T. 1. Martin, Crop Sci., 1995, 35, 9 1 3 .
RELATIONSHIPS BETWEEN BIOCHEMICAL PARAMETERS AND CHARACTERISTICS OF DURUM WHEATS.
M . C . Gianibelli
1
"
M . Ruiz 2, l M . Carrillo 2 and F. MacRitchie
QUALITY
I
I
CSIRO Division of Plant Industry, Grain Quality Research Laboratory, North Ryde, NSW, 2 1 1 3 , Australia. 2 Department of Genetics, E T S . I . Agronomos, Universidad Politecnica de Madrid, 28040 Madrid, Spain. 3 Permanent address: Facultad de Cs. Agrarias y Ftales, Cat. Cerealicultura, UNLP, P OBox 3 1 , 1 900, La Plata, Argentina .
I INTRODUCTION It has been shown that gluten composition is the major factor that determines differences 14 in quality parameters, such as firmness and elasticity in durum wheat flour doughs Gliadins and glutenins are the main groups of gluten proteins. Gliadins have single polypeptide chains, whereas glutenins form polymers of protein subunits linked by interchain disulphide bonds. Glutenins are subdivided into high (HMW) and low (LMW) molecular weight subunits. The association between HMW subunits and pasta quality characteristics are controversial . However a strong correlation has been observed between LMW subunits and quality parameters, such as the SDS sedimentation test and mixograph parameters 5 Differences in the quantity of LMW subunits were associated with variations in quality parameters between two French cultivars of durum wheat 6 The proportion of polymeric protein in total protein ( mainly HMW and LMW glutenin subunits) and the relative size distribution of polymeric protein have been strong correlated with dough strength in bread wheat 7 . The aim of this study was to investigate the effect of allelic variation for LMW glutenin subunits and gliadins in progenies from a cross where both parents had the same HMW glutenin subunits and also to analyse the relationship between biochemical and quality parameters in durum wheat .
2 MATERIALS AND METHODS A durum wheat cultivar with poor gluten quality, Oscar, was crossed with a strong gluten quality cultivar, Mexicali. F2 derived F4 grains were analysed electrophoretically for glutenin (LMW and HMW) and gliadin composition. Gliadins and glutenins were extracted according to the method outlined by Gupta and Shepherd 8. Gliadins were fractionated by acid (pH 3 . 1 ) polyacrylamide-gel electrophoresis (A-PAGE) 9 Grains from each F3 line were tempered at 1 6% moisture and milled using a Uda; cyclone milL Gluten strength was estimated by the modified SDS Sedimentation Test with some minor modifications 3 Mixing properties were assessed by the l O-g mixograph based upon the folIowing parameters: mixograph dough development time (MDDT), maximum height (peak mixing resistance, PR) and the difference between height at PR and after three minutes (resistance breakdown, RBD).
147
Wheat Protein Composition and Quality Relationships
Protein content (%P) was estimated by near infrared reflectance (NIR) with a Technicon Infralyzer 400. Vitreousness content (%V) was detennined in 200 kernels by the visual percentage of grains not showing yellowberry. A SE-HPLC technique was used to assess the molecular size distribution of proteins in SDS extracts following sonication and the amounts of different classes of proteins (polymeric, gliadins, albumins/globulins) as well as relative size distribution of polymeric proteins (Unexttactable Polymeric Protein, %UPP) were performed according to Gupta et a/I I . Chromatogram region Peak 1 was subdivided into two adjacent peaks p. and p • . corresponding to pure polymeric proteins and a mixture of smaller polymeric proteins and ID-gliadins, respectively · · . Peak 2 corresponded to gliadins and Peak 3 to albumins and globulins. The ratio of p. to p • . was also calculated.
3 RESULTS Differences in glutenins and gliadins from parents and some F2 grains are shown in Figures 1 , 2 and Table 1 .
8-LMW
C-LMW
2
3
6
7
8
9
10
11
Figure 1 Two-step one-dimensional SDS PAGE of glutenin subunits of the F2 progeny from the cross Oscar x Mexicali. Oscar (1) ; Mexicali (11)
1 48
Wheat Structure, Biochemistry and Functionality
2
3
4
5
II
7
8
9
10
Figure 2 A-PAGE fractionation of gliadins of the F2 progeny from the cross Oscar x Mexicali. Oscar (10) ; Mexicali (1)
Wheat Protein Composition and Quality Relationships
149
Table 1 Allelic differences between parents for gluten proteins and location of the genes
controlling them Protein class
Locus
HMW glutenin subunits
Glu-AI Glu-B I Glu-A3 Glu-B3 GIi-A I G1i-BI GIi-A2 GIi-A3
LMW glutenin subunits Gliadins
Oscar
Mexicali
null
null
7+8 LMW 4 LMW 6 + I l
y-5 1 y-42 a.-2
7+8 LMW 4 LMW I + 14
y-5 1 y-45 a.-I
00-29.5 1 2. 1 3
respectively. LMW and HMW glutenin Gliadin bands and gliadin blocks arc numbered according to subunits are numbered according to 14, 1 5 respectively. LMW glutenin subunits, encoded at Glu-B3, 6+1 1 and 1+14 are also termed LMW-I and LMW2 glutenin subunits patterns, respectively.
Mixograms of both parents are shown in Figure
OSCAR
3
MEXICALI
Figure 3 Mixograms of cultivars Oscar and Mexicali. MDDT: mixograph dough development time. PR: peak mixing resistance and RBD:resistance breakdown. Differences between parents in monomeric (gliadins, albumins and globulins) and total polymeric (mainly g1utenins) proteins are shown in Fig. 4 as well as the different relative size distribution of polymeric proteins (Fig. 5) based on extractability. Correlation coefficients between quality and biochemical parameters obtained by SE-HPLC in F4 1ines are presented in table 2. No significant correlations were found for protein content (%P) and vitreousness (%V) with the other variables analysed. Quality characteristics, evaluated through the SDS sedimentation test (SDSS), mixograph dough development time (MDDT) and peak mixing resistance (PR), were highly correlated with each other. They were also positively correlated with P I, P ill' and unextractable polymeric protein (%UPP) at highly significant levels (>0.00 1 ) and negatively with P I ', P2 and P3, the last one showing significance only at the 5% level. (Table 2) When principal component analysis was performed, variables SDSS, MDDT, PR, PI, P ill' and %UPP appeared positively related with the first main axis while P I ' and P2 were
Wheat Structure, Biochemistry and Functionality
1 50
related in a negative way. These variables were shown to be independent of r-breakdown (RBD), %V (first principal axis) and %P (third principal axis). Fig 6 represents F4 lines and parents in the first factorial layer ( variance of 70%). Lines with subunits LMW 1+14 (LMW-2 pattern) had the highest values for SDSS, MDDT, PR, PI. PI/I' and %UPP while lines with subunits LMW 6+ 1 1 (LMW-1 pattern) showed the lowest values.
Table 2 Simple correlation coefficients between qUillity characteristics and SE-HPLC parameters. '!IoV
%P
%V
1 .00
lOSS
MDDT
PR
RBD
1'1(%)
P1T4)
P2(%)
1'3(%)
0.08
1.00
0.00
-0.05
0.00
-0.09
0.83 -
-0.12
0.11
0.70 -
0.80 �
1 .00
-0.28
-0.09
-0.07
0.03
0.19
PI(%)
0.03
0.00
0.89 -
0.84 -
0.72 - -0.14
Pl'(%)
0.05
0.10
-0.85 - -0.78 - -0.67 -
0.19
-0.91 -
1 .00
P2(%)
-0.07
-0.05
-0.81 - -0.78 - -0.66 -
0.04
-0.94 '"
0.74 -
1.00
P3(%)
-0.09
-0.12
-0,45 '
-0.42 '
-0.37 '
0.24
-0.54 "
0.39 '
0.40 '
P11P1'
0.02
-0.07
0.90 -
0.83 -
0.69 - -0.19
0.97 - -0.97 - -0.86 - -0.48 "
UPP(%)
-0.02
-0.03
0.92 -
0.83 -
0.75 - -0.06
0.90 - -0.84 - ·0.80 - -0.67 -
'!loP
SDSS
MOOT
PR
RSO
1 .00
P11P1'
UPP(%)
1 .00
1.00 1 .00
1 .00
1.00
0.89 -
1.00
%V: % of vitreousness; %P: protein content; SDSS: SDS sedimentation test; MDDT: mixograph dough development time; PR: peak mixing resistance; RBD: resistance breakdown. P1(%), P 1 '(%), P2(%), P3(%): percentage of the SE-HPLC measurements of peaks I , 1 ' , 2, 3 respectively. UPP (%): % of unextractable polymeric protein. .. , .... , .... refer to significance at probability levels of 0.05, 0.01 and 0.001 respectively. ]50 ••0
A
]00.00
2S0.GO
t
200.00
1.50.00
10G.00
SO.GO
_
0.00
l S ll . 0 0
lOO.OO
'lso.GO
B
tfr
P2
�L-
t 200.00 �o.oo
100.00
so.oo
o . O�
Jj' P,
_. _ _
I !
P2 '�
LL. _ l,f'3_ �
Figure 4:Size Exclusion HPLC patterns of total protein. Oscar (A) and Mexicali (B).
151
Wheat Protein Composition and Quality Relationships
..
. .
A
- ...
.. ..
... ..
.. ..
... . ..
... ..
.....
.... 4----__2 I....
'" ...
.
-...
B
..i--.-L--L I
1....
.
-...
.
AA
' ", ..
I
a. ...
BB
.. ..
.. ..
, H."
.. ...
Figure 5 Size Exclusion HPLC patterns of: (A)-(AA) Extractable and unextractable protein from cultivar Oscar showing extractable (a) and unextractable (aa) polymeric protein and (B)-(BB) Extractable and unextractable protein from cultivar Mexicali showing extractable (b) and unextractable (bb) polymeric protein. J..
ABO
J..
"
P3 J..
J..
J..
J..
"
OSCAR
P2
J..
X
J..
.u.
J..
"
J..
P
UO-XCALI "
•
" PR
""
"
MOOT
"
SO�S p.,.
" "
'l.V
"
"
Figure 6 Plot of the 29 Fz derived F4 lines and the parentals in the first principal factorial axis defined by the parameters SDSS (SDS sedimentation test), MDDT, PR, RBD (Mixogram measurements), %P (Protein content), %V (Vitreousness), PI , PI" , Pz , P3 , P 1II" , and %UPP ( SE-HPLC measurements). .. LMW 1 pattern , • LMW 2 pattern.
Wheat Structure, Biochemistry and Functionality
152 4 CONCLUSIONS
SDS Sedimentation Test and the mixograph parameters , MDDT and PR are highly and positively influenced by the proportion of polymeric proteins (mainly glutenins) in the total protein content and the quantity of unextractable polymeric protein. The lines with the LMW l + 1 4 subunits (LMW-2 pattern) showed better quality, as estimated by SDSS, MDDT and PR, than the lines with the LMW6+ 1 1 subunits (LMW- l pattern). These differences are attributed to a greater proportion of polymeric proteins and a better polymerizing behaviour. The protein content (%P), vitreousness (%V) and r-breakdown (RBD) were not associated with dough strength parameters; therefore in a breeding program for durum wheat quality they should be independently estimated. The biochemical parameters obtained through Size Exclusion - HPLC have proved to be good indicators of dough strength and therefore a useful tool for breeding selection in early generations. Aknowledgements The authors wish to express thanks to O.R. Larroque for helpful collaboration. M.C.G. acknowledges support by the Consejo Nacional de Investigaciones Cientificas y Tecnologicas (CONICET) and Comision de Investigaciones Cientificas de la Provincia de Buenos Aires (CIC) of Argentina.
References N . E . Pogna, D. Lafiandra, P. Feillet and J. C. Autran, l. Cereal Sci., 1 988, 7, 2 1 1 . P . Feillet, O. Ait-Nouh, K. Kobrehel and J. C. Autran, Cereal Chern., 1 989, 66, 26. J . M . Carrillo, J. F. Vazquez and J . Orellana, Plant Breeding, 1 990, 104, 3 25 . M . I . P . Kovacs, N . K . Howes, D . Leisle and J . H. Skerritt , J . Cereal Sci., 1 993 , 18, 43. 5. M . Ruiz and J . M . Carrillo, Plant Breeding, 1 995, 114, 40. 6. J. C. Autran, B. Laignelet and M. H. Morel, Biochirnie, 1 987, 69, 699. 7. R. B . Gupta and F. MacRitchie, l. Cereal Sci., 1 994, 19, 19. 8. R. B. Gupta and K. W . Shepherd, Theor. Appl. Genet. , 1 990, 80, 65 9. D. Lafiandra and D. D. Kasarda, Cereal Chern., 1 985, 62, 3 1 4. 10. J. Dick and J. S . Quick, Cereal Chern., 1 983, 60, 3 1 5. 1 1 . R . B . Gupta, K. Kahn and F . MacRitchie, J. Cereal Sci. , 1 993 , 18, 23. 1 2 . H. D. Sapirstein and W. Bushuk, Cereal Chern., 1 985, 62, 372. 13. N . E . Pogna, J. C. Autran, F . Mellini, D. Lafiandra and P. Feillet, J. Cereal Sci., 1990,11, 1 5 . 1 4 . M . Ruiz and J. M. Carrillo, Theor. Appl. Genet., 1 993 , 87, 353 1 5 . P. I. Payne and G . J. Lawrence. Cereal Res. Cornmun . . 1 983. 1 1 , 29.
l. 2. 3. 4.
EFFECTS OF THE l BU1RS TRANSLOCATION ON GLUTEN PROPERTIES AND AGRONOMIC TRAITS IN DlJRUM WHEAT
Boggini G. ''', Tusa P. ''' , Di Silvestro S." and Pogna N . E .... Experimental Institute of Cereal Research, .. Section of Catania, Via Varese 43, 95 1 23 Catania, ** Section of Applied Genetics, Via Cassia 1 76, 00 1 9 1 Roma, Italy
Summary Six durum wheat lines containing the I BLlI RS chromosome translocation were grown in replicated plots in Sicily during two years of testing and analysed for their agronomical and quality characteristics. Yield and seed quality, as determined by SDS sedimentation volume and Alveograph and Mixograph parameters, were found to be lower and worse in the translocated lines as compared with those of three control durum wheat cultivars. The sticky dough and weak gluten characteristics of the I BLlI RS lines were likely due to the presence of secalins encoded by the G/i-RI locus on chromosome I RS and to the absence of low Mr glutenin subunits encoded by the Glu-3 locus on chromosome I BS. The occurrence of high M r glutenin subunits 7+9, which were shown to
exert positive effects on gluten strength in bread wheat, did not improve the poor dough properties of the translocated lines.
I INTRODUCTION The I BLiI RS chromosome translocation has been used extensively in bread wheat improvement programmes because of the high yield potential and disease resistence against leaf rust (Puccinia recondita spp. tritici), stem rust (Puccinia graminis spp. tritici) and stipe rust (Puccinia striiformis spp. tritici), conferred by genes located on chromosome I RS of rye I +4. However, most of the I BLl I RS bread wheat cuItivars are characterized by poor breadmaking quality and sticky doughS.;-7 The I BLiI RS translocation has been recently introduced into tetraploids wheat lines by crossing the bread wheat cv. Veery and
the durum wheat cv. CandoS. As expected, this lines showed a race-specific resistance against rust due to the Lr 26, Sr 3 1 and Yr 9 genes on rye chromosome I RS. The results reported in this communication concern the implication of the I BLlI RS translocation in grain quality and yield potential of six durum wheat lines containing high Mr glutenin subunits 6+8 or 7+9, the latter pair of subunits being very rare in durum wheat germoplasm.
154
Wheat Structure, Biochemistry and Functionality
2 MATERIALS AND METHODS 2. 1 Plant material
Seeds of six I BLl I RS translocation durum wheat lines (Titicum turgidum spp. durum) were kindly provided by B. Friebe. Each line was multiplied in head-rows for six generations and screened for morphological uniformity. Total proteins and ethanol-soluble proteins from seeds of the last self-pollinated generation were analysed by SDS-PAGE and A-PAGE respectively, and seeds from head-rows with identical protein patterns were bulked and used in this study. The I BLII RS lines, along with the durum wheat cvs Simeto, Ofanto and Duilio were grown in randomized blocks with three replications at Libertinia (Catania, Sicily) in 1 993 and 1 994 under husbandry conditions, similar to those used for commercial production. 2.2 Electrophoretic and technological analyses
Gliadins were extracted from single seeds with 70 % (v/v) ethanol and fractionated by A-PAGE as described previously9 The reduced total proteins from individual seeds were extracted and fractionated by SDS-PAGE according to Pogna el al. 9 "Straight run" tlours were produced from 3 K g o f grain from the bulk of three replications using a Bona 4RB laboratory mill with sieves of 54 and 42 GG. Protein content (% d. wt. ) was determined using the Inframatic 8 1 00 apparatus. The SDS sedimentation test was performed according to Mc Donald 1 0
Mixograph curves were obtained as described previously 1 1 + 1 2 The Alveograph evaluation of the I BLII RS lines and of the control durum wheat cultivars were carried out according to the I SO method 5530/4 and to the modified procedure developed by Boggini \ 3 , respectively. Yield and technological data were submitted to analysis of variance (ANOVA).
3 RESULTS AND DISCUSSION 3_1 Prolamin composition of 1 BL/I RS durum wheats
According to the gliadin nomenclature system of Kudryavtsev l4, the six I BLl I RS lines contained alleles c, (J and a at the gliadin loci Gli-A I (on chromosome I A), Gli-A2 (on chromosome 6A) and Gli-B2 (on chromosome 68), respectively. The lines inherited these alleles from the parental durum cv. Cando. Moreover, they showed six secalin components encoded by the Gli-R I ( Sec I ) locus on the short arm of chromosome I R ( Fig. I , arrows). SDS-PAGE fractionations of the reduced total proteins from five I BLi I RS lines showed high Mr glutenin subunits 6+8, which =
are encoded by the Glu-Bl locus on chromosome I BL ( Fig. 2 ). This subunit pair also occurred in the parental cv. Cando.
1
2
3
I. A -FAGt-· Figure of fractionation prolamins from (Jj I BLI R5; translocation line CY. 256 8 10, (2) FI from the cross CY. 256 8 10 x CY. Cappelli (durum wheat) and (3) CY. Cappelli. Secalins encoded by I U.S are arrowed.
155
Wheat Protein Composition and Quality Relationships
1
2 3 4 5 6
7
One line (25617127), contained Glu-HI encoded high Mr glutenin subunits
8 9 10 11 12
from the parental bread wheat cv. Veery. As far as we know, this is the l BU I RS sole translocation durum wheat genotype containing subunit pair 7+9, which is quite frequent in bread As cultivars. wheat the all expected, translocated lines were found to lack in low M r
7+9
glutenin subunits encoded by the Glu-B3 locus on chromosome l BS.
3.2 Agronomical and quality characteristics
.
, SDS-PAG�
fractionation of the reduced total proteins from the I BI., I �" lines provided hy Dr. B. r.riehe. , The lines 256 8'5 (C( umn nO 1 1), 25687 (column no 10) and
Figure 2.
�
256 8, 10 (column n 8) showed high Mr glutenin subumts 6+8, while the line 256 7 2 7 (column nO 3) showed high Mr glutenin subunits 7+9. The lines 256; 7,26 (column n ° 5) and 256/728 (column nO 2), which still appeared heterogeneous in this photograph, ajier six self-pollinated
generations showed only the high Mr glutenin subunits
Table 1 :
Source of variation
6 "- 8.
ANOVA showed significant variation for yield, heading time, kernel weight and test weight amongst the six I BLl I RS lines and the three control cultivars analysed ( Table 1 ). The effect of year was significant for all the agronomical traits except seed weight, whereas the e ffect of genoty pe x year interaction was significant at P < 0.05 for heading time.
Mean squares for agronomic traits in six 1 BUt RS durum lines and three control cultivan grown in Sicily during two yean of testing. Degrees
of freedom
Genotype (G) Year (Y) GxY interaction
u = p S O. O I ;
1 8
R
Y ield
1 7.75
8.64
Plant
Heading
height
date **
**
0.99 n. s.
... = p S O.05;
2 1 4 46
5 iO.30
\ 6.60
**
**
*
1 37 R6
1 ,557.4 1
n. �. **
1 33 . 1 9 n. s. n. s.
=
1 000 kernel
Hectolitre
weight
weight
444 . R 3
**
1 8.08 n. s.
23.46 n. s.
not significant.
88 57
1 0 1 .83
**
**
8.70 n. �,
Wheat Structure, Biochemistry and Functionality
156
Table 2:
Mean values over two years of testing for agronomic traits in six IBUIRS durum lines and three control cultivars. Yield
Genotype
Heading time (days
(tfha)
Hectoliter weight
from april 1 sl)
I BVI RS lines
b
1 000-kernel weight
Plant height
(g)
(kg)
(cm)
28. 1 bc 28.5 be 28.0 be 25.4 b 33.9 d 29.0 c
73.6 de 74.2 d 7 1 .2 ef 74.8 cd 70.5 f 73 . 1 de
27.8 24.8 26.3 27. 1 28.3 25.2
6.5 a 6. 1 a 5.8 a
1 6.8 a 18.7 a 1 7.7 a
79.7 ab 77.2 be 82. 1 a
44.5 a 43.2 a 43.2 a
80.3 a 85.7 a 76.7 a
Mean values of I BVI RS lines
2.8
28.8
72.9
26.6
82.4
Mean values of control cvs
6.2
1 7. 7
79.7
43.6
80.9
Friebe 25617, Friebe 25617, Friebe 25617, Friebe 256/8, Friebe 256/8, Friebe 256/8,
26 27 28 5 7 11
3.2 2.2 2.6 3.3 3.1 2.5
c
be b be be
b b b b b b
87.3 a 89.7 a 8 1 .0 a 8 1 .7 a 79.7 a 75.3 a
Control evs Simeto Ofanto Duilio
Values followed by the same letters in columns are not significantly different at P to Duncan's multiple range test
=
0.05 according
The I BLlI RS lines were not adapted to Sicilian environment because of their late heading, which resulted in lower kernel weight, test weight and yields as compared with the control cultivars (Table 2). Seed quality characteristics of the I BLlI RS translocation group were compared with those of the control group by analysis of variance (Table 3 ). There were significant differences (P < 0.0 1 ) amongst the genotypes for most of the characteristics; the effects of year and genotype x year interaction were significant for some quality parameters. However, the variance component for genotypes accouqted for most of the variation and the effects of year and genotype x year interactiorl� were small in magnitude for most quality characteristics. Table 3:
Source of variation
Mean squares for quality traits in six I BUIRS lines and three control cultivars grown in Sicily during two years of testing.
Genotype (G) Year (Y) GxY interaction **
=
Protein SDS content sedimen tation volume
Degrees of freedom
p > O.OI
5.27 * * 226.97 0. 1 3 n.s. 1 7·3.36
8
2.25
8 *
=
**
26.05
p > 0.05
**
**
ALVEOGRAPH PIL
W
5,006.68 1 ,88 1 .46
**
*
=
Judgement
Mixing time
Peack height
1 . 1 6 D.S. 10.76 * * 1 26. 1 8 D.S. 229.72 * * 2 . 1 2 D.S. 2.00 n.s. 80.22 D.S. 40.50 *
**
n.S.
MIXOGRAPH
not significant
Wheat Protein Composition and Quality Relationships
157
TABLE 4: Mean values over two years of testing for quality traits in six IBUIRS
durum lines and three control cultivars. Genotype
Protein content
SDS
sedimentation
(% d. wt.)
index
(ml)
MIXOGRAPH
ALVEOGRAPH W
(j x 1 0-4)
P/L
Judge-
Mixing
Peak
ment time (mm) height (mm)
1BV1RS lines
47.5 be 37.5 d 39.5 d 46.5 c 4 1 .5 cd 39.5 d
6.5 a 5.5 a 5.5 a
52.0 a 40.5 a 49.0 a
62.5 a 67.5 a 53.5 b
3.2
1 .3
35.8
42.0
2.2
5.8
47.2
6 1 .2
1 .5 1 .0 1.5 1 .5
d
3 . 1 ab 3.6 a 3.0 ab 2.9 ab 2.7 ab 3.8 a
42.0 b 41.5 b 43.5 a
166.3 a 12 1 .7 be 157.6 ab
3.2 ab 1 .4 b 1 .9 ab
27.5
55.9
42.3
148.5
28.0 28.5 24.8 29.0 28.8 26.3
Simeto Ofanto Duilio
13.2 d 1 3.6 cd 1 3.6 c
Mean value of the lBV1RS lines
1 5.2
Mean value of the control cvs
1 3.5
26 Friebe 256/7, 27 Friebe 256/7, 28 Friebe 256/8, 5 Friebe 256/8, 7 Friebe 256/8, I I
46.5 a 3 1 .5 a 33.5 a 30.5 a 34.5 a 38.0 a
58.6 de 70.4 de 35.7 de 80.5 cd 33.4 e 56.7 de
1 3.4 cd 1 5. 5 b 15.5 b 15.2 b 1 5.5 b 1 6.2 a
Friebe 256/7,
c
c
e c c
b
b b b LO b 1 .0 b
Control cvs
Values followed by the same letter in columns are not significantly different at P
to Duncan's multiple range test
=
0.05 according
The IBLlIRS group was characterized by values of SDS-sedimentation volume significantly lower than the control group (Table 4). Significant differences amongst the IBLllRS lines for this quality parameter were observed only in 1 994 (data not shown). All the lines were significantly different from the control cultivars in Alveograph W and mixograph peak height and judgement, whereas there was no significant difference between the two groups for the Alveograph PIL and mixograph mixing time. These results suggest that the durum lines containing the IBLllRS translocation produce weak doughs as observed in most bread wheat cultivars containing this translocation5+6. The high protein content of the IBLllRS lines as compared with that of the control cuItivars was likely due to their poor yield potential in the Sicilian environment. In this context it is noteworthy that the presence of the IBLll RS translocation in bread wheat cultivars has been found to be associated with high yield potential and reduced protein content7, 15+ 1 6. Doughs from the IBLl l RS lines showed a strong tendency to stick to the mixing bowl and hands, and could not be pulled out cleanly from the mixing bowl; in contrast the control cultivars showed a low degree of dough stickiness. Finally, dough quality characteristics of line 256/7/27, which contains high Mr glutenin subunits 7+9, were not significantly different from those of the remaining IBLll RS lines, which possess glutenin subunits 6+8 (Table 4).
158
Wheat Structure, Biochemistry and Functionality
4 CONCLUSION None of the I BL/I RS durum wheat lines here analysed had quality characteristics that would make them suitable for production of pasta or bread. Their poor quality characteristics are likely to be largely due to two factors: (i) the presence of secalins encoded by the Gli-Rl locus, on chromosome I RS and (ii) the absence of low Mr subunits encoded by the Glu-B3 locus on chromosome l BS. The negative effects of the l BLll RS chromosome on dough quality (weak gluten and dough stickiness) were not mitigated by the presence of the high quality glutenin subunits "7+9"17. These negative effects on gluten quality can be eliminated or, at least, minimized through three possible genetic approaches that would not affect the rust resistance potential of the I RS durum lines. The first approach is deletion of a small chromosome segment containing the GIi-Rl locus by irradiation of the translocated lines. This approach has been successfully applied to bread wheat 1 8 Alternatively, the phI c allele, which promotes homreologous pairing, can be introduced in a homozygous condition into the l BLl I RL lines, and allosyndetic recombinants possessing the Glu-B3 locus along with genes for rust resistance can be selected in the self-pollinated progeny of Glu-B3IGIi-Rl heterozygotes. Six secalin-free allosyndetic recombinants containing the Lr 26 gene have been recently selected in the 1 2 8 progeny of one 1 BLlIRS line related genetically to those here analysed (manuscript in preparation). The third approach consists in the incorporation of the l ALIlRS translocation from the bread wheat cv. Amigo into tetraploid wheat cultivars possessing LMW-2 type glutenin subunits encoded by chromosome I BS, in order to mitigate the deleterious effects on dough strength due to loss of this chromosome arm. The I ALII RS translocation is currently being transferred into elite durum genotypes in our lab.
References
1.
6.
P . BARTOS and I. BARES, Euphitica, 1 97 1 , 20: 425 F. J. ZELLER, 'Proceedings 4th International Wheat Genetic Symposium', Columbia, 1 973, MO, p. 209. S. RAJARAM, Ch. E. MAAN, G. ORTIZ-FERRARA and A. MUJEEB-KAZI, 'Proceedings 6th International Wheat Genetic Symposium', S. Sakamoto ed., Plant Germoplasm Institute, Faculty of Agriculture, Kyoto University, Kyoto, Japan, 1 983, p. 6 1 3 . F. J. ZELLER. and S. L. K. HSAM, S. L. K., 'Proceedings 6th International Wheat Genetic Symposium', S. Sakamoto ed., Plant Germoplasm Institute, Faculty of Agriculture, Kyoto University, Kyoto, Japan, 1 983, p. 1 6 1 . D. J. MARTIN and B. G. STEWART, Euphitica, 1 986, 35: 225 . R. J. PENA, A. AMAYA, S. RAJARAM and A. MUJEEB-KAZI, Jour. Cer. SCi. ,
7.
D. FENN, O. M. LUKOW, W. BUSHUK and R. M. DEPAUW,
2.
3.
4. 5.
.
1990, 12: 105.
Cer. Chern. , 1994,
70: 1 89.
8. 9.
1 0. 11. 12.
B. FRIEBE, F. J. ZELLER and R. KUNZMANN, Theor. Appl. Genet., 1 987, 74: 423 . N. E. POGNA, J. C. AUTRAN, F. MELLINI, D. LAFIANDRA and P. FEILLET, Jour. Cer. Sci. , 1 990,
1 1 : 15.
C. E. Me DONALD, Cereal Food World, 1 985, 30: 674. G. BOGGINI and G. NILSSON, Cereal Res. Cornrn. , 1 976, 4: 3. G. BOGGINI and N. E. POGNA, Agricoltura e Ricerca, 1 990, 1 1 4:
59.
Wheat Protein Composition and Quality Relationships
13. 14. 15. 1 6. 17. 1 8.
159
G . BOGGINI, Molini d'Italia, 1 990. 4: 1 5 1 . A. M. KUDRYAVTSEV, Russian J o/Genet. , 1 994, 30: 69. A . S . DHALIWAL, D . J . MARES and D . R . MARSHALL, Cer. Chern. , 1 987, 64: 72. R. L. VILLAREAL, S. RAJARAM, A. MUJEEB-KAZI and E. DAL TaRO, Plant Breeding, 1 99 1 , 106: 77. N . E. POGNA, F. MELLINI, A. BERETTA and A. DAL BELIN PERUFFO, J Genet. & Breed , 1 989, 43: 1 7. E. MILLET and M. FELDMAN, 'Proceedings VIII International Wheat Genetic Symposium', Beijing, China, 20+25 July 1 993. (Abstract).
DURUM WHEAT FOR BREAD MAKING: RELATIONSHIPS BETWEEN PROTEIN MOLECULAR PROPERTIES AND TECHNOLOGICAL PARAMETERS
M. Carcea, N. Guerrieri* and L. A. Pasqui National Institute of Nutrition, Via Ardeatina 546, 00178 Rome, Italy *Department of Agricultural and Food Molecular Sciences, University of Milano, Via Celoria 2, 20133 Milano, Italy
1 INTRODUCTION Durum wheat (Triticum durum Desf.) semolina is used almost exclusively for pasta making. However, around the Mediterraneum and especially in southern Italy, there has always been a traditional consumption of bread made with remilled semolina. 1 A number of publications recently reviewed by Boyacioglu and D'Appolonia2 testify to past and recent interest in the use of durum wheat for bread making, as main ingredient or as improver of the baking quality of soft wheat flour. In 1 985 Boggini in a study on durum wheat for breadmaking concluded that, amongst the Italian durum wheat cultivars, those with poor pasta making qualities showed the same negative behaviour during bread making.3 In 1 989 Boggini and Pogna associated bread making quality with gluten viscoelastic properties, protein content and protein composition.4 In particular most cultivars with 'Y-gliadin 42 had lower loaf volumes than cultivars with the allelic 'Y-gliadin 45. Moreover, the HMW glutenins subunit composition of the durum wheat cultivars examined appeared to affect bread making quality. Wheat flour is a multi-component raw material and obviously all of them interact to affect its baking quality. However, it is well known that proteins play a basic role in determining the rheological characteristics of a wheat dough and consequently bread quality. Therefore, within the frame of a study on durum wheat for breadmaking, we chose to focus our attention on possible relationships between protein molecular parameters and quality data, defined in a range of ways, in a set of Italian durum wheat cultivars of diverse origin, generally used for pasta making and possessing a range of gluten qualities. A common soft wheat flour was also used as a comparison. 2 MATERIALS AND METHODS 2 . 1 Samples
Remilled semolina was obtained by means of a Buhler experimental mill MLU-202 from the grains of 9 Italian durum wheat cultivars (named Creso, Duilio, Grazia, Appio, Messapia, Appulo, Capeiti, Plinio, Latino) tempered to 1 6% moisture. A blend in equal parts of grains of 2 Italian soft wheat cultivars, Mec and Centauro, was milled to flour and used as control. 2.2 Chemical and rheological tests
Moisture and protein (Nx5.7) of remilled semolina were determined according to AACC
161
Wheat Protein Composition and Quality Relationships
approved methods 44- 1 5 A and 46- 1 1 A respectively.5 Falling number was determined according to the ICC standard method No. 107.6 The Manual Gluten Quality (MGQ score) was obtained according to Landi,7 whereas the Gluten Index and the dry gluten content were obtained according to Cubadda et al .. 8 The SDS test was done following Axford et al.,9 with 3% S.D.S .. Farinograph and alveograph tests were performed according to AACC approved methods 54-21 and 54-30 respectively.5 2.3
Baking test
A straight-dough method was used to prepare pan bread loaves with the following ingredients: flour l 000g, compressed yeast 4%, salt 1 .5% and variable water according to the Brabender Farinograph. Malt was also added in variable amounts to adjust the falling number of the remilled semolina to the optimum value for baking (about 250s). All ingredients were mixed to optimum dough development (6 min) in a spiral mixer 60 r/min). The dough was left to ferment in bulk for about 30 min in a proofing cabinet under controlled temperature (30°C) and relative humidity (about 80%). It was then punched and mechanically moulded to give 250g loaves. The loaves were proofed under the same conditions as before until the dough had risen to a fixed height. The loaves were baked in a revolving oven at 250°C for 1 5-20 min. Volume was measured 3 h after removal from oven by the rapeseed displacement method whereas crumb characteristics were scored according to Mohs's scale as reported by Dallmann.lO 2.4
Proteins fractionation and quantification
Durum wheat proteins were fractionated according to the following procedure: Remilled semolina
I
Tris-HCl 0.05 M, pH 8.5, 1M NaCl
I
Distilled water
I
70% ethanol
J,
>Globulins > Albumins >Gliadins
HMW + LMW Glutenins Soluble proteins were quantified by the Bradford dye-binding method as modified by Eynard et al. l I. Globulins, albumins, gliadins and glutenins were studied by SDS PAGE. 1 2 Gliadins were also analyzed by Acid-PAGE. 13 The HMW/LMW ratio was calculated from the video image of the glutenins SDS-PAGE (Software CREAM. Kern en-tee). 2.5 Statistical analyses Data were analyzed by ANOVA and Duncan's multiple range text. Simple and multiple correlations were elaborated with the programme Statistica for Windows (Release 4.5) of StatSoft. 3. RESULTS AND DISCUSSION The glutenins and gliadins subunit composition, protein content, dry gluten and some gluten quality parameters are reported in Tab. l .
Wheat Structure, Biochemistry and Functionality
162
Table 1 Gluten Composition, Proteins, Dry Gluten, Gluten Index, Manual Gluten QualifJ: (MGQ) and S,D,S. Test Value otDurum Wheat Cultivars* SampleZ
Gliadins
Y
Proteins Dry gluten Gluten M G Q N x 5, 7 (% d.m ) Index scorex HMW (% d.m.)
Glutenins
lMW
Control
1 2.9c
l O.5e
92a
8
S.D. S value (ml)
Creso
45
2
6+8
1 2.7d
l 1 . 1 cd
87b
8
50
Duilio
45
2
7+8
1 2 .7d
l 1 . 1 cd
78c
8
45
Grazia
45
2
20
1 2.0e
l 1 .2cd
77c
7
44
Appio
45
2
20
1 2.0e
1 1 . 3c
72d
7
38
Messapia
45
2
20
1 2.9c
1 2. 2b
62e
6
44
Appulo
45
2
20
13.1b
1 2 .9a
38f
5
33
Capeiti
45
2
20
1 1 . 8f
l 1 .2cd
39f
6
30
Plinio
45
2
7+8
1 2. 1 e
1O.9de
72d
7
45
Latino
42
7+8
1 3 .3a
1 1 .9b
3g
4
25
*
All the values, a part from the MGQ scores and SDS values, are the means of duplicate determinations. Means within columns with different letters are significantly different (p$ 0.05). Z Control was bread flour. All the other samples were remilled semolina. x Gluten Quality obtained by the Manual method (range: 1 -10). Boggini and Pogna4 found that the HMWglutenin subunit composition of durum wheat cvs in combination with gliadin 42145 could be used as an indicator of quality in bread making. Therefore, we analyzed our samples for their gliadins and glutenins subunit composition. All of the durum wheat cultivars studied, except the cultivar Latino, possessed the 'Y-gliadin band 45. Most of the cultivars had the HMW glutenin subunit 20, some had the subunit pair 7+8, whereas only the cultivar Creso had the subunit pair 6+8. The Gluten Index, the Manual Gluten Quality Score and the SDS value clearly indicated the existance of a range of gluten qualities within our group of samples; from Latino, lowest values, to Creso, highest values. Alveograph and farinograph param�ters of the samples under study together with bread volume and crumb texture are reported in Tab. 2. According to our experience on soft wheat flour, values of W above 1 7 0 indicate good baking quality provided that the P/L value is between 0.30 - 0.70. Below 1 10 the baking quality is generally inadequate. Following this classification, the control sample with a W of 198 and a P/L of 0.24 would fall into the good baking quality group whereas the only durum wheat cv, Creso, with a W above 1 7 0 ( l 80) would have too high a P/L ratio, indicating, as expected, higher tenacity versus elasticity. A high P/L ratio is, in fact, typical of durum wheat samples whose gluten is, as known, very tenacious and not very elastic. Farinograph absorption values for the durum samples were in general higher than the control as reported also in the literature.14 This behaviour could be due to a higher content of damaged starch in remilled semolina. Development time of durum samples was generally higher than the control as a consequence of the higher strength of durum gluten compared to soft wheat and differences were also observed in stability and mixing tolerance. The cultivars Appulo and Latino, which scored the lowest values of MGQ, gave also the lowest values of stability and development. The results of the baking test are also reported in Tab. 2. Significant differences were found in bread volume of durum wheat cultivars which were all but the cultivar Plinio
163
Wheat Protein Composition and Quality Relationships
Table 2 Technolosical Characteristics otDurum Wheat Cultivars AlveographZ Sample *
W
G
P/L
Control
198a
30.2
0.24f
Bread
Farinograph
Absorp. Develop. Stability MTX (sec) (B. V. (sec) (%) 5 5 .2
90
Crumb
Volumez TextureY (cc)
5 10
30
567c
8
630b
7
656b
8
Creso
180b
2 1. 2
0.82c
6 1.8
150
255
60
Duilio
1 6 1d
19.0
1 .02a
6 1 .9
150
240
60
Grazia
167c
22.9
0.54e
59.3
165
225
60
657b
8
59.0
150
2 10
50
654b
7
59.5
150
225
70
65 l b
8
6 l2d
7
Appio
156d
19.3
0.93b
Messapia
1 l 8e
2 1. 8
0.54e
Appulo
1 l 7e
22. 1
0.56e
59.3
170
90
60
Capeiti
IOlf
2 l .3
0.55e
60. 5
170
105
70
675a
7
Plinio
l 56d
2 1 .0
0.70d
58.6
180
225
80
629c
8
16.9
O.77c
60. 1
l35
90
60
622cd
6
Latino *
67g
Control was bread flour. AIl the other samples were remilled semolina. Means of four or six (bread volume) determinations. Means within columns with different letters are significantly different (p $ 0.05). x Mixing Tolerance. y Mobs score, range 1 -8. Highest value given to a very close porosity with very small pores.
Z
higher than the control. Crumb structure of durum samples showed in general quite a close porosity. The different protein fractions of remilled semolina, i.e. globulins, albumins, gliadins, HMW and LMW glutenins were fractionated according to the procedure described in the Materials and Methods section and reported on a percentage basis (data are not shown). All the durum wheat cultivars compared to the control showed a sensibly lower content of glutenins, especially the HMW fraction. Moreover different proportions of the various protein fractions were noticeable in the durum cultivars examined. After quantification of technological and molecular parameters we went on to study possible correlations between them. Simple correlations between technological parameters are reported in Tab. 3. Table 3 Simple Correlations between Technological Parameters in Durum Wheat * Alveograph W
P/L
Farinograph
Gluten Index
S. D.S value
0.5770 0.6201
!!.Mll
0.4443
� 0. 3 8 14 0.5 1 1 8
0.02 1 4
0. 1407
Absorption Develop. Stability Mixing Tolerance
Bread Volume 0 .3009 0.5079
� Q..6.8!lli
Bread Voll Proteins
0.4265
*
0.0676 0.3404
Underlined correlation coefficients are significant at p$O.05.
Significant positive correlations were found between some farinograph parameters such as absorption and development and bread volume. Bread volume normalized for protein content was significantly correlated to development only. Boggini and Pogna4 also reported development time as being positively correlated to bread volume in durum
1 64
Wheat Structure, Biochemistry and Functionality
wheat. This parameter could therefore be considered a good predictor of baking quality in durum wheat. Simple correlations between technological and molecular parameters are instead reported in Table 4. Table 4 Simple Correlations between Molecular and Technological Parameters in Durum Wheat* Bread Volume! Volume Proteins
Farinograeh
Alveograeh W
PIL
Absorp. Develop. Stab.
0.6002 Q.8B1l
0.2472 0.0933
0.0467 0.4818 0.0505
Glutenins + 0.3095 0.3035 Gliadins
0. 1 1 20 0.3573
0.3785
Gliadinsl Glutenins
0.3861 0.3742
Gliadins
Proteins
Gluten S.D.S
Mixing Index Tolerance 0.2832
0.481 2 0.2067
Q.B.l82. 0.4866 Q.Bill
0. 1 1 10 0.4033
0.0696 0.0388
0.21 86 0.4423 0.0658 0.6140
0.3559 0. 1 2 1 5
0.4225 0.3922
0.0432 0.0014
0.2214 0.2982 0.0153
0.4963
0.1622 0.5059
LMW
0.2083 0.0833
0.3798 0.3240
0.2803 0.0849 0.4793
0. 1973
0.4194 0.5582
HMW
Q.1448 0.6129
0.3423 0.4092
Mill Q...8ill
Q.ll54 ll.lill
0.2678 0.4144
HMW+IMW 0.4338 0.4 1 80
0.0026 0.0932
0.3206 0.6146 0.2232 !illl12.
0.0829 0.6054
HMWIIMW !l.1125. 0.6068
0.41 87 0.4890
ll.12Ql QMQ1 !!.12!i1
.!l.1..ll1
0.3559 0.1221
Globulins
0.4326 0.4233
0.0358 0.4537
0.3977
Q.W1 0.4286 �
0.0067 0.5445
Albumins
0.4382 0.4266
0.2640 0.3461
0.0765 0.0363 0.1908 0.021 5
0.1409 0.3390
Albumins+ Globulins 0.3096 0.3035
0.1 1 20 0.3573
0.3785
Q.B.l82. 0.4866 Q.Bill
0.1 1 10 0.4033
Dry Gluten
Mill 0.0193
0.2337 0.3387
QJi651 0.2841
0. 1737 0.5922
*
0.0562 0. 1 966
Underlined correlation coefficients are significant at p:'>0.05.
Significant positive correlations were found between bread volume and the total amount of HMW glutenins and between bread volume and the ratio HMW/LMW glutenins. HMW glutenins seem therefore to play a key role in determining durum wheat baking qUality. Significant and high positive correlations were also found between some farinograph parameters such as development and mixing tolerance and the amount of glutenins+gliadins, the amount of HMW glutenins, the HMWILMW ratio, the amount of globulins and globulins+albumins. Furthermore, mixing tolerance was also positively correlated to the amount of HMW +LMW glutenins. Farinograph absorption was significantly correlated only to the total amount of HMW glutenins and to the HMWILMW ratio, whereas stability in addition to being correlated to the same molecular parameters in the same way, was significantly correlated also to dry gluten. The alveograph parameter W showed only a significant positive, but low correlation with dry gluten. The study of the linear correlations between our variables suggested the existence of more complex relationships between them so we expanded our study to the mutual relationships between three variables. We inserted our variables in three dimensional graphs and we examined a number of them reporting different combinations. However,
16 3t 0.325 0. 3 3: 0.275 J 0.25 0. 225
3
0. 375 0. 35 0. 325 � 0. 3 � 0.2 75 0. 25 � 0.225 :r 0. 2
�
Wheat Structure. Biochemistry and Functionality
166
the most meaningful appeared to be those where the y and x axes were respectively, bread volume and percentage of glutenins. Some tridimensional graphs where the z axes are HMWILMW glutenins, gliadins/glutenins, globulins+albumins are depicted in Figure 1 . Within the same figure, we considered also of interest to differentiate our samples according to their HMW glutenins subunit composition. Our group of samples was not homogeneous as far as gliadins were concerned because the cultivar Latino (L) had "( gliadin 42 which could already be considered an indicator of poor baking quality, as confirmed by its bread volume. By observing Figure 1 , we could say that our 7+8/"(45 samples (P and D) were both characterized by a high HMW/LMW ratio even if they differed for their percentage of glutenins. The highest the level of glutenins, the better was bread volume (D>P). Within the same group of samples a smaller gliadin/glutenin ratio seemed to be favourable to bread volume together with a low albumin+globulin percentage. This latter statement could be valid also for the cultivars of the 201"(45 group where Capeiti 8 (C 8), which gave the highest bread volume, was characterized by the lowest level of globulins+albumins and vice-versa the cultivar Appulo (A). The HMW 20 group seemed in general to be characterized by a low HMWILMW ratio whereas the gliadin/glutenin ratio varied a great deal. The two extremes in this group of samples as regard to bread volume, i. e. C 8 (highest bread volume) and A (lowest bread volume) had not too distant glutenins percentages and HMW/LMW ratios but they had markedly different gliadin/glutenin ratios and globulins+albumins contents. Unfortunately there was only one 6+8 sample (C). A low albumins + globulins percentage (monomeric proteins) and a high level of glutenins (polymeric proteins) seemed to be favourable to bread volume in all the samples studied. This observation is supported by indications in the literature about the destabilizing role of monomeric proteins during loaf expansion. Even if our findings should be confirmed and corroborated by the observation of a bigger population of durum wheat samples , we could nevertheless conclude that simple correlations can not be used to predict baking quality in durum wheat, but multiple correlations (3D and more) between molecular and technological parameters could be useful to understand the role of each component and to identify their best combinations.
Acknowledgements We acknowledge the help of Mr. E. Caproni and Mr. L. Bartoli. Research supported by National Research Council of Italy, Special Project RAISA, subproject 4, Paper No. 23 1 1 .
References 1. G.B. Quaglia, 'Durum Wheat Chemistry and Technology', G.Fabriani and C . Lintas, Am. Assoc. Cereal Chern., St. Paul, MN USA, p. 263. 2. M. H. Boyacioglu and BL D'Appolonia, Cereal Foods World. 1994, 39, 1 68. 3. G. Boggini, Tecnica Molitoria, 1 985, 6, 579. 4. G. Boggini and N.E. Pogna, 1. Cereal Sci., 1989, 9, 1 3 1 . 5 . A.A.C.C., 'Approved Methods o f the American Association of Cereal Chemists', St. Paoul , MN USA, 1983. 6. I.C.c . , 'Standard Methods of the I nternational Association for Cereal Science and Technology', Moritz Schafer, Detmold, Germany, 1987. 7 . A . Landi, 'The Future o f Cereals for Human Feeding and Development o f Biotechnological Reserch ( I n Italian), Chamber of Commerce, Foggia, Italy, 1988. 8. R. Cubadda, M. Carcea and L.A.Pasqui, Cereal Foods World, 1992, 37, 866. 9. D.W.E. Axford, E.E. McDermott and D.G. Redman, Milling Feed Fert. , 1978, 161, 1 8 . 1 0 H. Dallmann, 'Porentabelle. Fortschritte der Getreideforschung', Moritz Schilfer, Detmold, Germany, 1 969. 1 1 . L. Eynard, N. Guerrieri, P.Cerletti, Cereal Chern. , 1994, 71, 434. 12. U . K. Laemmli, Nature, 1 970, 227, 680. 1 3 . A. Dal Belin Peruffo, N.E. Pogna, C. Pallavicini , E. Pegoraro, F. Mellini, A. Bianchi, Sernenti Elette, 1984, 30, 1 . 14. M . H . Boyacioglu and B.L. D'Appolonia, Cereal Chern., 1994, 7 1 , 2 1 . ,
,
CONTRIBUTION OF THE Hordeum chilense GENOME TO THE ENDOSPERM PROTEIN COMPOSITION OF TRITORDEUM
J . C . Sillero, 1.B. Alvarez, and L.M. Martin. Departamento de Genetica Escuela Tecnica Superior de Ingenieros Agronomos y de Montes Universidad de Cordoba Apdo. 3048, E- 14080 Cordoba, Spain.
1 SUMMARY
Several studies have indicated that the breadmaking quality of tritordeum (Hordeum chilense-wheat amphiploid) are related with the presence of the H. chilense proteins into the endosperm of the amphiploid. The objective of this work has been to group these proteins by the Osborne's categories and stablish their degree of genetic variation. These protein fractions were obtained from eight lines of tritordeum (5 hexa- and 3 octoploid) and analyzed by SDS-PAGE. The results indicated that the H. chilense genome incorpo rate a variable number of protein components to each fraction. Likewise, although the globulin fraction did not presented any variation for the tested lines of tritordeum, a certain degree of variation could be observed in the other three fractions. 2 INTRODUCTION
Tritordeum (XTritordeum Ascherson et Graebner) is the amphiploid derived from the cross between a South American wild barley (Hordeum chilense Roem. et Schulz. ) and wheat. This amphiploid was obtained in the hexaploid form (H. chilense x Triticum turgidum conv durum Desf. em. M.K.) for the first time in 1 9791 • Before the production of hexaploid tritordeum, an octoploid form of low fertility had been obtained from the cross involving H. chilense and bread wheat (T. aestivum L. em. Theil, cv. 'Chinese Spring'2. From the beginning, the hexaploid form showed promising characteristics as a new 3 crop . Later studies confirmed these expectations4,s. The data suggested that tritordeum could be used as a protein source crop, because of its high grain protein content4• Nevertheless, recent studies have shown that the protein contents of tritordeum and wheat are not significantly different when their grain yields are similar6• Alvarez et al . 7, using several physicochemical tests, found that hexaploid tritordeum exhibited some potential for breadmaking. Similar results were also obtained for some lines of octoploid tritordeum derived from bread wheat cultivars with better agronomic characteristics than those of the parent wheat cultivar, cv. 'Chinese Spring'8,9. Likewise. the results suggested that careful selection of the H. chilense line for use in the crossing experimental was important with respect to the end-quality of the tritordeum producedJO• because of the endosperm storage proteins contributed by H. chilense8,l 1 .
Wheat Structure, Biochemistry and Functionality
168
The objective of the current work has been to study the nature of the H. chilense proteins expressed in the endosperm of tritordeum, as well as to analyze their capacity of variation. 3 EXPERIMENTAL 3 . 1 . Grain samples The following eight lines of primary tritordeum, five hexaploid ([H- l IT-22 l , [H1 2/T- 103 ] , [H-57/T-5S] , [H-6 1 /T-5S] , and [H-6 1 1T- 1 03]) and three octoploid ([H- l IT26] , [H- 1 2/T-65 ] , and [H-55/T-79]) were analyzed, along with their respective wheat parent (T). The genomic constitution of the hexaploid tritordeum l ines is AABBHcbHcb and the octoploid tritordeum lines is AABBDDHcbHcb, where Hch is the H. chilense genome. 3.2. Protein extraction The different fractions (albumins, globulins, gl iadins and glutenins) were extracted from 20 mg of wholemeal flour by sequential extraction according to Khan et al . 1 2• The glutenins were obtained from the last pellet. 3.3. SDS-PAGE procedure Reduced and alkylated proteins were electrophoresed in vertical SDS-PAGE slabs in a discontinuous Tris-HCI-SDS buffer system (pH = 6.S/S. S) at a polyacrylamide concentration of 12 % (w/v). Reduction and alkylation procedures of the proteins were performed as described by Graybosch and Morris 1 3 • Al iquots ( 7 . 5 JL I ) were transferred to the sample wells o f gel . Electrophoresis was performed at a constant current of 30 rnA for 3 . 5 h at lOOC. Samples were run with standard reference proteins: Phosphorylase B, 94 kD; Bovine seroalbumin, 67 kD; Ovoalbumin, 43 kD; Carbonic anhydrase, 30 kD. The molecular weights of protein components were determined by comparison with these proteins. Gels were fixed and stained according to Alvarez et al. 1 1 . 4 RESULTS AND DISCUSSION Figure 1 shows the albumin patterns from the tested l ines. As far as could be determined from one dimensional electrophoresis, the tritordeums presented some additional bands to those of their wheat parents, which have a sharp origin in the H. chilense line. So, the tritordeums derived from the line H- l and H - 1 2 presented one band, named as a, with a Mr of 54.6 kD, but this component was not observed in the other tritordeums. Likewise, these tritordeums and also [H-55/T-79] incorporate one second band (b, Mr= 3 2 . 2 kD) absent in the rest. On the contrary, a new band (c, Mr = 3 1 . S kD) appear in the rest of the lines, [H-57/T-58] , [H-6 1 1T-58] and [H-6 1 1T- I03] . These results suggest that the bands b and c could be allelic, but this hypothesis must be confirmed with new studies on these components . The differences observed between the tritordeum [H- l IT-26] and its wheat parent (Figure 1 , lanes 14 and 1 5 , respectively) in the zone marked with the asterisk, could be only consequence of an over-extraction in tritordeum . It is noteworthy that this tritor deum show the highest protein content face to its parene4• On the other hand , these differences can not have their origin in the H. chilense line because of the other line of
Wheat Protein Composition and Quality Relationships
169
tritordeum derived from the l ine H� 1_ did not present any irregularity. 2
3
4
5
6
7
8
9
10
11
A
12
13
Figure 1 SDS-PAGE separation of albumins of wheat and tritordeum lines. Lanes are asfollows; 1, T-22; 2, [H-lIT-22]; 3, [H-J2IT-103]; 4, T-1 03; 5, [H-611T-103], 6, [H-
5 7IT-58]; 7, T-58; 8, [H-611T-58]; 9, T-65; 10, [H-J2IT-65]; 11, Mw,' 12, T- 79; 13, [H-55IT-79]; 14, [H-lIT-26]; 15, T-26. The molecular weight (MW) of the indicated reference proteins is as follow: A = 94 kD; B = 67; C = 43 kD; D = 30 kD. The aste risk indicate some differences between this line of tritordeum and its parent (see text) .
The globulins patterns of the tritordeums showed three bands in addition to those of their wheat parents (Figure 2). These bands, named as d (Mr = 73. 3 kD), e (Mr= �4. 3 kD) and r (Mr = 32.6 kD), were presented in all the tested lines of tritordeum. Any variation could be observed between the globulins from H. chilense, although a slightly variability was detected for the wheat globulins, principally in bread wheat (Figure 2 , lanes 10, 1 2 and 15). When the gliadin fractions were studied (Figure 3), four bands form H. chilense could be observed. The two first bands (marked as g and b) showed very close Mrs (56.5 kD and 56.0 kD, respectively). Both bands are present in the tritordeum derived from the lines H- l , H-12 and H-55 of H. chilense (Figure 3 , lanes 2 , 3 , 1 1 , 1 3 and 14). O n third band (called a s i, Mr= 54.5 kD) appeared i n the abovementioned tritordeums, and in the line [H-57rr-58] (lane 6). The fourth band (marked as j) was present in all the lines of tritordeum and shows a Mr of 50.5 kD. Likewise, in the wne indicated with a bracket, there is a group of bands present in all the tested lines; however, their high density has very difficult their analysis. It is noteworthy that the lane 14 showt",d newly higher intensity than it parent (lane 15), which suggest that the abovementioned differen ce in protein content could be responsible of it. In any case, the high number of components and problems for the analysis were found in the glutenins fractions. A total of seven additional bands could be observed in some lines of tritordeum, although the high overlapping of some components with those from wheat suggest that the number could be higher.
Wheat Structure. Biochemistry and Functionality
170 '2
3
4
6
5
7
8
9
10
11
12
13
14
15
Figure 2 SDS-PAGE separation of globulins of wheat and tritordeum lines. Lanes are follows; 1, T-22; 2, [H-1/T-22J; 3, [H-12IT-103J; 4, T-103; 5, [H-61/T-103J, 6, [H5 7IT-58J; 7, T-58; 8, [H-61/T-58J; 9, Mw,' 10, T-65; 11, [H-12IT-65J; 12, T- 79; 13, [H-55IT- 79J; 14, [H-1IT-26J; 15, T-26. The MW is similar to the indicated in Figure 1 . as
2
3
4
5
6
7
8
9
10
11
12
13
14
15
A
[
Figure 3 SDS-PAGE separation of gliadins of wheat and tritordeum lines. Lanes are as follows; 1, T-22; 2, [H-1/T-22J; 3, [H-12IT-103J; 4, T-103; 5, [H-61/T-103J, 6, [H57IT-58J; 7, T-58; 8, [H-61/T-58J; 9, MW; 10, T-65; 11, [H-12IT-65J; 12, T- 79; 13, [H-55IT- 79J; 14, [H-1/T-26J; 15, T-26. The MW is similar to the indicated in Figure 1. Th e bracket indicate one zone where several gliadins are presents.
171
Wheat Protein Composition and Quality Relationships
In Figure 4, the bands marked as k (Mr = 107,7 kD) and I (Mr= 98. 8 kD) appear in all of the tested lines of tritordeum and to correspond with the bands in the high Mr zone indicated by Alvarez et alY. Data from other studies have suggested that both bands are linkage'o. The band I corresponds to the component 1 indicated by Payne et al Y , who used the line H- l of H. chiLense. Paradoxically, these authors did not detected the band k, which appear in a high number of lines of the H. chilense collection availa ble -100 accessions-. When both bands disappear, other two bands of low Mr appear in this zone (Gimenez-Alvear, pers. commun.). The third band (called m) shows a Mr of 56.0 kD and is present in the lines derived from H- J , H-12 and H-55; while the fourth band (named as n , Mr = 54.5 kD) is present in the all lines of tritordeum with exception of the derived tritordeum from H-6 1 . The three last bands (marked as 0, p and q) are present in all the lines of tritordeum and show a Mrs of 50.5 kD, 32.0 kD and 30.7 kD, respectively. 1
3
4
7
9
--.",---:""_ r.--
10
11
12.
13
14
15
Figure 4 SDS-PAGE separation of glutenins of wheat and tritordeum lines. Lanes are as follows; 1, T-22; 2, [H-lIT-22]; 3, [H-12IT-103]; 4, T-103; 5, [H-611T-103], 6, [H-
57IT-58]; 7, T-58; 8, [H-61/T-58]; 9, T-65; 10, [H-12IT-65]; 11, T- 79; 12, [H-55IT- 79]; 13, [H-l/T-26]; 14, T-26; 15, MW The MW is similar to the indicated in Figure 1 . .
Because o f the band o f 54.5 kD appear both gliadins (Figure 3 , band i ) and glute nins fractions (Figure 4, band n) , although with higher intensity in the last ones, it maybe a band of glutenins which had been partially extracted with 70° ethanol. For the same reason, the glutenins bands (Figure 4) with Mrs of 56.0 kD (band m) and 50.5 kD (band 0) could be bands of gl iadins (Figure 3 , bands h and j , respectively) which had not totally extracted with the respective solvent. On the other hand, the asterisks of Figure 4 indicate the found differences between the banding patterns of the line T-79 and its putative derived tritordeum [H-55rr-79] . These results suggest that this wheat line was not the pattern of this tritordeum, although it could be a sister line of it.
Wheat Structure. Biochemistry and Functionality
172
5 CONCLUSIONS The current work indicates that the H. chilense genome synthesized several components for each one of protein group of the endosperm of tritordeum . We have detected 3 components of albumin, 3 of globulins, 3 of gliadins and 5 of glutenins, together with an additional group of very close bands in the gliadins fraction. In general , a certain de gree of variation has been detected between the bands from H. chilense. The data confirmed that the majority of the H. chilense proteins are include in the group of storage proteins (gliadins and glutenins) . Likewise, these fractions present the highest variability in protein components, which could have a great importance for quality improvement in tritordeum by manipulation of such variability for storage proteins. Acknowledgments This work was supported by grant AGR91 -0844 of the Comision Interministerial de Ciencia y Tecnologfa (CICYT) of Spain. The first author thanks to MAPA for a predoctoral fellowship. Likewise, J.B.A. thanks the FPJ programme of the Spanish MEC for a postdoctoral fellowship. We want to thank to A. MartIn and J. Ballesteros from CSJC (Spain) for the seed materials.
1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 1 1. 12. 13. 14. 15.
References A . Martin and E. Sanchez-Monge Laguna, Euphytica, 1 982, 3 1 , 262. A . Martin and V. Chapman, Cereal Res. Commun. , 1 977, 5, 365 . A . Martin and J . 1 . Cubero, Cereal Res. Commun. , 1 981 , 9, 3 17 . J . 1 . Cubero, A . Martin,T. Millan, A . Gomez-Cabrera and A. de Haro, Crop Sci., 1 986, 26, 1 1 86. A . Martin, Rachis, 1 988, 7 , 1 2 . J. Ballesteros, Tesis Doctoral , Universidad de Cordoba, Spain, 1 993. (in Spanish). J.B. Alvarez, J. Ballesteros, J.A. Sillero. and L.M. Martin, Hereditas, 1 992, 1 16, 1 93 . J.B. Alvarez, I.M. Urbano and L.M. Martin, Cereal Chern. , 1 994, 71, 5 17. J.B. Alvarez and L.M. Martin, Cereal Res. Commun. , 1 994, 22, 49. J.B. Alvarez, Tesis Doctoral , Universidad de Cordoba, Spain, 1 993 . (in Spanish) . J.B. Alvarez, A . L. Canalejo, J. Ballesteros, W.J. Rogers and L.M. Martin, Plant Breeding, 1 993, 1 1 1 , 1 66. K . Khan, G. Tamminga and O. Lukow, Cereal Chern. , 1 989, 66, 39 1 . R.A. Graybosch and R. Morris, 1. Cereal Sci. , 1 990 , 1 1 , 20 1 . J . C . Sillero, Tesis de Licenciatura, Universidad de Cordoba, Spain, 1 994. (in Spa nish). P . I . Payne, L.M. Holt, S.M. Reader and T.E. Miller, Biochern. Genet., 1 987, 25, 53.
GLIADIN COMPONENTS AND GLUTENIN SUBUNITS IN WHEAT BREEDING
A. I. Abugalieva Kazakh Research Institute of Agriculture by V. R. Williams P. O. 483 133 Almalybak, Kazakhstan
1 INTRODUCTION Gluten proteins are the most important biochemical determinants of wheat grain quality. Because of their unique properties and biological specificities, they are effective markers of genes, genotypes and quality traits. It is important in breeding to define the methods that are available for identifYing important protein markers and to establish how the information they can provide can be used for quality improvement. In practice, such an approach has been directed towards answering a number of important questions: ( 1 ) the nature and the number of protein components that define a genotype and the value of this information in breeding, (2) how the protein composition and method for determining it can be used as a means of identifYing genomes, (3) how the information · on protein composition can be used in selecting appropriate genotypic/phenotypic traits that are of commercial value, and (4) facilitating achievement of the objectives of the breeding process using electrophoretic methods for monitoring protein composition, thus enabling lines with desirable gluten polypeptide compositions and hence quality characteristics to be selected.
2 IDENTIFICATION OF VARIETIES
AND
BIOTYPES
Wheat varieties are commercially important. The use of protein marker methods has enabled different varieties to be identified and genetical relationships to be established. The Kazakhstan breeding varieties are characterised by a substantial degree of heterogeneity in terms of the occurrence of biotypes, which has been revealed both in gliadin polypeptide and glutenin subunit composition (Table 1 ). The degree of heterogeneity varies from one variety to another It is related to the relative qualities and the biotypes present, which is in tum affected by the growing conditions. The predominant biotype found for any particular variety is usually the basis for that variety. Until recently, traditional breeding was limited to selection according to technological properties, growth characteristics, yield, morphology and disease resistance. Studies at the biochemical level, in particular by characterising the grain storage protein polymorphism and genetics have extended the boundaries and possibilities in breeding. In this regard it is
Wheat Structure, Biochemistry and Functionality
174
important to provide more accurate information on the protein compositions of wheats, which enables specific biotypes to be identified and selected for at the various stages of breeding. 2.1
Gliadin Polypeptides and Glutenin Subunits in the Identification of Genotypes
Experiments were carried out to study gliadin polypeptide and glutenin subunit heterogeneity among Kazakhstan varieties. Wheat storage proteins may be classified from 2 a functional perspective into two main groups: gliadin, which comprises monomeric proteins and glutenin, which comprises polymers in which the subunits are linked by inter chain disulphide bonds. Gliadins may be further sub-divided into sulphur-rich (S-rich) a-, p- and y-gliadin sub-fractions and a sulphur-poor (S-poor) co-gliadin sub-fraction. Using a polarographic method, we have found that the disulphide bonds contents increase in going from co- to a-gliadins. For some varieties and biotypes, e.g. the variety Bogamaya 56, the S-S-bonds contents of the co-gliadin area are greater than those in the y-area. This may explain the high degree of heterogeneity of the co-gliadin sub-fraction in this genotype, which has 8-1 1 components, the unusual cysteine contents, which are more like those of y gliadins, accounting for the more mobile co-components.
Table 1 Polymorphism Found in Kazakhstan Wheat Varieties Based on Their Gliadin
Component and Glutenin Subunit Compositions Number ofBiotypes Identified
Variety Bogamaya 56 Bezostaya 1 OPAKS- l Zemokormovaya 50 Lesostepka 75 Saratovskaya 29 Omskaya 9 Kazakhstanskaya 126 Kazakhstanskaya 1 5 Dneprovskaya 521 Kavkaz Alabasskaya Albidum 1 14 Marquis * data not available
gliadin 26 16 5 9 3 5 3 1 2 4 3 4 2 6
Proportion (%) of Most Common Biotype as Defined by Gliadin and Glutenin Polypeptide Composition
glutenin
gliadin
glutenin
7 4 2 10 1 3** 2* * 1 3 * * * * *
44-85 3 7-96 89-95 46-60 75-92 80-94 72-88 99- 100 95-98 20-75 65-70 80-89 90-95 66-75
5 1 -90 68-76 50-8 1 52 99-100 53-85 74-86 99- 1 00 60-89 * * * * *
* * data provided by K. M. Bulatoval
Wheat Protein Composition and Quality Relationsh!ps
175
As a result of comparative studies of the amino acid compositions of glutenin subunits, highly aggregated gliadins, low molecular glutenin and total fractions, the glutenin electrophoretic spectrum was differentiated into A, B and C zones, with clear identification of high M, subunits ranging from A8 to B263 . The S-rich and S-poor gliadins are referred to here as the gliadin extract and the high M, glutenin subunits as the glutenin extract. 2.2. Development of a Cataloguing System for Biotypes
The selection of biotypes was carried out from three types of material: cultivated varieties, accessions in competitive trial and hybrid combinations derived from two variants at the early and late stages of breeding. It was necessary to create a protein component cataloguing system that could be used in the wheat breeding process. Previously used ways of identifying varieties were not sufficiently discriminating for hybrid populations for a number of reasons: firstly, the number of gliadin components observed was greater than the number in the known spectrum4; secondly, the lack of differences in the relative electrophoretic mobility has limited the identification of allelic variants' , though this was rectified later6; thirdly, analysis based only on relative electrophoretic mobility of components7 had excluded the application from breeding of a large amount of information about cultivated wheat varieties. In our work, the system that we established for cataloguing the gliadin compositions of genotypes, including those of hybrid origin, enabled us to complete the spectrum with high precision. The system is essentially based on a combination of a description of gliadin composition according to the VIR (Russian Institute of Plant Production, St Petersburg) nomenclature, together with the relative electrophoretic mobilities of protein bands, which improves precision and objectivity. In this system, the 0.5 gliadin component is taken as having a mobility of 1 00; the mobilities of other gliadin components are then determined relative to the 0.-5 component, and this has enabled errors in the identification of components to be avoided. The choice of this reference component was as a result of its widespread occurrence in most of the cultivated wheat varieties. Where this reference band was absent, any other band could be used providing that it was present in both the standard variety and in the variety under investigation. 2.3
Use of Storage Protein Composition and Isozymes in Biotype Identification
The intervarietal polymorphism of gliadin components, glutenin subunits and isozyme systems was established. This information was used for selecting corresponding protein biotypes. By electrophoretic analysis of individual wheat variety grain samples, their heterogeneity was determined in relation to all the enzyme systems studied, i. e. peroxidase (PRX), alpha-amylase (AMY), acid phosphatase (ACPH) and glucose-6-phosphate dehydrogenase (GPDH). For each class of enzyme, two biotypes of each of the varieties studied were selected and thus the potential for discrimination was extended. For example, for the variety Bogarnaya 56 were observed 26 gliadin variants, five glutenin variants and two PRX variants. AMY, ACPH and GPDH appeared in various combinations, of which there were 48 in all. However, for breeding programmes for grain quality, the gliadin polypeptide and glutenin subunit compositions, as determined by electrophoresis, were more informative.
Wheat Structure. Biochemistry and Functionality
176
3 DIFFERENT BIOTYPES Further objectives in the grain quality investigations were to obtain lines representing biotypes based only on differences in the gliadin and glutenin compositions. Thus, 38 biotypes of the variety Bogamaya 56, 19 of Bezostaya I , 24 of Zemokormovaya 50 and two of OPAKS I were found. Lines were also characterised with respect to marker traits and on the basis of a combination of biochemical parameters, such as amino acid composition of the endosperm proteins, protein content, starch content, content of disulphide bonds, and the technological properties of the grain, flour, dough and bread. Annual screening of the biotypes showed significant variation in their quality traits, whether it was biological, technological or breadmaking quality. All the traits showed some variability but this varied depending on the genotype. Differences in quality in relation to technological properties were noted under different growing conditions, and the ranking of the different biotypes varied for different growing locations. Investigations of grain quality of biotypes of the variety Bogamaya 56 (the standard variety) over a number of years can be summarised as follows. The minimal rank corresponding to a high grain quality rating both under irrigation and under non irrigation conditions has been determined for each of 38 gliadin-glutenin biotypes9 This method of evaluation provides the prospect of detecting, and directing the selection of, genotypes that are of greater value and more constant with respect to grain quality under different growing conditions. It is extremely difficult to detect biotypes distinguishable as having all positive or all negative quality attributes simultaneously. Statistical analysis using multiple parameters can provide useful information on inherent grain quality evaluation, however. For example, some biotypes of the variety Zemokormovaya 50 variety are highly polar in relation to both technological and nutritional properties. Samples combining both these attributes were arranged more close together and the rest were dispersed across the spectrum of "technological traits --+ nutritional value".
4 GLUTEN PROTEINS AND GRAIN QUALITY Some gliadin components and subunits of glutenin occurred in all varieties but some occurred only in a certain proportion of the varieties and samples analysed. Furthermore, it was noted the levels of individual gliadin components and glutenin subunits could vary considerably depending on the growing conditions and how they affected different wheat cultivars. This occurred both for polypeptides that were common to all biotypes as well as for those which varied in occurrence between biotypes. Our studies have revealed relationships in terms of protein accumulation between components and groups of components. Most of those relationships were noted for polypeptides that varied from one biotype to another, such as glutenin subunits A8.5, A9, A 1 2, A l 3 , B21 and B27, and in some cases for polypeptides that were present in all biotypes, such as glutenin subunits A8 60 and A l l and y-gliadins y3 63 and y4 4.1
Variability in Gluten Protein Content
Both gliadin and glutenin levels varied significantly under different growing conditions; the coefficient of variation was 4- 1 4% for gliadin and 2-4 1 % for glutenin in the case of
Wheat Protein Composition and Quality Relationships
177
spring sown wheats. For winter wheats there was greater variability in terms of gliadin content (coefficient of variation 1 0-25%) and glutenin content ( I S-43%). Intravarietal differences in the contents of individual polypeptides were also observed. The levels of glutenin subunits AS. 5 and A9 varied inversely as did those for subunits A 1 2 and A 1 5 . Factor analysis of the contents o f gliadin components and glutenin subunits showed that 32% of the common variability was due to gliadin, 50% to glutenin and l S% to interactions between the contents of gliadin components and glutenin subunits. Of considerable interest was the finding that four pairs of glutenin subunits accounted for 37% of total variation. Those subunit pairs were AS. 5 plus A9, A12 plus AI3, A I 4 plus A 1 5 and A 1 9 plus B24. Conditions during each growing year also had a considerable influence on the nature of the protein correlation according to the scheme: protein content -+ contents ofthe total albumin, globulin, gliadin and glutenin fractions ---+ contents of gliadin and glutenin subfractions -+ contents of individual gliadin components and glutenin subunits. The way in which the contents of gliadin components and glutenin subunits contents vary during the ripening phase is the result of genotype - environment interactions. This characterises the degree of stability within genotypes (USSR Patent 1 269292). 4.2
Gluten Protein Components and Grain Quality Prediction.
For the spring wheats, it was established that the contents of high Mr glutenin subunits A 1 2 (G/u IB; 7+S) and AI3 (G/u IB; 7+9) were the main determinants of dough physical properties, such as mixing time, elasticity and the Alveograph PIL ratio. The breeding programme for winter wheat involves a detailed study of gliadin-glutenin biotypes and the way they determine grain quality. Variation in the contents of glutenin subunits A9 (G/u ID; 3) was related to grain hardness for the variety OPAKS l . Variation in the contents of glutenin subunits A l l , AI3 and A 1 9 and y-gliadin components for the variety Bogarnaya 56 was related to gluten content and high Valorimeter values. Variation in the contents of glutenin subunit A19 was correlated with grain hardness (r=0.69). Variation in the contents of glutenin subunit B2 1 was correlated negatively with glutenin protein content and total gluten content (r=-0.73 and-0.7 1 , respectively), with Valorimeter values and with Alveograph PIL ratio (r=-0.72 and -0. 79, respectively) and was correlated positively with gliadin content and grain hardness (r=0.79 and O.SO, respectively). Variation in the contents of glutenin subunit B22 was correlated with both total protein and gluten contents (r=0.69 and 0.67, respectively) Thus, the results obtained with a large number of samples of cultivated Kazakhstan varieties, prospective accessions in trials, biotypes, isogenic lines and lines derived from the breeding programme showed that the contents of individual gluten fractions were related differently to factors, such as grain yield and flour, dough and bread technological parameters. Our investigation of the quantitative relationships among gluten proteins in these diverse materials has enabled us to show that there is no universal quality relationship between glutenin and gliadin electrophoresis patterns and parameters used as indicators of technological quality. This shows that, in addition to a simple qualitative approach to valuable genotypes based on the presence or absence of particular gluten protein components, the use of statistical modelling of quantitative information may also be of value in increasing the quality of agriculture commodities.
Wheat Structure. Biochemistry and Functionality
178
Table 2 Grain Quality Evaluation System and Interpretation in Breedingfor Quality Evaluation and Interpretation
Grain Quality Related Factors
Determination Method
Biological Level Genetical
Individual gliadin components
Protein markers
Individual glutenin subunits Groups of components Blocks of components Composition of individual gliadin components Composition of individual glutenin components Genes and chromosomes Phenotypical
statistical
Monosomic analysis
Total protein content
Spectrophotometry and
Contents of protein fractions
NIR analysis
Contents of specific gliadins Contents of specific glutenin subunits
Electrophoresis using densitometry and RP-HPLC
Disulphide bond contents
Polarography
Amino acid composition to indicate nutritional Huality
Amino acid analysis
Variability of genotypes
Abugalieva et aI. , 1 993 9
Stability of genotypes Technological Level Technological (empirical evaluation)
Gluten quantity
State standard-68
Gluten quality Dough elasticity (P)
Chopin Alveograph
Dough extensibility (L) Dough energy (W) Dough mixing time
Brabender Farinograph
Dough resistance Valorimeter evaluation Bread volume
State standard
Bread making value etc. Sedimentation value statistical
Principal component integral evaluation Quality rank Quality clusters
Abugalieva et aI. , 1 993 9
Wheat Protein Composition and Quality Relationships
179
5 CONCLUSIONS ON USE OF PROTEIN MARKERS IN WHEAT BREEDING The work summarised here was aimed at optimising the wheat breeding process for improving grain quality through a study of grain storage protein composition both in qualitative and quantitative terms. The choice of which grain quality data to include is determined principally by the aims of the particular breeding programme. In turn, this governs which evaluation methods need to be used as selection tools in the breeding process (Table 2) . The traits of new lines, the methods used for their determination and the breeding parameters need to be characterised at each level of interpretation. References
1 . Y. V. Peruanski and AI.Abugalieva, J. Breeding and Seed Production, 1 985, 3, 23 2. P. R. Shewry, A S. Tatham, J. Forde, M. Kreis and B. J. Miflin, J. Cereal. Sci., 1 986, 4, 2, 97. 3. Y. V. Peruanski, A I. Abugalieva, K. M. Bulatova and L. M. Nechoroscheva, Soviet Agric. Sci., 1 986, 6, 6. 4. V. G. Konarev, I. P. Gavrilyuk and N. K. Gubareva, 'Genetical resources of wheat' Agropromizdat, Leningrad, 1 976, 1 13 . 5 . A A Sozinov, P. A Poperelya, Soviet Agric. Sci. , 197 1 , 2, 9. 6. A Sasek, J. Cerny and S. Sykorova, Sci. Agric. Bohemosl., 1 989, 21, 257. 7. W. Bushuk and R. R. Zillman, Can. J. Plant Sci. , 1 978, 58, 505. 8. A I. Abugalieva and S. I. Abugalieva, Sci. News Kazakhstan, 1 99 1 , 2, 52. 9. A I. Abugalieva, Y. V. Peruanski, K. M. Bulatova and V. V. Novochatin, Russian Agric. Sci. , 1 993, 4, 9.
GLIADIN AND HIGH MOLECULAR WEIGHT (HMW) GLUTENIN SUBUNITS IN THE COLLECTION OF POLISH AND FOREIGN WINTER WHEAT CUL TIV ARS AND THEIR RELATION TO SEDIMENTATION VALUE
J. Waga and J.Winiarski Plant Breeding and Acclimatization Institute 4 Zawila St. ,30-423 Krakow Poland
I INTRODUCTION In the last decades in Poland the wheat cultivation was mainly aimed at high grain yield from cultivars introduced to production. This resulted in the deterioration of technological parameters of the new cultivars. Due to recent economical changes, the quality criteria became stricter in all areas of production. It particularly concerns agricultural products, including the technological quality of wheat grain. Breeders want to adjust the standard of their products to the rising criteria and so they are interested in the development and practical use of new methods, which allow an effective acceleration of quality breeding process. One of the methods is the electrophoretic analysis of wheat storage proteins. The research conducted in Plant Breeding and Acclimatization Institute (PBAI) is aimed at determination of the relationship between the technological quality and set of storage protein blocks of cultivar, and also at showing the possibility of their application as markers of this feature in practical breeding.
2 METHOD Gliadin and glutenin proteins of 1 05 cultivars and strains of winter wheat coming from PBAI collection were investigated over the period of 3 years. Proteins were examined by electrophoresis, gliadins on starch gel and glutenins on poJiacrylamid gel SDS PAGE. The technological quality of the investigated material was assessed using the results of ZELENY test. 1 The examined forms were divided into 4 groups, according to the sedimentation value: A - very good cultivars, B - good cultivars, C - fair cultivars and D - poor cultivars.
3 RESULTS 3.1 The polymorphism of gliadin and glutenin proteins in the analysed groups of cultivars and strains
2 Based on the Poperella catalogue, 26 different gliadin protein blocks were identified in the examined materials. The chromosomes of the 1 st homeological group coded as follows: I A seven, 1 8 six, ID five different protein fractions.
Wheat Protein Composition and Quality Relationships
181
The chromosomes of the 6th homeological group coded as follows: 6A three, 6B three, 6D two fractions of gliadin protein. When describing the fraction of glutenin proteins using the PAYNE catalogue3 3 blocks coded by chromosome l A, seven blocks coded by chromosome 1B and two blocks coded by chromosome ID were identified. 3.2 The relationship between identified storage protein fractions and the sedimentation value
The average sedimentation value of the groups of cultivars and strains, containing particular identified blocks of storage proteins were compared. The significance of the differences between the average values was assessed by FISCHER test. It appeared that only protein blocks coded by chromosome I B and lD strongly affected the sedimentation value during each year of the three year research period. This resulted in considerable differences between the forms examined as far as the sedimentation value is concerned. Gliadin blocks marked: Gld IB5 and Gld 105 as well as glutenin blocks marked Glu I B7+9 and 105+10 are connected to the high sedimentation value, while gliadin blocks Gld IB3 and Gld 101 as well as glutenin blocks Glu I B6+8 and Glu 102+12 are connected to the low sedimentation value of the investigated cultivars and strains. On the diagrams (Figure 1) the frequency of the occurrence of cultivars and strains containing g1iadins and g1utenins coded by chromosomes IB and ID is shown. The above mentioned blocks are indicated. 80 50
6 40 I:: Q) ::I C" Q)
cl::
-
30
20 10
0
....
10 18 18 18 18 18 18 1 2 3 4 IS 7
oth
er.
o
blocks
.n..r=..
188+ 187+ 187 187+ 1817 188 8 . • +1'
Gliadins
50
6 40
I::
g
cl::
>. t) I:: Q) ::I C" Q)
30
20
cl::
10 0
101
102
1015
1015
� blocks ...
Glutenins
80
C" Q)
-
1 -1
1 08
other blocks
50
0
102+12
1015+10
other.
Gliadins Glutenins Figure 1 Thefrequency ofthe occurence of cultivars and strains containing gliadins and
glutenins coded by chromosome IB and 1D
Wheat Structure, Biochemistry and Functionality
182
Table 1 Frequency of high quality g.motypes in the groups qfcui/ivaI's containing individual 'good ' protein blocks Protein block Number of cultivars Frequency ofhigh Number ofhigh quality culrivars quality cultivars Gld IB5 7 86 6 Gld IDS 20 85 17 Glu IB7+9 63 46 29 Glu I D5+ 1 0 28 44 64
Table 2 Frequency of high quality genotypes in the groups of cultivars containing one, two, three and{our 'good' protein blocks Frequency ofhigh Number of high Number ofprotein Number of cultivars blocks quality cultivars quality cui/ivaI's 1 8 25 32 2 73 15 11 3 87 15 13 1 00 4 4 4
3.3 Possibility of technological quality evaluation based on the electrophoregrams of gliadins and gluten ins
The percentage of high quality forms (class A + B), among the cultivars and strains containing favourable protein blocks was considered to be an indicator of efficency evaluation of the technological properties, based on electrophoretic picture of storage protein fractions. In the table 1 the percent of high quality forms in groups of cultivars and strains having single protein blocks considered advantageous was shown. Because of a much greater number of forms containing glutenins IB7+9 or ID5+ l 0 as compared to forms containing gliadins IB5 or IDS the obtained result of about 63 % can be regarded as fair. It means that the cultivar, in which the glutenin fractions IB7+9 or ID5+ l 0 were identified may be defined with the probability close to 63 % as high quality form. In the table 2 the percent of high quality forms in groups of cultivars and strains having one, two, three or four protein blocks considered adventageous was shown. As comparison shows, the lowest number of high guality cultivars was observed in the group of forms containing one adventageous protein variant. This number increases with the rise of the number of advantageous protein blocks reaching the highest value for cultivars combining all four such variants. The results presented show that increasing the number of protein fractions contributing to a high sedimentation value in one genotype raises its technological properties. It means that genes controling influence of gliadins and glutenins on technological properties are additive.
4 DISCUSSION The results shown prove the existence of the relation between the blocks of storage proteins and the sedimentation value. However, the technological quality is a complex
183
Wheat Protein Composition and Quality Relationships
feature, affected by many genetical and environmental factors. That is reason, the evaluation of this feature, using exclusively the results of electrophoretic analysis of gliadins and glutenins shall be incomplete for it defines only one of the factors, the technological properties of wheat cultivars. This however does not change the fact, that stored proteins are a very important factor influencing this feature. From the genetic and practical breeding point of view, the electrophoretic analysis of storage proteins is a particulary interesting method, for its results depend exclusively on genotype but not on environmental factors. Another important and advantageous feature of this method is the possibility of quick and error free indication of genotypes having the desired protein blocks combinations. This is the reason why some Polish breeders in co-operation with the autors of this paper have attempted to practically apply the electrophoretic analysis of gliadins and glutenins in defining the following problems: - Identification and reproduction of homozygous hybrid genotypes based on the results of half seedling analysis of the F2 generation. - Selection of homogenic lines, among the heterogenic strains of generations F4 - F7. - Identification and selection of hybrid lines between Triticum aestivum and Triticum durum. - Analysis of inheritance of protein fraction and identification of progeny from cross combinations between Triticum aestivum and wild wheat species.
Summary During the last three years the set of
250
Polish and foreign winter wheat cultivars
investigated in Plant Breeding and Acclimatization Institute in Krakow has been analysed regarding to gliadin and HMW glutenin subunits using the method of polyacrylamid gel electrophoresis. The allelic variants of these proteins - so called blocks - were identified based on catalogues of Poperela (gliadin) and Payne (glutenin). Variancy analysis shows significant relation between gliadin and glutenin subunits coded by chromosomes l B and
I D. Additively influence of storage protein blocks on the sedimentation value was observed. Electrophoregrams of gliadin and HMW glutenin proteins can be utilized as one of the criterion of quality properties estimation in breeding of new wheat cultivars. Polish breeders from Plant Breeding and Acclimatization Institute have practical undertaken to test the electrophoretic analysis of storage proteins in selection of high quality genotypes.
References
1 . L. Zeleny, W. T. Greenway, G. M. Gurney, C . C . Fifield and K. L. Lebsock, Cereal Chem. , 1 960, 37, 673 . 2. A. A. Sozinow and F. A. Poperella, Ann. Techn. Agric., 1 980, 29, 229. 3. P. 1. Payne and G. 1. Lawrence, Cereal Res. Commun., 1 983, 11, 29.
PATHOGENESIS-RE L ATED PROTEINS IN WHEAT
C. Caruso, G. C h i l osi*, C. Caporale, E. Poerio and V. Buonocore
F.
Vacca,
L . Bert i n i , P. M a g ro* ,
D ipartimento di Agrobiologia e Agrochimica and *Dipartimento di Protezione delle Piante, U n iversita degli Studi della Tuscia,Viterbo, 0 1 1 00-ltaly
1 INTRODUCTION
In their natural habitat plants are challenged by several pathogen ic agents such as viruses, viroids, fungi and bacteria. 1 For their survival they have developed a complex variety of defense responses induced upon infection . The most frequently observed biochemical events are the rapid accumulation of antim icrobial compounds (phytoalexins, thionins, enzyme inh ibitors) , 2- 4 the reinforcement of the cell wall by deposition of callose and ligni n , acc u m ulation of hydroxyproline-rich glycoproteins 5 , 6 and enzymes involved i n phenyl propanoid and flavonoid metabolism,1-9 and production of a family of proteins collectively known as pathogenesis-related (PR) proteins.1 0-1 6 P R proteins were first described in tobacco plants infected with tobacco mosaic virus (TMV); 1 7, 1 8 since then, PR proteins have been found in a variety of infected plants such as tomato, potato, maize, parsley, etc.1 9 -22 and h ave been grouped into five classes. The function of PR proteins of group 1 has not yet been established while it has been shown that groups 2 and 3 have in vitro f3 - 1 ,3-glucanase and chitinase activities, respectively; PR5 proteins are structurally similar to the bifunctional trypsin/a amylase i n h ibitor from maize and to the sweet protein thaumatin. Up to date, only few members of the PR4 class h ave been described; in particular genes encoding PR4 proteins have been described in potato, tobacco, tomato a n d rubber tree (Hevea brasiliensis) , 23-26 whereas mature PR4 proteins have been characte rised from barley and wheat seeds. 2 7, 2 8 So far, most of the work has been done on infected plants (tubers, leaves) , while the expression of PR proteins in specific tissues of healthy plants has been less characterized; for example, it has been reported that PR proteins are
developmentally regulated in healthy tobacco plants during flowering29,30 o r d uring leaf senescence i n tomato.31 Moreover expression o f specifically induced PR proteins during germination in maize seeds in response to fungal infection has been reported.3 2 , 33 These findings suggest that the PR proteins could also play a role in plant defense against pathogens during different stages of deve lopment. Recently we isolated from wheat seeds two h ighly homologous PR4 proteins (wheatw i n 1 and wheatwin2) showing antifungal activity towards
185
Wheat Protein Composition and Quality Relationships
phytopathogenic fungi of cereals. 2 8 ,34 Here we report that these PR4 proteins are specifically induced upon infection with Fusarium culmorum d u ring germi n atio n ; using antisera raised against wheatwin 1 the two PR4 proteins were detected 48 hours after infection . 2 MATERIALS AND M ETHODS 2.1
M aterials
Triticum a estivum , cultivar San Pastore, was kindly supplied from Istituto Sperimentale per la Cerealicoltura (S. Angelo Lodigiano, Italy). M acroconidia from sporodochia of Fusarium culmorum (Smith) Sacc.(isolate 485} were collected from 1 0 days cultures grown at 20 OC and suspended in sterile potato dextrose broth (PDB) . Reagents for sodium dodecylsulfate polyacrylamide gel electrophoresis (SOS-PAGE), including low molecular weight markers and reagents for immunoblotting, were from Bio-Rad (Italy). All other reagents were of the h ighest purity com mercially available. 2.2
Methods
2.2. 1 . Plant Materials. Wheat seeds were sterilised with hypochlorite 2% and dried i n a fume cupboard; dried sterilised seeds were placed o n sterile agar plate for 24 hours at 21
Oc to allow germinatio n . Embryos were then inoculated J.l1 (3 1 0S
with a conidial suspension of the fungus F. culmorum by adding 1 0
*
spores per m illiliter) to each embryo. Inocu lated and sterile control e mbryos were
allowed to continue germination at 20 Oc for the required period of time. 2.2.2. Protein extract and western blotting. Sterile and F. culmorum-infected seedlings were h arvested and ground to a powder in a pre-chilled mortar in liquid n itrogen . The extraction buffer, 50 m M sodium phosphate, pH 8.0 containing 0. 1 5 m M NaCI and 1 % PVP, was added to the powder ( 1 mllg fresh weight tissue). The buffer extracts were then centrifuged twice at 1 0,000 rpm for 20 min at 4 0C , and the clear supernatant was used for SOS-PAGE and i m munoblotting, following essentially the procedure of Lae m mli34 and Towbin35, respectively. Monoclonal antibodies were raised against wheatwin 1 (manuscript in preparation) and used in this work. Goat anti mouse horseradish peroxidase (SIGMA) was used as second antibody; both 4-chloro-1 -naphthol (Merk) and l uminol (Amersham) were used for detection of serological reactions.
3 RESULTS AND DISCUSSION We have isolated from the albumin fraction of wheat kernel two highly homologous proteins (wheatwin 1 and wheatwin2) belonging to the PR proteins of class 4 , which were found to be strong i nhibitors of fungal growth . 2 8• 3 6 The present study was undertaken to obtain a better insight into the capability of wheat seedlings to synthesize these particular PR4 proteins in response to fungal infectio n . In fact, protection of the germinating seeds is of vital importance for the survival of the species. Wheat seedlings germinated for 24 hours were inoculated with a suspension of spores of F. culmorum and allowed to continue germination for a total of 24. 48 and 72 hours; control experiments were carried out in the same conditions using sterile water instead of the fungal spores.
1 86
Wheat Structure, Biochemistry and Functionality
Analysis of protein extracts from inocu lated and control seedlings at different time after infection allowed us to analyse the ability of germinating seeds to express specific PR4 proteins. Figure 1 shows the protein extracts analysed by SOS-PAG E . Approximately 1 0 mg of proteins per g of seedlings were obtained. The difference in the protein patterns of infected and control seedlings were mainly quantitative, showing relatively high amount of some proteins in the high range of molecular weight. A monoclonal antibody raised against wheatwin1 was used to detect the presence of this protein as well as the presence of wheatwin2 in the protein extracts obtained from F. culmorum-infected and u ninfected wheat seedlings. The same SOS-PAGE gel was blotted onto n itrocellulose and incubated with the monoclonal antibody; the i m m unoblot analysis of protein extracts is shown in Figure 2. A PR4 protein accum ulates only in extracts from infected seedlings ; its presence is detectable starting at 48 hours after infection and its level remains similar in 72 hour infection . F. culmorum i s reported to b e one of the most widely spread pathogens of wheat; the fungus is a soil-inhabiting species that causes important damages in crops through foot and root rot. Moreover, F. culmorum is frequently isolated from wheat kernels, the inoculum source consequently being also seed-transmissed 37 . I nduction of plant defense proteins such as PR4 proteins in seed tissue of germinating seeds may play a remarkable role in reducing colonization of F. culmorum and can be considered as part of the complex mechanisms that seedlings may use to defend themselves against pathogen attack.
2
3
4
5
Figure 1 SOS-PAGE of protein extracted from uninfected (1,3) and infected (2, 4) wheat seedlings at 48 (1,2) and 72 (3, 4) hours after infection. Molecular markers are shown in lane 5.
1 87
Wheat Protein Composition and Quality Relationships
1
2
3
4
5
Figure 2 Immunoblot analysis of protein extracts from uninfected (1,3) and infected (2,4) wheat seedlings at 48 (1,2) and 72 (3, 4) hours after infection. Purified wheatwin1 (5) was used as a control. R eferen ces
1 . K. Hahlbrock and D. Scheel, 'Innovative Approaches to Plant Disease Control', I. Chet ed. John Wiley, New York, 1 987, pp 229-254. 2. A.G. Darvill and P. Albersheim, Annu. Rev. Plant Physio/. , 1 984, 3 5, 243-275. 3. A.W. Williams and M. M. Teeter, Biochemistry, 1 984, 2 3, 6796-6802. 4. C.A. Ryan, Annu. Rev. Phytopathol. , 1 990, 2 8, 425-449. 5. A.M. Showalter, J .N . Bell, C .L. Cramer, J.A. Bailey, J.E. Varner and C .J . Lamb, Proc. NatJ. Acad. Sci. USA, 1 985, 8 2, 6551 -6555. 6. D. Mazau and M.T. Esquerre-Tugaye, Plant Physiol. , 1 986, 8 0, 540-546. 7. M .A. Lawton , A.A. Dixon, K. Hahlbrock and C.J. Lamb, Eur. J. Biochem. , 1 983, 1 2 9, 593-601 . 8. J. Friend, Ann. Proc. Phytochem. Soc., 1 985, 2 5, 367-392. 9. C .L. Cramer, J.N. Bell, T.B. Ryder, J .A. Bailey, W. Schuch, G .P. Bolwell' M .P. Robbins, A.A.Dixon and C.J. Lamb, .EMBO J., 1 985, 4 , 285-289. 1 0. D.J. Bowles, Annu. Rev. Biochem., 1 990, 59, 873-907. 1 1 . J.F. BoI, J.M. Linthorst and B.J.C. Cornelissen, Annu. Rev. Phytopathol. , 1 990, 2 8 , 1 1 3- 1 38. 1 2. T. Boller, 'Plant-Microbe interactions: Molecular and Genetic Perspectives', T. Kosuge and E .W. Nester, eds. Macmillan, New York, 1 987, Vol 2, pp 38541 3. 1 3. J.P. Carr and D.F. Klessing, 'Genetic Engineering: Principles and Methods', J .K. Satlow ed. Plenum Press, New York, 1 989, pp 65- 1 09. 1 4. A.A. Dixon and C.J. Lamb, Annu. Rev. Plant Physiol. Plant Mol. Bioi. , 1 990, 4 1 , 339-367. 1 5. H .J.M. Linthorst, Crit. Rev. Plant Sci., 1 991 , 1 0, 1 1 3-1 50. 1 6. LC. Van Loon , Plant Mol. Bioi. , 1 985, 4 , 1 1 1 - 1 1 6.
188
Wheat Structure, Biochemistry and Functionality
1 7. 1 8.
L.C. Van Loon and A. Van Kammen , Virology, 1 970, 4 0, 1 99-2 1 1 . S . Gianinazzi, C . Martin and J . C . Vallee, Comptes Rendus de I' Academie des Sciences, serie 0, 1 970, 2 7 0, 2383-2386. A. Camacho-Hen riquez and H-L. Sanger, Arch. Virol. , 1 984, 8 1 , 263-284. E. Kombrink, M. Schroder and K. Hahlbrock, Proc. Natl. Acad. Sci. USA ,
1 9. 20.
1 988, 8 5, 782-786. 21 . 22. 23.
W. Nasser, M. de Tapia, S. Kauffman n , S. Montasser-Kousari and G . Bu rkard, Plant Mol. BioI. , 1 988, 1 1 , 529-538. I . E . Somsich, E. Schmelzer, J. Bollmann and K. H albrock, Proc. Natl. Acad. Sci. USA, 1 986, 8 3, 2427-2430. A. Stanford, M. Bevan and D. Northcote, Mol. Gen. Genet., 1 989, 2 1 5, 200-
208. 24.
L. Friedrich , M. Moyer, E. Ward and J. Ryals, Mol. Gen. Genet. ,
1 99 1 , 2 3 0,
1 1 3- 1 1 9 . 25. 26. 27. 28. 29. 30. 31 .
H . J . M . Linthorst, N . Danhash, F.T. Brederode, J AL . Van Kan ,P.J . G . M . De Witt and J . F. Bol, Mol. Plant-Microbe Interactions, 1 991 , 4 , 585-592. W. Broekaert, H. Lee, A. Kush , N . H . Chua, N . H . , N. Raikhel, Proc. Natl. Acad. Sci. USA , 1 990, 8 7 , 7633-7637. B. Svensso n , I. Svendse n , P. Hojrup, P. Roepstorff, S. Ludvigsen and F . M . Pou lse n, Biochemistry, 1 992, 3 1 , 8767-8770. C. Caruso, C . Caporale, E. Poerio, A. Facchiano and V. Buonocore, J. Prot. Chern. , 1 993, 1 2, 379-386. A.D. Neale, J .A. Wahleithner, M. Lund, H .T. Bonnet, A. Kelly, D . A. Meeks Wagner, W.J . Peacoc and E.S. Den n is, Plant Cell, 1 990, 2 , 673-684. T. Lotan, N. Ori and A. Fluhr, Plant Cell, 1 989, 1 , 881 -887. P. Vera, J. Hernandez-Yago and V. Conejero, Plant Science, 1 988, 5 5, 223-
239. 32. 33. 34. 35.
J . M . Casacuberta, P. Puigdomenech and B. San Segundo, Plant Mol. BioI. , 1 991 , 1 6, 527-536. J . M . Casacuberta, J . M . Raventos, P. Puigdomenech and B. San Segundo, Mol. Gen. Genet. , 1 992, 2 3 4, 97- 1 04. U .K. Laemmli, Nature, 1 970, 2 2 7, 680-685. H. Towbin , T. Staehelin and J. Gordon, Proc.Natl. Acad. Sci. USA, 7 6, 4350-
4354. 36. 37.
C . Caruso, C . Caporale, G. Chilosi, F. Vacca, L . Bertini, P . Magro, and V. Buonocore, submitted to Planta H. Fehrmann 'European Handbook of Plant Deseases', I . M . Smith , D . H . Phillips, A.A. Elliot and S A Archer eds . Blackwell Pubblications, Oxford, London, Edinburg h , Boston, Palo Alto, 1 988, pp 287-289.
E. Poe rio J. Dunez, Scientific Melburne,
INVESTIGATION OF HYPERSENSITIVny TO WHEAT GLIADIN GLUTEN-FREE DIETARY PRODUCTS USING DOT-BLOT ASSAY
FROM
I. M. Stankovic·, I. Dj . Miletic· and V. D. Miletic" •
Faculty of Phannacy, Institute of Bromatology, Belgrade, Yugoslavia "Blood Transfusion Institute, Belgrade, Yugoslavia
1 . INTRODUCTION Coeliac disease is a pennanent intolerance to dietary gluten, resulting in small intestinal villous atrophy with consequent malabsorption and malnutrition. Gluten is the protein fraction of cereal grains that gives cohesiveness and elasticity to the dough. It is composed of prolamins and glutenins. Gliadin (wheat prolamins) are of family of grain kernel storage proteins with more than 40 closely related members. Prolamins are insoluble in water and soluble in ethanol. A gluten-free diet is life long treatment for patients with coeliac disease ( 1 ) and require strict avoidance of any food and other products containing prolamins from selected grains, e.g., wheat, barley, rye and oats. Maize and rice storage proteins are not generally included on this list. G liadins are found in foods, soups, sauces, beers and phannaceutical products, as well as in additives, colorings, emulsifiers, eXcipients, flavorings and preservatives that are derived from gluten containing grains. There is no consensus about the highest nontoxic level of gliadin in gluten-free food. In most countries the official limit for gluten-free dietary products is 0.3 g/100 g on a dry weight basis, but there are many different opinions; some researches suggested much smaller concentrations (2). There is no standardized methodology for gliadin detennination in dietary products and finally there are great individual differences in reactions on gliadin among coeliac patients (3,). The aim of our work was development of specific semiquantitative test for detection of gliadin in gluten-free dietary products using dot-blot assay.
2. MATER IALS AND METHODS
2.1 Materials Table 1 lists 7 gluten-free dietary products and positive control. The table gives commercial names of product. the company that manufactured it and the result of dot-blot assay detennined by the method described below.
Wheat Structure, Biochemistry and Functionality
190
2.2 Methods 2 .2 . 1 Extraction (�{ Gliadins from glutL'1'l-free jJroduct.s .
Extraction of
gliadins from gluten-free dietary products was performed both with 1 % SDS (sodium dodecyl sulphate) and
70% ethanol. Some researchers suggest that
SDS might be the best solvent for extraction of gliadins resulting in more
quantitative extractions and avoiding problems associated with the use of
ethanol in assays solvents for
15
(2). Samples (5 g/25 ml) were suspended in aforementioned 2200 g for 1 5
minutes at room temperature and centrifuged at
minutes. Supernatant was used for immunoassay.
2 .2 .2 Dot-blot assay . strips by applying
A dot-blot a..
2 �l of SDS and ethanol extracts of dietary products in form
of small round dots, As a positive control, a dot of gliadin (Sigma) ( 1 mg/ml in
1 % SDS) was applied to each strip. Unoccupied sites on the strip were blocked
with a solution of
3% gelatin in TTBS (GTTBS) for one hour and then washed
in TTBS. The primary antibody was rabbit antigliadin antisera (Behring) ( 1 :400 in TTBS) and secondary one was goat anti rabbit I gG (H+L) labeled with
horseradish peroxidase (HRP) (Bio Rad) ( 1 :200 in TTBS). As a peroxidase
specific substrate 4-chloro- 1 -naphtol was used,
3. RESULTS Results of dot-blot assay of investigated gluten-free samples are shown in Table 1
TABLE 1. Vot-blot assays q{ dietary products Commercial name
Source
result
1 . Procel
(Aroma)
traces
2. Procel I I
(Aroma)
traces
(Aroma)
++
4. Uniprocel
(Aroma)
traces
5.
(Maizena)
3. Proa�l without lactose and casein
Damin
6. Gluten-free musli
(Finax)
7. Gluten-free macaroni
(Nutritia Dietary Products Ltd.)
8. Gliadin
( Sigma)
+ +++
+++++
191
Wheat Protein Composition and Quality Relationships
In Table 2 are given result.. of dilution experiments as the highest dilutions of investigated samples that gave positive reaction
Table 2
Results of dot-blot assays of different dilutions (2 � dot)
Commercial name
Source
dilution
(Aroma)
1 :8
2. Damin
( Maizena)
1 :4
3. Gluten-free musli
(Finax)
4. Gliadin
(Sigma)
1 . Procel without lactose and casein
1:16 0.0033 mg/ml
4. DISCUSSION AND CONCLUSIONS Three of seven investigated samples showed positive reactions, three samples gave positive reaction only in traces and with one sample reaction was negative. In this study , the detection limit for gliadins in dot-blot assay was determined by serial dilution of corrunercial gliadin (Sigma) and was found to be 0.033 mg/ml, which is concentration level lower than that suggested for gluten-free diet. Using 2 �g of gliadin in a standard dot-blot assay procedure, the lowest detectable value of gliadin was 6 ng. The proposed method can be used as a quick, sensitive and inexpensive semiquantitative test for detection of gliadin presence in dietary products and meals for coeliac patients other in laboratories or by patients themselves.
References 1. 2.
A. S. McNeish, Arch . Di.''I . Child. 1 980, 55, 1 1 0 I. Dj. Miletic, V. D. Miletic and E. A. Sattely-Miller, } Pediatr . Gaestroenterol . Nutr ., 1 994, 19, 2 7
3.
P. Juto, B . Frederikzon and O . Hernell,j . Pediatr . Gastroenterol . Nutr ., 1 985,
4, 723
THE BREWING VALUE AND BAKING QUALITY OF POLISH WINTER WHEAT CULTIVARS
lWiniarski and lWaga Plant Breeding and Acclimatization Institute 4 Zawila St.,30-423 Krakow Poland
I
INTRODUCTION
[n the last few years there has been a noticeable rise of interest in using wheat grain as a raw material for the production of malt. Wheat malt is mainly used in the production of surface fermentation beer, for which some of the old breweries are famous. The production of surface fermentation beer has become popular in mini breweries especially in the West European countries. The simple technology, typical for surface fermentation beer is one of the reasons why this kind of beer is produced in mini breweries. The rising interest on the market in light beer, oflow alcohol content and specific refreshing taste cannot be ignored. Wheat malt is also added to barley malt in production of bottom fermentation beer. ) The increased interest in wheat, as a malt raw material is expected. So far, in Germany, 14 min hectolitres of beer per year, are produced from wheat malt, for which 60 thousand tons of wheat grain are used. 2 It is not a figure which would economically justify breeding of wheat oriented for brewing value. Thus, a more economical decision has been made: to examine brewing value of all kinds of winter wheat currently cultivated, to find forms, which are most suitable for brewing. It should stop the elimination from cultivation wheat, having good brewing value, but lower fertility, poor baking qualities and low animal feed value. The research initiated can give preliminary information about brewing value of Polish winter wheat cultivars.
2 MATERIALS AND METHODS For the investigation, the grain from the Crop Variety Testing Centre was taken. It came from four different group grading stations located in the regions of brewing barley cultivation, where grain is generally adequate for brewing industry. For the investigation 1 0 different winter wheat cultivars of different yielding and baking qualities were used. They were: Alba, Almari, Begra, Jawa, Koda, Lanca, Oda, Olma, Panda and Parada. In the grain the following parameters were determined: thousand grain weight and grain content of 2 . 5 mm size or more. 1 00 g samples were malted at the temperature of 1 2°C according to the following procedure: 1 st day - 5 hours of soaking, in water; 2nd day - 4 hours of soaking in water. The germination was carried on for 5 days. Every day the grain was stirred. The malt was then dried for 1 6 hours at the temperature of 50°C. During the next
193
Wheat Protein Composition and Quality Relationships
two hours the temperature was raised up to 80"C and maintained at this level for the next 6 br's. Technological procedure was identical to one used for barley malt and very similar to that, introduced in Weihenstephan in Germany 2 The evaluation of malt was carried out using standard or adequat/y modified methods to allow small samples of malt to be examined by procedures used for barley grading 3,4 In the malt the following parameters were determined: protein content, soluble nitrogen compounds content, extractability, fine - coarse grind extract difference, wort viscosity, Kolbach index, diastatic power. Selected baking parameters like sedimentation value and falling number had also been examined. The results of the evaluation were elaborated separately for each year using statistical methods. Change of the relationship between the cultivar and the location of breeding station was considered an error. The values of different cultivar patameters were compared to the requirements of Polish Standards and to the requirements put to wheat malt by European industry. 2,5 3 RESULTS OF THE EXPERIMENT AND DISCUSSION
The parameters of the cultivars investigated were considerably different both from statistical and technological point of view. The smallest grain size had the Panda and sometimes the Koda, Lanca and Parada cultivars. There were big differences between cultivars in the protein content. The wheat of good baking value such as Begra, Panda and Almari featured great protein content. However, as for the brewing wheat, the protein content should not exceed 12 % of dry mass. Still the solubility of protein compounds was adequate for most cultivars (Table 1). The extractability of malt was another parameter very much different for the cultivars considered. According to German Iiterature2 , the wheat malt extractability should not be lower than 83 .5 % d.m. Table 1 Brewing value ofmalts from winter wheat cultivars (part 1)
Cultivar
Thousand grain weight g d.m.
Totalprotein content % d.m.
1990 1 991 1991 1 990 39.2 36. 1 1 1 .7 1 1 .3 Koda 1 1.8 37.5 Jawa 1 1 .7 40.5 10.8*** Alba 37.6 1 1 .0*** 40. 5 39.7* * * Oda 42.2 12.3 12.2 36.0 10.8*** 38.1 *** Lanca 12.1 34.9 40.9 10.8*** Parada 10.9*** Begra 39.5 12.7*** 43 .7*** 12.9*** Panda 34.0* * * 12.5 37. 3 * * * 12.6 40. 1 *** 47. 6*** A1mari 12. 1 12.3 Olma 40.2 36.2 12.2 12.5 Mean 1 1 .7 37. 1 4 1 .0 12.0 LSD 0.80 2.48 2.48 0.89 Industry � 12.0 requirements 2,5 * * * significant in relation to means at P�O.OI
Kolbach index % 1990 43 . 1 40.8 45.0 40.2 42.3 39.9 38.5 40.6 4 1 .4 43 .5 4 1 .6
1 991 44.9 42. 5 46.0 45.6 44. 1 42.7 39.0* * * 41.7 43 .3 45 . 1 43 . 5 2.72 � 37.0
Wheat Structure, Biochemistry and Functionality
194
Table 2 Bre'wing value ofmalts from winter wheat cultivars (part 2)
Cultivar
-
Fine grind extract % d.m. 1 99 1 1 990 85.5 86.2*** 84.9 85.7 87.2*** 87. 1 * * * 84. 1 84.9 85 . 1 86. 1 86,..9 85.9 83 .6*** 83 . 8 * * * 84. 3 * * * 83.6*** 84.9 84.7 84.5 84.6 84.9 85.3 1 .27 0.83 2': 83.5
Wort viscosity mPa ' s 1 991 1 990 1 .6 1 0 1 . 585 1 . 557 1.615 1 . 557 1 .603 * * * 1 .660 1 . 595 1 .655 1 .605 1 .660 1 . 570 1 . 532* * * 1 . 580* * * 1 . 543 * * * 1 . 492*** 1.713*** 1 . 597 1 . 725 * * * 1 . 820* * * 1 .645 1 . 584 0.040 0.044 � 1 .650
Koda Jawa Alba Oda Lanca Parada Begra Panda Almari 01ma Mean LSD Industry requirements 2,5 * * * significant in relation to means at P�O.OI
Diastatic power ° WK 1 990 1 99 1 405 382* * * 340 408 3 1 5* * * 320* ** 343 * * * 329 425 * * * 505*** 369*** 429*** 427*** 362 258*** 278* ** 269*** 291 *** 396*** 447*** 344 385 23.3 24.0 2': 270
In our research the greatest extractability was recorded for Alba cultivar, and in 1 99 1 also for the Koda cultivar. The lowest extractability had Begra and Panda cultivars. In spite of . adequate fine - coarse grind extract difference, the wort viscosity above 1 .65 mPa s may hinder proper wort fermentation. Thus was found out for the Olma, Almari, Oda and Panda cultivars. The amylolityc enzyme activity was either good or very good. The biggest diastatic power was observed for Lanca, Parada and Olma while the lowest for Almari and Parada cultivars (Table 2). From technological point of view as for as wheat malt properties are concerned,s the best for brewing seems to be Alba cultivar. During two year research period it showed the greatest malt extractability, adequate protein content in grain, good solubility of protein compounds, suitable wort viscosity and sufficient amylolitic enzyme activity. Fair brewing qualities have Koda, Jawa, Lanca, Parada and Oda cultivars. They showed lower malt extractability and diastatic power value than Alba cultivar did. Poor brewing qualities were revealed in Begra, Panda, Almari and Olma cultivars. On the other hand, these have better baking qualities like greater protein content in the grain and excess wort viscosity as compared to average figures and standards for brewing industry. The examining of the relation between different properties of malt revealed that, like in barley, the high protein content has unfavourable effect on other properties. Particularly significant negative correlation exists between protein content in malt and solubility of protein compounds defined by Kolbach index. The less significant, but also important relation occurs between overall protein content and nitrogen compounds content (Table 3). The effect of protein on malt extractability of wheat has proved greater than the effect of this compound on the extractability of new barley cultivars. The relation for wheat, defined by the regression factor was such as observed for brewing barley 40 years ago. 6 With an increase of protein content by 1 % of d.m. the extractability decreased by about 1 % of d.m. However through long term selection aimed to obtain stable extractability of brewing barley, this relation has been substantially Iimited.As compared to wheat bred and cultivated in Germany, whose brewing value is regularly measured, the Polish cultivars grown in
195
Wheat Protein Composition and Quality Relationships
Table 3 Correlation and regression coefficients between total protein and some quality
parameters Parameter
Correlation coefficients
199 1 1990 -0.9294*** -0.8862*** Extract (fine grind) -0.9009*** -0.8773 * * * Extract (coarse grind) 0. 5343 *** 0.4985*** Soluble nitrogen -0. 7623 * * * -0.7293 * * * Kolbach index * * * Showed only significant relationships at P�O.OI
Regression coefficients 1 990 - 1 .07 - 1 .06 22.53 -2.28
1 991 -1 .07 -1.1 1 23 . 78 -2.37
Table 4 Comparision of average value of the same quality parameters ofwheat maltfr-om
German and Polish wheats, cultivated in the countries 0 ori in Wheat cultivars in German Wheat cultivars in Poland Quality parameters
Extractability (% d.m.) Fine-coarse grind extract difference (%) Wort viscosity (mPa·s) Protein content (% d.m.) Soluble nitrogen (mgll 00g) Kolbach index (%) Diastatic power ("WK)
1 989 85 . 1
1 990 84.6
1990 84.9
1 99 1 85.3
1 .2 1 .738 1 3 .0 805 38.8 298
1 .4 1 .754 1 2.9 825 40. 1 284
1 .0 1 .645 1 2.0 792 4 1 .6 385
1 .3 1 . 584 1 1 .7 807 43.5 344
the present conditions achieve a slightly higher brewing value (Table 4). It is probably related to poorer fertilisation of soil in Poland which results in a lower protein content in the grain. Polish cultivars of winter wheat feature slightly better average extractability of malt, better cytolitic and protein disintegration and much higher average amylolitic enzyme 25 activity. The latter may be explained by more intensive selection in Germany, , aimed at elimination from the cultivation the wheat cultivars having greater sprouting tendency adversely affecting the baking value of grain. Eradication of these forms means removing of the objects of richer amylolitic enzyme complex.
4 CONCLUSION
As results, from two year investigation on winter wheat cultivars, Alba cultivar has got the best brewing value and the worst baking quality. It showed the greatest extractability of malt, the adequate cytolitic and protein disintegration and average amylolitic enzyme activity. The Koda, Jawa, Lanca, Oda and Parada cultivars showed a fair brewing value, meeting the requirements of brewing industry. The poorest brewing value was represented by cultivars of greater protein content in the grain,like Begra, Panda, Almari and Olma those having, on the other hand, better baking quality. In comparision with foreign cultivars, home-bred cultivars seem to have, on the whole,better technological value because of the lower protein content in grain.
Wheat Structure, Biochemistry and Functionality
196
Summary In connection with the rising interest in winter wheat as a raw material for brewing industry 1 0 cultivars grown in 4 different locations in Poland have been examined. In these cultivars, after malting, the most important properties were determined. Those were: protein content, extractability, fine - coarse grind extract difference, wort viscosity, soluble nitrogen compounds content and diastatic power of malt. The best for brewing appeared to be the Alba cultivar. The fair brewing value showed Koda, Jawa, Lanca, Parada and Oda cultivars. The lowest brewing value have the cultivars known for their better baking qualities, like Begra, Panda, Almari and Olma. As compared to foreign cultivars, mainly German, Polish cultivars generally feature better brewing value.
References 1.
2.
3. 4. 5. 6.
1. S. Hough, 'The Biotechnology of Malting and Brewing', Cambridge University
Press, Cambridge, 1985. B. Sacher and L. Narziss, Brauweit, 1 990, 45, 2 1 00. L. Rusniak and M. Kowalska, Bulletin of Plant Breeding Institute, 1 974, 1-2, 1 1 5 . L. Rusniak and M . Kowalska, Bulletin ofPlant Breeding Institute, 1975, 1-2, 83 . L. Narziss and Schwill-Miedauer, Brauwelt, 199 1 , 4, 1 06. F. Schmidt, L. Reiner and M. Giehl, Brauwissenschajt, 1975, 4, 94.
Wheat Protein Molecular Biology and Genetic Engineering
WHEAT PROTEIN MOLECULAR BIOWGY AND GENETIC ENGINEERING: IMPUCATIONS FOR QUAUTY IMPROVEMENT P.R. Shewry!, AS. Tatham!, J. Greenfield!, N.G. Halford!, S. Thompson1,2,3, D.H.L Bishop3, F. Barro\ P. Barcel04 and P. Lazzeri4. lIACR-Long Ashton Research Station, Department of Agricultural Sciences, University of Bristol. Long Ashton, Bristol BSl8 9AF 2J>resent address: Sir William Dunn School of Pathology, South Parks Road, Oxford
OXl 3RE
3NERC Institute of Virology and Environmental Microbiology, Mansfield Road, Oxford OXl 3SR 4IACR-Rothamsted, Harpenden, Herts AI.5 2JQ
1 IN1RODUCTION Wheat gluten is a complex mixture of proteins, with over 50 individual components being revealed by two-dimensional electrophoresis. Although most, if not all, of these components contribute to its functional properties, their precise structures and roles have still not been established. There are several reasons for this. Firstly, although it is relatively easy to fractionate gluten proteins into groups (e.g. a-type gliadins, (a) gliadins and v-type gliadins), the purification of individual components of these groups can be extremely difficult. Secondly, they may have unusual structures, resulting from the presence of extensive repeated sequences, making them difficult to study using methods of analysis generally used for globular proteins. Thirdly, the functional properties of gluten proteins are expressed as part of the gluten network that forms in doughs. Attempts to reconstitute dough or gluten from their constituent parts have met with varied success, making it difficult to determine the functional properties of individual purified components. Molecular biology can help to provide solutions to all these problems. The sequences of cDNAs and genes provide complete amino acid sequences of the encoded proteins, which in turn facilitate structural studies. These DNAs can also be expressed in E.coU or other heterologous hosts to produce wild-type or modified proteins for structural studies, or for functional analyses using small scale systems such as the 2g mixograph.l Finally, the cDNAs and genes can be used for wheat transformation, in order to explore the functionality of the encoded proteins when expressed in the developing seed.
2
ISOLATION OF cDNAs AND GENES FOR GLUTEN PROTEINS
The isolation of cDNAs and genes, even for abundant proteins such as most gluten proteins, is still far from routine. In fact, the repetitive structures of wheat gluten proteins make this particularly problematical as recombination between the repeated nucleotide sequences present in the corresponding cDNAs and genes may lead to instability. As a result our knowledge of prolamin sequences is still incomplete, with no complete sequences of (a)-gliadins and limited knowledge of LMW subunits of glutenin.
200
Wheat Structure. Biochemistry and Functionality
Although we do have the complete sequences of (&)-gliadin homologues from barley (C hordeins)2.3 and rye «&)-secalins),4 the (&)-gliadins appear to be more diverse in structures and the isolation of corresponding cDNAs or genes remains an important target. Our lack of knowledge of the structures of LMW subunits is a major problem
in understanding their role in gluten. These proteins account for about 40% of gluten, and they are se arated by SDS-PAGE into three groups called B-type, C-type and D-type subunits.6. It is extremely difficult to purify single components for
�
detailed analysis. Nevertheless, Lew et aI.B have determined the N-terminal sequences of a number of individual components. This showed that the B-type components formed a discrete group, with two sub-groups called LMWs and LMWm on the basis of their N-terminal amino acids. The LMWm type were further divided into three subgroups on the basis of amino acid substitutions at position 5 (Table 1). It is unfortunate that all the available cloned cDNAs and genes correspond either to the
minor LMWmc5 type of LMW subunit or to variant types not identified by Lew et aI.B In contrast, we know little about the quantitatively major LMWs type. Lew et aI.B also showed that the C-type subunits were related to a-type and y type gliadins, and suggested that they correspond to mutant forms of these proteins which contain additional cysteine residues: cDNAs encoding such proteins have been isolated.9,IO The D-type LMW subunits also appear to be mutant forms of monomeric gliadins, being related most closely to (&)-type gliadinsY
3 THE
APPliCATION OF PROTEIN ENGINEERING TO ANALYSIS OF WHEAT GLUfEN PROTEIN STRUCIURE
THE
Protein engineering is the analysis of structure and function using protein expressed from a cloned cDNA or gene. The advantages include speed, high yields and ease of purification. However, the most important advantage is undoubtedly the ability to design and express proteins with specific mutations in order to determine the impact on structure and function. It has proved immensely powerful in studying globular metabolic proteins, such as enzymes, but has not so far had a major impact on analysis of food or structural proteins. The requirements for protein engineering are the availability of cDNAs or genes and of an expression system. The latter is usually based on microorganisms (e.g. E.coli, other bacteria, yeasts and filamentous fungi) or cultured cells (notably insect or mammalian cells), with expression vectors derived from plasmids or viruses. It is necessary not only to produce high levels of protein, but also that the protein should be correctly folded and, in some cases, post translationally processed and assembled in multi-subunit complexes. It is this latter requirement which has limited the application to some proteins. We have used protein engineering to study the structures and properties of wheat gluten proteins, including the formation of glutenin polymers, using yeast,12 baculovirus13 and E.colil4 expression systems.
3.1 Disulpbide Bond Formation
in
a
LMW
Subunit of Glutenin
Expression of a wheat LMW glutenin subunit gene in cultured insect cells gave yields of about 30-5Omg protein per litre of culture, accounting for about 25-30% of the protein extracted from the insect cellsP However, much of this protein appeared
201
Wheat Protein Molecular Biology and Genetic Engineering
Table 1 Availability of cloned cDNAs or genes for LMW subunits of wheat glutenin Protein Type! B-type LMW s
Clone
Gene or
(major type)
None
LMW mh5
(minor type)
None
mr5
(minor type)
None
meS
(minor type)
Variant types
C-type a-type V -type D-type
Reference
eDNA
cDNA LMWG-IDI Gene cDNA pTdUCDI
Bl1-33
Okita et aI,9
Colot et aI,15 Cassidy and Dvorak16
lP1211 pLMW21
Gene Gene
Pitts et aI,t7 I D'Ovidio et aI, B
A735
eDNA
Okita et aI,9
pWI020
cDNA
Scheets & Hedgcoth,10
None
IProtein groups as defined by Payne et aI.,6 Jackson et aI.,7 and Lew et aI.B to be incorrectly folded and the yield after in vitro refolding was less than 10% of the total. Nevertheless, this system was used to study the effects of substitution of specific cysteine residues with serines on the ability of the protein to form disulpbide-bonded polymers. Comparison of the numbers, distributions and sequence contexts of cysteine residues showed that six of the eight cysteines present in the LMW subunit encoded by the cloned gene are also present in monomeric y-gliadins and four of these also in monomeric a-gliadins. These six cysteines were therefore assumed to form three intra-chain disulpbide bonds, as shown in Figure lA The two additional cysteines present in the LMW subunit (SH in Figure lA) are assumed to be "unpaired" and available to form inter-chain disulpbide bonds. A series of mutants was therefore constructed, in wbich one or both of the "additional" cysteines were converted to serine and the expressed proteins purified and re-folded in vitro using a rapid dilution method. The results are shown in Figures 1 B-E. Refolding of the wild-type protein (Figure IB) gave a mixture of monomers and polymers (the latter being too large to enter the gel). Monomers were also observed when the two single mutants were re folded (Figures lC and D), with dimers also present but no polymers. The proportion
Wheat Structure. Biochemistry and Functionality
202
A Predicted Behaviour Wild type
II I
I
Repeals
SH
mutant 1
M
Serine
�
2 Cysteine
dimers
Serine
�
�
Serine
C
B
�
SH
Cysteine
�
double mutant
polymers
Serine
0
monomers
E
-
�imers fnonomers
Mr
a
b
a
b
a
b
a
b
Mr
Figure lA Schematic representation of the structures of the wild type LMW subunit and the three mutants, and their predicted behaviour. The proposed disulphide structure is based on comparisons with monomeric r-g1iadins and a-gliadins. Figures IB-E SDS-PAGE of reduced (tracks a) and reduced and refolded (tracks b) samples of the following expressed LMW subunit proteins: wild-type (A), mutant 1 (B), mutant 2 (C) and double mutant (D). Mr indicates molecular weight marker proteins (Mr 180,()()(), 116,()()(), 84,()()(), 58,()()(), 48,500, 36,500 and 26,600).
Wheat Protein Molecular Biology and Genetic Engineering
203
of dimers was higher with mutant 2 (Figure ID), which is consistent with the single "additional" cysteine close to the N-terminus being more readily accesis ble for inter chain disulphide bond formation. These dimers were absent when the double mutant was folded, which gave monomers with little or no polymer. At least two monomeric bands were observed with mutant 1 and the double mutant, which presumably resulted from the presence of forms with incorrect disulphide bonds. Although the results of this study were consistent with our hypothesis and with the patterns of disulphide bond formation revealed by direct analysis of peptides prepared from gluten,19 they were not conclusive. The levels of refolded proteins obtained were very low, and the proportions of monomers and polymers formed by the wild-type protein were found to be influenced by the protein concentration. In addition, it is necessary to make further mutants in which putative paired cysteines are also substituted in order to determine whether the generation of further "unpaired" cysteine residues also affects polymer formation. 3.2 Analysis of BMW Subunit Structure
The HMW subunits of glutenin consist of three distinct domains. These are unique N- and C-terminal domains of 81-104 residues and 42 residues, respectively, flanking a central repetitive domain v in length from about 630 to 830 residues. Analyses of whole HMW subunit proteins, 1 and of synthetic peptides corresponding to the repeat motifs in the central domain,22 have shown that the repetitive sequences form an unusual spiral structure based on fJ-reverse turns, but the details of this structure and its role in determining the functional properties of the HMW subunits have proved difficult to determine due to the complex multi-domain structure of the protein. We have therefore adopted a protein engineering approach, and expressed a peptide corresponding to residues 103 to 643 of HMW subunit IDxS in E.coli. This peptide, and a mutant form with cysteine residues present at the N- and C-termini, have been purified and are currently being studied to determine their conformations, ability to form polymers and rheological properties.
�
4 EXPRESSION OF GLUTEN PROTEINS IN 1RANSGENIC WHEAT Protein engineering is a powerful tool for studying the structures and biophysical properties of individual gluten proteins and it is even possible to determine the . functional properties of heterologously expressed proteins by incorporation into doughs using a small scale mixograph.1 However, such incorporation experiments are difficult to perform and it is not possible to ensure that the incorporated protein forms the same molecular interactions as it would if expressed in the developing wheat grain. The development of wheat transformation systems therefore provides an opportunity to determine the roles of individual proteins in wheat gluten structure and functionality. This will ultimately allow us to develop new varieties in which the composition and properties of the gluten proteins have been tailored for specific end use properties. We are using wheat transformation to determine the roles of HMW subunits in the biophysical and functional properties of wheat gluten. This exploits the availability of a series of near isogenic wheat lines, produced by Dr Greg Lawrence at CSIRO, Canberra.23 These lines include a triple null containing no HMW subunits,
Wheat Structure. Biochemistry and Functionality
204
a control with five HMW subunits (lAxl, lBx17 + lBy18, 1Dx5 + 1Dy10) and six lines containing one (lAxl), two (lBx17 + lBy18 or 1Dx5 + 1Dy10), three (lAxl, 1By17 + 1By18 or 1Ax1, 1Dx5 + 1Dy10) and four (lBx17 + 1By18, 1Dx5 + 1Dy10) subunits. These lines are currently being transformed by inserting genes encoding subunit 1Ax1,24 1Dx5lS or 1Dy10.26 The genes for subunits 1Dx5 and 1Dx10 are currently being used in separate transformation experiments, but further studies will include the introduction of both genes together, allowing the effects of transformation with subunits 1Dx5 and 1DylO alone and the allelic pair to be compared. Previous studies have indicated that the HMW subunits have both quantitative and qualitative effects on gluten quality.24,27 Comparisons of the amounts of HMW subunits synthesised in the transformants and the isogenic control lines, and the biophysical and functional properties of the glutens and doughs produced from the lines, will allow these effects to be dissected in detail. This will facilitate the use of genetic engineering to produce wheats with new and improved end-use properties. Acknowledgement IACR receives grant-aided support from the Biotechnological and Biological Sciences Research Council of the United Kingdom. References
1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 1 1. 12. 13. 14. 15. 16. 17.
F.Bekes, o. Anderson, P.W. Gras, RB. Gupta, A Tam, C.W. Wrigley, and R Appels, 'Improvement of Cereal Quality by Genetic Engineering', Eds RJ. Henry and JA Ronalds, Plenum Press, New York and London, 1994 p.97. J. Entwistle, S. Kundsen, M. Miiller,and V. Cameron-Mills, Plant MoL BioL 1991 17, 1217. O.V. Sayonova. Abstract of thesis, Moscow, 1992. G. Hull, N.G. Halford, M. Kreis, and P.R Shewry, Plant MoL BioL 1991 17, 1111. D.D. Kasarda, J.-C. Autran, EJ.-L Lew, C.C. Nimmo and P.R Shewry, Biochim. Biophys. Acta 1983 747, 138. P.I. Payne and K.G. Corfield, Planta 1979 145, 83. EA Jackson, LM. Holt and P.I. Payne, Theor. AppL Genet. 1983 66, 29. EJ.-L Lew, D.D. Kuzmicky, and D.D. Kasarda, Cereal Chem. 1992 69, 508. T.W. Okita, V. Cheesbrough and C.D. Reeves, J. BioL Chem. 1985 260, 8203. K. Scheets and C. Hedgcoth, Plant Sci. 1988 57, 141. S.M. Masci, E. Porceddu, G. Colaprico and D. Lafiandra, J. Cer. Sci. 1991 14, 35. K.A Pratt, PJ. Madgwick and P.R Shewry, J. Cer. Sci. 1991 14, 223. S. Thompson, D.H.L Bishop, P. Madgwick, A S. Tatham, and P.R Shewry, J. Agric. Food Chem. 1994 42, 426. L Tamas, J. Greenfield, N.G. Halford, AS. Tatham, and P.R Shewry, Protein Expression and Purification 1994 5, 357. V. Colot, D. Bartels, R Thompson and R Flavell, MoL Gen. Genet. 1989 216, 81. B.G. Cassidy and J. Dvorak, Theor. AppL Genet. 1991 81, 653. E.G. Pitts, J.A Rafalski and C. Hedgcoth, Nucleic Acids Res. 1988 16, 1 1376.
Wheat Protein Molecular Biology and Genetic Engineering
18. 19. 20. 21. 22. 23. 24. 25. 26.
27.
205
R D'Ovidio, AT. Oronzo and E. Porceddu. Plant MoL BioL 1992 18, 781. P. KOhler, H.-D. Belitz and H. Wieser, Z. Lebens. u-Forsch. 1991 192, 234. J.M. Field, AS. Tatham and P.R Sbewry, Biochem. J. 1987 247, 215. MJ. Miles, HJ. Carr, T. McMaster, KJ. rAnson, P.W. Belton, VJ. Morris, J.M. Field, P.R Sbewry and AS. Tatham, Proc. NatL Acad. Sci. USA 1991 88, 68. AS. Tatham AF. Drake and P.R Sbewry, J. Cer. Sci. 1990 11, 189. GJ. Lawrence, F. Macritchie and C.W. Wrigley, J. Cer. Sci. 1988 7, 109. N.G. Halford, 1.M. Field, H. Blair, P. Urwin, K. Moore, L Robert, R Thompson, RB. Flavell, AS. Tatham and P.R Sbewry, Theor. AppL Genet. 1992 83, 373. 0.0. Anderson, F.C. Greene, RE. Yip, N.G. Halford, P.R Sbewry and J.-M. Malpica-Romero, Nucleic Acids Res. 1989 17, 461. RB. Flavell, AP. Goldsbrougb, LS. Robert, D. Schnick and RD. Thompson, Bio/I'echnology 1989 7, 1281. P.R Sbewry, N.G. Halford and AS. Tatham, J. Cer. Sci. 1992 15, 105.
THE USE OF BIOTECHNOLOGY TO UNDERSTAND WHEAT FUNCTIONALITY
A. E. Blechl and 0.0. Anderson Agricultural Research Service U.S. Department of Agriculture Western Regional Research Center 800 Buchanan St. Albany, CA, USA 947 1 0
1 INTRODUCTION
The High Molecular Weight Glutenin Subunits (HMW -GS) are seed storage proteins that along with Low Molecular Weight Glutenin Subunits form disulfide-bonded high molecular weight polymers in the endosperm cells of wheat. There are two types of HMW-GS, designated x and y types, and each allelic pair is encoded by linked genes at the Glu-J loci on the long arms of the homeologous group 1 chromosomes . In any one cultivar, between 3 and 5 of the 6 genes are active in producing polypeptides. I Although HMW-GS constitute only 5-10% of the total flour protein, they have large effects on mixing and baking properties. The presence of specific allelic pairs, most notably those encoded by the 0 genome, has been correlated with bread-making quality parameters.v The total amount of HMW-GS is also important in determining the strength characteristics of bread doughs.2,4 Indeed, some allelic differences, for example those between IAx l or I Ax2* and their null alleles,S and those between I Bx7 and I Bx7*,6 have been attributed to quantitative differences in gene expression, The effects of having different numbers of HMW-GS in the same genetic background has been investigated by Lawrence et al. who derived wheat lines that express between 0 and 5 HMW-GS.7 Lines with fewer numbers of HMW-GS genes had lower levels of HMW GS polypeptides and exhibited decreased performance in mixing and baking tests.7,8,9 Using an independent set of near-isogenic lines from variety Sicco, Kolster et al. found that decreases in overall HMW-GS levels due to deletion of the D-genome-encoded subunits was compensated to some extent by increases in the other HMW-GS, but no compensation occurred when A- or B-genome-encoded subunits were missing.1o Galili et al. also found that there was no compensation by the D-genome-encoded HMW-GS when the Glu-Bl locus was deleted, but that an increase in B-encoded subunits in aneuploid substitution lines resulted in decreased synthesis of the other HMW-GS.II We were interested in investigating further the relationship between the quantity of HMW-GS and end-use properties, specifically whether increases in HMW-GS levels would lead to improvements in dough strength. The establishment of a reliable and efficient transformation protocol in our laboratoryl2 allows us to ask this question experimentally by introducing additional copies of HMW-GS genes into wheat. The first
Wheat Protein Molecular Biology and Genetic Engineering
results from these experiments
are
207
presented in this paper.
2 RESULTS AND DISCUSSION
Among the cloned genes available to us for re-introduction into wheat were all six HMW-GS genes from cultivar Cheyenne. These same genes are already components of the genome of cultivar Bobwhite, the wheat variety used in our DNA transformation experiments because of its high efficiency of regeneration from tissue cultures. For our initial experiments, we wanted to be able to distinguish the products of the introduced gene from those of the endogenous genes. Shani et al. had previously demonstrated that hybrid HMW-GS, created by gene fusions and expression in the bacteria E. coli, migrated in SDS-PAGE at unique positions, often clearly distinguishable from those of the native HMW-GS.13 One such hybrid, made by joining the genes for the DylO and Dx5 subunits at a shared HindlII site just inside the repeat region, migrates at a position slightly ahead of that of the native Dx5 subunit. This result can be seen in Figure 1. The lane marked Y(H)X contains the extract from E. coli expressing the DylO:Dx5 hybrid glutenin subunit (marked by an arrow). This band is not seen in extract from bacteria that contain the empty expression plasmid, pet3A,14 without a HMW -GS coding sequence (lane pet3A). Lane BW contains seed extract from cultivar Bobwhite showing the HMW-GS Ax2*, Dx5, Bx7, By9 and DylO as well as a few minor bands in this region. To test whether the separation between the hybrid and native HMW-GS would be clear enough in seed extracts under these gel conditions, Bobwhite seed extract and extract from the bacteria expressing the hybrid HMW-GS gene were mixed and run in the lane marked "mix". The hybrid DylO:Dx5 GS is clearly distinguishable from the endogenous HMW-GS, migrating slightly ahead of the Dx5 subunit and slightly behind a minor band from the wheat seed extract. Based on these results, a DNA construction was made in which the 5' and 3' flanking sequences for bacterial expression were replaced by the original wheat sequences. The result, a hybrid gene between the native DylO and Dx5 genes with the fusion junction at the HindlII site, is diagramed in Figure 2. The promoter elements for expression in wheat endosperm are provided by the approximately 2800 bp of sequence 5' to the DylO coding region. It has been shown that 432 bp of DylO 5' flanking sequence is sufficient for full levels of expression of reporter genes in maize endosperm cell transient assayslS and that 433 bp of the allelic Dy12 gene is sufficient for endosperm-specific expression of reporter genes in transgenic tobacco.16.17 The coding region of the hybrid gene consists of the first 143 codons of DylO, including the signal peptide, and the last 720 codons of the Dx5 gene. The Dx5 gene also provides the translation and transcription termination sequences within approximately 2000 bp of 3' flanking DNA. This DNA was co-transformed into immature embryos of Bobwhite along with DNA containing a selectable marker gene encoding herbicide resistance, UbiBAR.12 The DNA's were introduced by the particle bombardment method as detailed in Weeks et al.12 Transformed tissues were selected based on their resistance to the selection agent, bialaphos, and plants were regenerated. The transformation efficiency was 1 independent fertile resistant wheat plant obtained for every 200 embryos bombarded. Immature seeds from these plants were removed for dissection between 3 and 4 weeks after anthesis. The embryos were plated on a precocious germination medium containing 3 mg/L
208
Wheat Structure, Biochemistry and Functionality
Figure 1 Expression of hybrid HMW-GS genes in transgenic wheat and E. coli Extracts from either transgenic wheat endosperm (left four lanes) and/or E. coli cells containing the pet3A expression plasmid (right three lanes) were subjected to SDS-PAGE in a 10% (0.05% bis) acrylamide gel. The gel was stained with Coomassie blue. Lane 1 and 2 contain protein extracts from Tj wheat seeds of 2 independent lines whose embryos germinated in the presence of 3 mg/L bialaphos. Lane BW contains protein extract from the parental nontransformed cultivar Bobwhite. The lane labelled Y(H)X contains protein extract from an E. coli culture transformed with the pet3A vector expressing the hybrid Dy1O:Dx5 glutenin subunit. The lane labelled "mix " is an artificial mixture of the contents of lanes BW and Y(H)X. The lane labelled pet3A contains extract from E. coli transformed with the empty (nonexpressing) pet3A vector plasmidu. The designations to the left identify endogenous HMW-GS of Bobwhite wheat endosperm. The numbers to the right indicate the sizes in kilodaltons and migration positions of molecular weight standards run in a different lane of the same gel. The arrows mark the location of the bands corresponding to the hybrid HMW-GS.
�--
1
Wheat 2
-----;=====+- E. coli ---'1 BW mix Y(H)X pet3A
Ax2*
'
Dx5
-
.......
B x7
-
By9, Dy1 0
- 94
- 67
Wheat Protein Molecular Biology and Genetic Engineering
209
bialaphos to confirm that the herbicide resistance was a stably inherited trait and thus that these were true transgenic wheat plants. The endosperms were used to prepare protein extracts which were then analyzed by SDS-PAGE. Two such extracts are shown in Lanes 1 and 2 of Figure 1 . The band corresponding to the hybrid HMW -GS is indicated by the arrow. This protein is clearly present at levels higher than those of the endogenous HMW-GS in these two independent transformed lines. Similar results were obtained in 1 2 other independent transformants: expression levels are at least as high as those of the endogenous genes. The basis of the relatively high level of expression of the hybrid HMW -GS is not known at this time. Analyses of later generations of seed progeny of these plants show that the high expression levels are inherited to at least the T3 generation (data not shown). Experiments are in progress to quantitate the accumulation levels of the hybrid HMW-GS relative to total protein and to the native HMW-GS. Figure 2 Diagram of the plasmid encoding the hybrid HMW-GS The plasmid was constructed by fusing the 5' flanking DNA and N-terminal coding region of the DyJO HMW-GS to the coding and 3 ' flanking regions of the Dx5 HMW-GS gene. The junction is a shared Hindlll site (arrow) just inside the codons for the repeated amino acid motif regions of the DylO and Dx5 genes (shown as circles corresponding to 20 codons). J The flanking sequences are denoted by thin lines and are not drawn to scale. The DyJO coding regions are shown in black and the Dx5 coding regions are shown in gray. The S letters mark the locations of cysteine residues in the encoded polypeptide. The wheat sequences were cloned into the EcoRl site of the vector pBluescript (Stratagene, La Jolia, CAY.
5'
-Ot--fp_ Dy1 0
Hitll
Dx5
()- 3 '
3 CONCLUDING REMARKS These experiments demonstrate that a gene encoding a HMW-GS subunit can be stably incorporated into the wheat genome by genetic transformation and that such a gene is expressed at levels at least as high a,o; those of the endogenous subunits. The fourteen independent wheat lines derived here will provide a near-isogenic series in which to examine the effects of this HMW-GS on the mixing and baking properties of doughs derived from their flours. Because the protein synthesized is an entirely new variant, any differences observed in functionality could be due to either qualitative or quantitative effects of the new HMW-GS. In order to determine whether there is a purely quantitative effect of HMW-GS levels on dough strength, we are currently introducing native Dx5 and DylO genes into wheat by transformation. The results of the experiments presented here predict that the relative levels of these proteins in transgenic endosperm will be increased.
Wheat Structure, Biochemistry and Functionality
210
4 ACKNOWLEDGMENTS We acknowledge the excellent technical assistance of Dafna Elrad and Eric Schlossberg. This work was supported by the Agricultural Research Service, U. S. Department of Agriculture CRIS No. 5325-21430-001-00D. References
1. P. R. Shewry, N. G. Halford and A. S. Tatham, J. Cer. Sci. , 1992, 15, 105. 2. P. Payne, M. A. Nightingale, A. F. Krattiger and L. M. Holt, J. Sci. Food Agric. , 1987, 40, 5 1 . 3 . O. M . Lukow, P. I Payne and R. Tkachuk, J. Sci. Food Agric. , 1989, 46, 45 1. 4. K. H. Sutton, J. Cer. Sci., 199 1 , 14, 25. 5. G. I. Lawrence, F. MacRitchie and C. W. Wrigley, J Cer. Sci., 1988, 7, 109. 6. N. G. Halford, I. M. Field, H. Blair, P. Urwin, K. Moore, L. Robert, R. Thompson, R. B. Flavell, A. S. Tatham and P. R. Shewry, Theor. Appl. Genet., 1992, 83, 373. 7. B. A. Marchylo, O. M. Lukow and I. E. Kruger, J Cer. Sci., 1992,15, 29. 8. L. Gao and W. Bushuk, Cereal Chern., 1993, 70, 475. 9. R. B. Gupta, Y. Popineau, I. Lefebvre, M. Cornec, G.I. Lawrence and F. MacRitchie, J Cer. Sci., 1995, 21, 103. 10. P. Kolster, C. F. Krechting, and W. M. 1. van Gelder, Theor. Appl. Genet. , 1993, 87, 209. 1 1. G. Gali1i, A. A. Levy and M. Feldman, Proc. Natl. Acad. Sci. USA, 1986, 83, 6524. 12. I. T. Weeks, O. D. Anderson and A. E. Bleehl, Plant Physiol., 1993, 102, 1077. 13. N. Shani, I. D. Steffen-Campbell, O. D. Anderson, F. C. Greene and G. Galili, Plant Physiol., 1992, 98, 433. 14. A. H. Rosenberg, B. N. Lade, D. Chui, S. Lin, 1. 1. Dunn and F.W. Studier, 1987, Gene, 56, 125 15. A. E. Bleehl, G. F. Lorens, F. C. Greene, B. E. Mackey and O. D. Anderson, Plant Sci. , 1995, 102, 69. 16. V. Colot, L. S. Robert, T. A. Kavanagh, M. W. Bevan and R. D. Thompson, EMBO J., 1987, 6, 3559. 17. L. S. Robert, R. D. Thompson and R. B Flavell, Plant Cell, 1989, I, 569.
CONSTRUCTION OF D16 GENES MODIFIED IN THE REPETITIVE DOMAIN AND THEIR EXPRESSION IN ESCHERICHIA COU
R. D'Ovidio1,2, O.D. Anderson2 , S. Masci1,2, J. Skerritt3 and E. Porceddu1 IDipartimento di Agrobiologia e Agrochimica, Universita della Tuscia, Via S. Camillo de Lellis, 01 100 Viterbo, Italy. 2US Department of Agriculture, A.R.S . , W.R.R.C . , 800 Buchanan Street, Albany, CA 947 10, USA. 3CSIRO Division of Plant Industry, GPO Box 1600 , Canberra ACT 2601 , Australia.
1 INTRODUCTION High molecular weight glutenins (HMW-GS) have been studied extensively both at biochemical and molecular level because of
their role in determining the viscoelastic
properties of wheat gluten, which in turn are responsible for the quality characteristics
and biochemical analyses indicated that bread making quality Glu-DI and Glu-AI locP·3. Detailed analysis at the Glu-DI locus has shown that, in general, the cultivars containing the allelic pair designated 1Dx5 + IDyl0 show superior bread making quality3.
of bread wheat. Genetic
is particularly
associated with variation at the
Nucleotide sequence analysis of HMW-GS genes made it possible to distinguish the primary
structure of these
proteins in three main regions: the non repetitive N-terminal
and C-terminal domains, and
the central repetitive domain. Sequence comparison of
genes encoding HMW-GS revealed the presence of small differences in aminoacid sequence and/or composition which have been indicated as responsible for determining differences
in the physical
properties
of gluten.
In particular,
two
structural
characteristics seem mainly involved in conferring such important role to these proteins: the number and position of cysteine residues,
and the
structure of the
repetitive domain. In order to verify the importance of the latter characteristic we have modified
the central repetitive domain of the 1Ox5 gene.
2. MATERIAL AND METHODS The modifications of
the repetitive domain contained in the Dx5 constructs were the expression in Escherichia coU was
carried out on the pET-3a-Glu-1Ox54 and
performed following the procedure reported by Studier and Moffatts.
SDS-PAGE was performed with a Mini-Protean II Cell (BioRad) according to the manufacture instructions. western blot analysis were carried out using monoclonal antibody which recognized specifically the HMW-GS6.
Wheat Structure. Biochemistry and Functionality
212 Table
I . Summary ofthe characteristics oftlze polypeptide expressed by each pET-3aDx5 plasmid constructs.
1
pET-3a-Dx5
Dx5-R853
696
853
1
Dx5-R576
1
1
Dx5-R44 1
1-
Repetitive domain length
576
441
+ 22 . 5
-17.2
-36.6
88,259
104,583
75,484
61 ,80 1
1 19,000
142,000
102,000
82,000
% of repetitive domain added or removed Calculated MW (daltons) Apparent MW on SDS-PAGE (daltons)
Relative surface hydrophobicities were measured on the basis of elution time on RP-HPLC. Proteins were eluted through a C8 column with a linear gradient from 28% to 35 % acetonitrile containing trifluoroacetic acid.
3. RESULTS AND DISCUSSION Three different constructs with variable lengths of the repetitive domain were prepared and expressed in Escherichia coli.
The Dx5 HMW glutenin variants,
designated Dx5-R853, Dx5-R576 and Dx5-R441 , produced subunits with repetitive domains which are 22. 5 % longer, and 1 7 . 2 % and 36.6% shorter expressed subunit, respectively (Table 1 ) .
than the naturally
On SDS-PAGE the modified Dx5 glutenin subunits show the anomalously slower
migration typical of this class of proteins (Figure I). The anomalous migration seems
the repetitive region. The length of the has a negative correlation with the surface hydrophobicity of the
to be positively correlated with the size of repetitive domain
molecule, measured by RP-HPLC.
These constructs might be very useful to establish the role of the repetitive domain in determining the viscoelastic properties of dough because specific insertion and deletions are present in the same background . The evaluation of the effects that these modifications
might cause
on
gluten
is currently being
verified
in vitro by
micromixographic experiments7, and could be tested in vivo by expressing the Dx5
213
Wheat Protein Molecular Biology and Genetic Engineering
constructs in transgenic wheat plant... In addition, the Dx5 constructs could be used in basic physical studies of the polypeptide structure.
M
1
2
3
4
5
KOa 200 1 16-
97.466 -
45-
Figure 1 SDS-PAGE analysis of wild-type and modified Dx5 HMW-GS extracted from E. coli harbouring the pET-3a-Glu-1Dx5 plasmid constructs. 1) pET-3a; 2) Dx5-R853; 3) pET-3a-Dx5; 4) Dx5-R576; 5) Dx5-R441. M) Molecular weight standard (KDa) is reported on the left site of the picture.
The possibility to generate Dx5 HMW-GS modified in the repetitive domain demonstrates the capability of creating new genetic variability in the laboratory for this class of proteins. This approach, besides eliminating the need to search for natural variability of HMW-GS, offers the opportunity to generate variation at specific region or sites. This possibility makes it possible to test the proposed hypotheses about the influence of some structural features of HMW-GS on gluten characteristicS8•10 and to achieve more informations about the molecular structure of single HMW-GS, and their modification after the formation of the backbone of the polymeric structure of wheat gluten. While there is in fact a well documented correlation between breadmaking quality and the presence of specific HMW -GS3 little is known about the precise organisation of HMW-GS in glutenin polymer.
4. REFERENCES 1. 2.
P.l. Payne, K.G. Corfield, I.A. Blackman, Theor. Appl. Genet. , 1979, 55, 153. P.1. Payne, K.G. Corfield, L.M. Holt, I.A. Blackman, J. Sci. Food. Agric. , 1981, 32, 51.
Wheat Structure. Biochemistry and Functionality
214 3. 4. 5. 6. 7. 8. 9. 10.
P . I . Payne, Ann Rev Plant Physioi, 1987, 38, 141 . N. Shani, J.D. Steffen-Campbell, 0.0. Anderson, F.e. Greene and G. Galili, Plant Physiol. , 1992, 98, 433 F.W. Studier and B.A. Moffatt, J. Mol. Evol. , 1986, 189, 1 1 3 . J.L. Andrew and J.H. Skerritt, J. Cereal Sci. , 1994, 19, 2 1 9 . F. Bekes and J.H. Gras, Cereal Chem. 1992, 69, 229 J.A.D. Ewart, J. Sci. Food Agric., 1968, 19, 617. A. Graveland, P. Bosveld, W.J. Lichtendonk, J.P. Marseille, J.H.E. Moonen and A. Scheepstra, J. Cereal Sci. 1985, 3, I . D.O. Kasarda, 'Wheat is Unique', Y. Pomeranz Ed., AACC, St. Paul, MN, p. 277.
EXPRESSION OF BARLEY AND WHEAT PROlAMINS IN BIOPHYSICAL STUDIES
E.COLI FOR
JJA Greenfield!, L Tamas2, N.G. Halford!, D. Hickman!, S.B. Ross-Murphyl, S. Ingman4, AS. Tatham1 and P.R. Shewryl
lIACR-Long Ashton Research Station, Department of Agricultural Sciences, University of Bristol, Long Ashton, Bristol BS18 9AF, UK. 2CSIRO, Division of Plant Industry, GPO Box 1600, Canberra, ACI' 2601, Australia. 3Division of Life Sciences, Biopolymers Group, King's College London, Campden Hill Road, Kensington, London W8 7AH, UK. 4Unilever Research, Colworth Laboratory, Colworth House, Sharnbrook, Bedford MK44 1LQ, UK.
1
INTRODUCTION
Wheat gluten is a complex mixture of proteins, which are classically divided into gliadins and glutenins. 1 These groups can be readily prepared by solvent extraction and gel filtration chromatography, and the gliadins fractionated into their component types (a, p, y, c.» by anion-exchange chromatography. However, each of these fractions contains a mixture of individual proteins and it is difficult, and in many cases has not yet proved possible, to purify single homogeneous components. The glutenins can be similarly divided into high molecular weight (HMW) and low molecular weight (LMW) subunits, and the latter into B, C and D types.2.3 Once again it is difficult to purify single proteins, especially of the LMW types. Since a number of cloned cDNAs and genes for gluten proteins are available, expression in heterologous systems provides an attractive opportunity to prepare large amounts of single homogeneous proteins for biophysical studies. In addition it is possible to make specific mutations, in order to explore the relationship between protein structure and function (or, in the case of food proteins, functionality). We are therefore using protein engineering to study the structure and functionality of wheat gluten proteins, focusing on the c.>-type gliadins4 and the HMW 5 subunits of glutenin. However, clones encoding c.>-gliadins are not currently available and it has therefore been necessary to study a homologous protein from barley, called C hordein.6 C hordeins have similar amino acid compositions, N-terminal amino acid sequences" and conformations' (as demonstrated by circular dichroism spectroscopy) to the c.>-gliadins encoded by chromosomes 1A and 1D of bread wheat.
2
PROTEIN ENGINEERING OF C HORDEIN
The barley genomic clone Ahor1-17 encodes a protein of 261 residues, including a 20 residue signal peptide.8 The mature protein has an Mr of 28,033 and consists of 233 residues of repeated sequences (based on the consensus peptide Pro.Gln.Gln.Pro.Phe.Pro.Gln.Gln) flanked by non-rep�titive sequences of 12 and 6 residues at the N- and C-termini, respectively. These repeated sequences appear to form a loose s iral structure based on a mixture of poly-L-proline II structure and p reverse turns. ,10 The C hordeins and c.>-gliadins also lack cysteine residues. This
�
Wheat Structure, Biochemistry and Functionality
216
means that they are monomeric and, in the case of the w-gliadins, appear to contribute to gluten viscosity rather then elasticity. The coding region of this clone was mutated to replace the signal sequence with an ATG (Met) initiation codon and expressed in E.coli using the pETId vector system.n,12 In addition, a mutant form was also constructed and expressed, with cysteines substituted for serine and
threonine at positions 7 and 236, respectively, of the encoded protein. The protein was readily extracted from the pelleted cells with 70% (vIv) aqueous ethanol and precipitated by the addition of 2 volumes of 1.5M NaCI and standing at 4 " C. The yield after 3 hours of induction was in excess of 30 mgll of culture. Aliquots of the preparation were also purified further by RP-HPLC for detailed physico-chemical analysis. SDS-PAGE of the wild-type protein showed a single band migrating slightly slower than an Mr 30,000 marker protein. In contrast, the mutant cysteine-containing
protein was not clearly resolved in the non-reduced state, showing only a ladder of faint bands towards the top of the gel. These were replaced by a single band of similar Mr to the wild-type protein under reducing conditions, indicating that the mutant protein formed disulphide-bonded polymers either in the E.coli cells or during extraction and purification. The wild-type and mutant proteins appeared to be correctly folded as determined by comparison of their surface hydrophobicities (by RP-HPLC) and their secondary structure contents (by circular dichroism spectroscopy in 70% (vIv) ethanol) with those of a mixture of C hordeins prepared directly from barley. The mutant and wild-type C hordeins are being subjected to rheological analysis. Samples of 20-30 mg dry weight were hydrated to various levels ranging from 50 to 70% water and tested using a controlled strain rheometer. Preliminary results indicate that the mutant (polymeric) protein is more elastic than the wild-type as determined by comparing the 1/ * slopes of frequency sweeps. More detailed studies are currently in progress.
3
EXPRESSION OF AN HMW SUBUNIT REPEAT PEPTIDE
The HMW subunits of glutenin consist of between 627 and 827 residues, with Mr of 67,495 to 88,137.5 They have three clear domains, with an extensive central domain consisting of repeated sequences flanked by shorter non-repetitive domains at the N terminus (81-104 residues) and C-terminus (42 residues in all subunits). Variation in the length of the repetitive domain is, therefore, largely responsible for differences between the Mr of the whole proteins. Four, five or seven cysteine residues are present in the HMW subunits of bread wheat, with three or five in the N-terminal domain, one in the C-terminal domain and, in some subunits only, single cysteines within the repeats. These cysteines appear to allow the HMW subunits to form high Mr polymers which contribute to the elasticity of gluten and dough. The repetitive domains are based on short peptide sequences, with hexapeptides (consensus Pro.Gly.Gln.Gly.Gln.Gln), nonapeptides (consensus Gly.Tyr.Tyr.Pro.Thr.Ser.Pro or Leu. Gin. Gin) and, in x-type subunits only, tripeptides (Gly.GIn.GIn). As in C hordein these sequences also appear to form a loose spiral structure, which is based only on p-reverse turns and called a p-spiral.1>1S The p spiral could contribute to gluten functionality, either by being intrinsically elastic13 or by forming strong hydrogen bonds with adjacent proteins, facilitated by the high
217
Wheat Protein Molecular Biology and Genetic Engineering
content of glutamine residues (about 40 mol %). However, the complex multidomain structure of the HMW subunits makes it difficult to carry out detailed studies of the structure and functional properties of the J3-spiral structure. In order to eliminate this problem we have subcloned a genomic fragment from the subunit IDx5 gene, encoding a peptide of Mr about 57,000 from the central repetitive domain of the protein (Figure 1). In addition, a mutant form has been constructed encoding a protein with cysteine residues added close to the N- and C-termini (Figure 1).
89
I
NH 2
SH S.r;� S�
103
M r 88,128
REPEATS
M r 56,894
106 G or e
Figure 1
785
I 643
827 I
eOOH
SH
640 Yor e
Schematic structure of HMW subunit lDx5 and of the Repetitive Fragment Expressed in E.coli
The wild-type and mutant proteins were expressed in E.coli using the pETI7b vector systemll and purified by extraction with 70% (v/v) ethanol followed by precipitation with ammonium sulphate. The wild-type protein has also been subjected to detailed spectroscopic analysis, using circular dichroism, fluorescence and Fourier-transform infra-red spectroscopy. This has confirmed the presence of a J3-turn-rich conformation, which was previously proposed on the basis of structure prediction, 13 and the analysis of short synthetic peptides based on the nonapeptide and hexapeptide repeat motifs.14 Future plans include more detailed spectroscopic analyses, and rheological comparisons of the wild-type and cross-linked forms. Further mutants will then be constructed in which the number and distribution of cysteine residues is altered to affect cross-linked formation, while the length and precise sequence of the repetitive domain are altered to affect the extent and properties (including hydrogen bonding capacity) of the J3-spiral structure. These studies will provide details of the precise structures of the HMW subunits and the molecular basis for their role in gluten.
Acknowledgement IACR receives grant-aided support from the Biotechnology and Biological Sciences Research Council of the United Kingdom.
Wheat Structure, Biochemistry and Functionality
218
References 1.
D.O. Kasarda, J.E. Bernardin and C.C. Nimmo, 'Advances in Cereal Science Ed. Y. Pomeranz. American Association of Cereal and Technology' Chemists, St. Paul, Minnesota, 1976, 1, p.158.
2. 3. 4.
P.I. Payne and K.G. Corfield, Planta 1979, 145, 83. E.A Jackson, LM. Holt and P.I. Payne, Theor. AppL Genet.
5. 6.
1983, 66, 29.
D.O. Kasarda, J.-c. Autran, E.J.-L Lew, C.C. Nimmo, and P.R Shewry,
Biochim Biophys. Acta 1983, 747, 138.
P.R Shewry, N.G. Halford and AS. Tatham, 1 Cer. Sci. 1992, 15, 105. P.R Shewry, 'Barley: Chemistry and Technology' Eds. J. MacGregor, and R Bhatty. American Association of Cereal Chemists, St. Paul, Minnesota, U.SA
1993, p.131.
8.
AS. Tatham, P.R Shewry and P.S. Belton, 'Advances in Cereal Science and Technology'. Ed. Y. Pomeranz. American Association of Cereal Chemists, St. Paul, Minnesota, U.S.A 1990, 10, p.1. J. Entwistle, S. Knudsen, M. Milller and V. Cameron-Mills, PL MoL BioL 1991,
9. 10.
AS. Tatham, AF. Drake and P.R Shewry, Biochem 1 1989, 259, 471. K.J. I'Anson, VJ. Morris, P.R Shewry and AS. Tatham, Biochem 1. 1992, 287,
11.
AH. Rosenberg, B.N. Lade, D.-S. Chui, S.W. Lin, J.J. Dunn and F.W. Studier,
7.
12. 13. 14. 15.
17, 1217. 183.
Gene 56, 125. L Tamas, J. Greenfield, N.G. Halford, AS. Tatham and P.R Shewry, Protein Expression and Purification 1994, 5, 357. AS. Tatham, P.R Shewry and B.J. Miflin, FEBS Letts. 1984, 177, 205. AS. Tatham, AF. Drake and P..R Shewry, 1 Cer. Sci. 1990, 11, 189. MJ. Miles, HJ. Carr, T. McMaster, P.S. Belton, VJ. Morris, J.M. Field, P.R Shewry and AS. Tatham, Proc. Natn. Acad. Sci. U.S.A. 1991, 88, 68.
Low Mr Sulphydryl Compounds in Wheat Flour and Their Functional Importance
MEASUREMENT AND REACTIVITY OF GLUTATHIONE IN WHEAT FLOUR AND DOUGH SYSTEMS
1. D. Schofield and X. Chen The University of Reading Department of Food Science and Technology P. O. Box 226, Whiteknights Reading RG6 6AP United Kingdom
1 INTRODUCTION The importance to dough processing performance (processability) and baked product quality of the reduction-oxidation (redox) reactions that occur in wheat flour and dough ) has long been recognised . The (bio)chemistry of those reactions, on the other hand, is still poorly understood, and their technological manipUlation, including the use of exogenous oxidising bread improvers, such as potassium bromate, azodicarbonamide and ascorbic acid (after oxidation to dehydroascorbic acid), or reducing agents used in biscuit making, such as sodium metabisulphite, is based largely on empiricism. The lack of a satisfactory knowledge base concerning the nature of these reactions restricts the development of new, more effective and more consumer-acceptable technology for modulating them than that presently available. The withdrawal in EU countries of traditionally used oxidising improvers for use in bread making on toxicological grounds, especially of potassium bromate, leaves processors dependent on ascorbic acid as sole bread improver. Ascorbic acid performs less well than bromate, however, highlighting the need for alternative technologies. Consumer and media pressure may also make the use of other presently-allowed redox additives, whether toxicologically safe or not, problematical in the long-term. Moreover, although variation is known to occur in oxidant requirements for bread making from one flour to another, the basis of this, whether genetic, agronomic or processing related, is largely unknown. Such variation is also difficult to assess and measure efficiently so as to control raw material inputs, and hence processability and product quality. Definition of the reactions/reactants that are important could form the basis for developing new analytical methods that might provide users of grain and flour with the means of monitoring and controlling raw material quality more precisely. Similarly, defining the important reactions/reactants and the mechanism(s) by which variation in them is controlled, together with the provision of appropriate analytical methodology, could be of value to plant breeders in selecting for appropriate genetically controlled redox characteristics and developing new cultivars with improved end-use properties.
1.1
The Technological Importance of Glutathione
Particular attention has been focused on the role of the tripeptide glutathione (y-g1utamylcysteinylglycine), which occurs endogenously in flour in both free reduced 2s (GSH) and free oxidised GSSG) forms - , as well as in the form of protein-glutathione mixed disulphides (pSSG) ,6" . GSH is able to react with inter-polypeptide chain disulphide bonds (PSSP) in glutenin during dough mixing through sulphydryl-disulphide (SHlSS)
{
Wheat Structure, Biochemistry and Functionality
222
interchange reactions8, resulting in the formation of a PSSG and a free protein SH gouP (pSH). Glutenin may thus be depolymerised, resulting in a weakening of the dough3,9' I. If such reactions are indeed significant in dough systems, flours with high levels of GSH, or similar peptides, would presumably be desirable for biscuit making, specifically for semi sweet or hard sweet biscuits, which require weak dough structure with minimal elastic recoil after sheeting. Such a dough weakening is effected currently by adding fairly high levels of the SS reducing agent, sodium metabisulphite. On the other hand, low GSH levels would be desirable in bread flours since a strong elastic dough is required that can retain the gas produced during yeast fermentation as discrete small gas celIs. Consistent with this notion, it has been observed that dough rheological properties are inversely correlated with the GSH contents of flours milIed from wheat cultivars that differ in bread making qualityI2.ls. It has also been proposed that oxidising improvers used as in�redients in bread making .16, exert their effects by causing the oxidation of GSH to GSSG4,I thus preventing GSH from participating in reactions involving cleavage ofPSSP, which would otherwise weaken the dough and cause bread quality to diminish. In the case of ascorbic acid, this reaction is thought to be catalysed by the endogenous flour enzyme, glutathione dehydrogenase (also called dehydroascorbate reductase). The oxidising improver reaction can therefore be considered as competing with the disulphide bond cleavage reaction for the available GSH. Thus protein depolymerisation and dough weakening are prevented:
:::
P
�
GSH
GSH
OXidiSi Impro
S Interchange PSSG
:>1r
GSH
:��s
PSH
�
GSSG
In fact, GSSG is also able to react with flour PSH via SH/SS interchange reactions, resulting in the formation ofPSSG and GSW7: GSSG
PSH
SH/SS Interchange PSSG
GSH
This reaction does not result directly in the scission of flour PSSP. Addition of GSSG during dough mixing does result in dough weakening, however3,Io This can be explained on the basis that the released GSH can undergo further SH/SS interchange reactions with flour PSSP. However, the naturally occurring levels of GSSG in flour-water doughs are thought to be relatively low, and such low levels may not have any significant effect on dough rheologyu It could be, however, that the role of oxidising improvers is not simply to convert GSH to GSSG in a 'one-off' reaction, but that they must continue to oxidise GSH to GSSG until all available PSH groups are blocked and further release of GSH via reaction of GSSG with PSH is prevented.
2 MEASUREMENT OF GLUTATHIONE IN FLOUR AND DOUGH SYSTEMS 2.1
Establishment of Methodology for Measuring GSH, GSSG and PSSG
Notwithstanding the research summarised above, the technological significance of sulphydryl peptides, and in particular that of glutathione and its reactions, remains extremely unclear. A major problem has been uncertainty about the true levels of
Low Mr
Sulphydryl Compounds in Wheat Flour and Their Functional Importance
223
glutathione in flour, since values reported in the literature vary by several orders of magnitude,, 14. This is almost certainly due to methodological problems in measuring the compound in flour. Furthermore, a convenient and reliable method for measuring not only GSH itself, but also GSSG and PSSG, has not been available making it difficult to obtain a complete picture of the reactions that glutathione undergoes in flour and dough. Without the ability to measure GSH, GSSG and PSSG discretely, definitive conclusions cannot be drawn about the reactions of GSH in flour and dough and their significance. The recent establishment in our laboratory of a relatively rapid, straightforward, sensitive and accurate HPLC technique for measuring directly the contents of GSH, GSSG and PSSG individually in flour and dough,,1 represents an important methodolo§ical breakthrough. The method is based on that described by Reed and co-workers . It involves initial extraction of GSH and GSSG with ice cold 5% (w/v) perchloric acid (PCA). The use of PCA as extractant has several advantages. Firstly, because PCA is a strong acid, the low « 1 .0) pH during extraction suppresses the ionisation of the SH groups both on GSH and on flour proteins. This prevents SHISS interchange reactions and the consequent loss of free GSH and/or free GSSG through the formation of PSSG, which may occur when extracting under neutral or slightly alkaline conditions. This may have compromised the analyses in some previous studies. PCA is also a strong chaotrope, which ensures efficient extraction of the peptides and minimises their entrapment by or adsorption onto the flour proteins. Lastly, PCA is an efficient protein precipitant, which results in a convenient separation of GSH and GSSG from the flour proteins, and minimises any interference by proteins in later stages of the procedure. It also precludes the need to include a time consuming chromatographic or other type of protein separation steps in the clean-up procedure. After extraction with PCA, free SH groups on GSH molecules and any other SH compounds extracted are blocked by alkylation with iodoacetic acid (lAA) at pH 8.0. It is important that the lAA is immediately available to react with the SH groups when the pH of the extract is raised from pH<1.0 to pH 8.0, and, thus, the lAA is added to the PCA extract before the pH is adjusted. The extraction and derivatisation steps up to this point are carried out under nitrogen in order to prevent air oxidation of SH compounds to SS compounds. Finally, the free amino groups on GSH, GSSG and any other amino acids or peptides in the extract are blocked by dinitrophenylation with fluorodinitrobenzene (FDNB). The yellow DNP derivatives are then separated by HPLC on an amino bonded phase silica column and they are detected and quantified by their absorbances at 365 nm. For determination of PSSG, the pellet after PCA extraction is suspended in a buffer at pH 8.5, and the suspension is incubated in the presence of the reducing agent, dithiothreitol (OTT), which reduces any disulphide bonds and releases glutathione and any other SH compounds present in the form of protein mixed disulphides. The protein and the released GSH and any other SH compounds are then separated by addition of ice cold 5% (w/v) PCA, which precipitates the protein and leaves the GSH in solution. The released GSH and any other SH compounds in the PCA solution are then derivatised and quantified as for the free GSH and GSSG. The methodology we have established, which has been rigorously optimised, provides a powerful tool for determining the levels of these compounds in different flours and the factors that affect them, the reactions that they undergo during flour and dough processing, and relationships between these compounds and their reactions and raw material quality, in terms of both processability and baked product quality. Research, in which this methodology has been applied, has served to emphasise that the picture we have of the variation in the levels of the different forms of glutathione that are present in flour, its significance, and the reactions those compounds undergo, both in dry flour and doughlbatter is quite inadequate. 2.2
GSH, GSSG and PSSG Levels in Flour
Once established and optimised, the analytical procedure was applied to determine the GSH, GSSG and PSSG contents of 'straight-run' Brabender Quadrumat Junior-milled
Wheat Structure, Biochemistry and Functionality
224
white flours from a set of single samples of grain of UK-grown wheat cultivars representing a range of baking potentials ,7. The flours used in these experiments were analysed immediately after milling. Considerable variation was noted in the GSH, GSSG and PSSG contents (Table 1 ). The GSH values ranged from 1 8 to 8 1 nmol/g of flour, those for GSSG from 1 2 to 27 nmol/g flour, and those for PSSG from 70 to 1 50 nmol/g flour for the eleven cultivars examined. No relationship was discernible between the GSH or GSSG contents of the flours and bread making performance. However, flours from cultivars of good bread making quality (Bread Making Values of A and B) generally had higher PSSG contents than those from cultivars of poorer bread making quality (Bread Making Values of C and D). The poor bread making cultivar Riband was a clear exception, however, the PSSG value for this cultivar being the same as that for the very strong gluten cultivar Fresco. Analysis of bran and shorts (containing mainly germ) fractions obtained by milling grain on a BOhler experimental mill showed that bran contained 496 nmol/g of GSH and 356 nmol/g GSSG, while shorts contained 443 nmol/g GSH and 1 1 2 nmol/g GSSG. Experiments with fractions derived by pearling successive layers from the outside of the grain also suggested that gradients of GSH and GSSG contents exist with low values at the centre of the endosperm and high values towards the outside (results not shown). These results may have implications for the causes of the poor bread making quality of high extraction flours and wholemeals. Table 1
GSH, GSSG and PSSG Contents' of Freshly-Milled White Flours from UK-Grown Wheats
Cultivar
GSH
GSSG
PSSG
b Total Free Glutathione
Fresco
3 1a
24a
131a
79
b Total
Flour Glutathione
Bread Making Value
210
C
Hereward
62b
22b
1 50b
1 06
256
B
Mercia
74c
27c
102de
1 28
230
B
Pastiche
45d
1 8dg
1 00e
81
181
B
Avalon
75c
1 3ei
1 08d
101
209
B
Norman
74c
1 5eh
73f
1 04
177
C
Galahad
81e
1 7dh
70f
1 15
1 85
D
Tara
47d
1 2fi
73f
71
1 44
D D
Riband
64b
1 9b9
1 3 1a
1 02
233
Beaver
56f
1 9b9
72f
94
1 66
D
Haven
1 8g
20bg
89g
58
1 47
D
'Values are in nmol/g flour. bTotal Free Glutathione (GSH plus GSSG) and Total Flour Glutathione (GSH plus GSSG plus PSSG) are given as GSH equivalents cA and B, Bread wheats; C and D, BiscuitlFeed wheats. The best bread wheats are given a value of A and the poorest D. Fresco is a cultivar with very strong gluten characteristics. Values within columns that are followed by the same letter are not significantly different (P< 0.05).
Low Mr Sulphydryl Compounds in Wheat Flour and Their Functional Importance
2.3
225
PSSG Levels in Flour Protein Fractions
Considerable differences were observed between the PSSG contents of the different protein fractions extracted from cultivar Mercia flour by the Osborne fractionation procedure. PSSG values (expressed on a nmoVg protein basis) were highest in the residue (comprising mainly glutenin protein) and albumin fractions (897 and 796 nmoVg protein, resp.) and lowest in the gliadin fraction (76 nmoVg protein). The globulin fraction had an intermediate value (239 nmoVg protein). These results, in particular those for the globulin and gliadin fractions, are similar to those reported previously4 for protein fractions. Two SDS-unextractable glutenin macropolymer ('gel protein') preparations were also examined. The PSSG value for the glutenin macropolymer from cultivar Glenlea, a very strong gluten Canadian cultivar, was 1,062 nmoVg protein, whereas that from cultivar Bussard, a weak: gluten French cultivar, was 1,538 nmoVg protein. Although glutathione was the major component present in the chromatograms of the components released by reduction with DTT, substantial amounts of other components were also found to be present. Since these components also contained one or more amino groups that could be blocked by dinitrophenylation with FDNB, they are presumably cysteine-containing peptides and cysteine itself, which are also present in the form of mixed disulphides with the flour protein. One of these components did, in fact, co chromatograph with cysteine, but the other components in the chromatograms have not yet been identified. Both glutathione and cysteine in the form of mixed disulphides were also detected in glutenin by Ewart6. He referred to glutathione and cysteine in such a form as 'end blockers' to indicate that he considered that they might have a role in blocking sites for further polymerisation of glutenin through disulphide bond formation. The highest PSSG content in the different flour protein fractions obtained by a modified Osborne fractionation procedure was observed for the residue fraction containing mainly glutenin. This is of interest and potential importance since variation in bread making quality amongst wheat cultivars is known to be due to differences in the properties of this fraction20. In contrast, much lower values were observed for the gliadin fraction. It is well known that the Osborne fractionation procedure does not achieve a complete separation of the different protein classes in wheat flour and, in particular, that 70% (v/v) ethanol is capable of extracting from wheat flour substantial amounts of small glutenin polymers enriched in low M, subunits of glutenin21.23. Therefore, even the low gliadin PSSG content observed here could be an over-estimate if, as seems likely, some of the PSSG detected in the gliadin fraction is associated with small glutenin polymers. It may be, in fact, that gliadin contains no PSSG, and this would be consistent with the view that disulphide bonds in gliadin are all intramolecular.
2.4
GSH, GSSG and PSSG in Stored Flour and Relationship to Bread Making Performance
Improvements in the bread making performance of wheat flour during short-term storage have been reported by a number of researchers24.27. The use of oxidising improvers in bread making is intended to simulate these improving effects of flour ageing. Despite the potential importance of short-term changes in the bread making quality of flour on storage, the (bio)chemistry of this effect has not been explained. During the course of establishing HPLC methodology for measuring GSH, GSSG and PSSG individually in flour, we noticed that the GSH and GSSG contents of white flour that had been stored at 4°C for 90 days prior to analysis were much lower than those of freshly milled flours,28. Sarwin and co-workers 4 have also made similar observations with regard to the GSH contents of stored and freshly milled flours. The precise kinetics of the changes in flour GSH and GSSG contents, and the relationship of the changes, if any, to possible changes in bread making performance were not determined, however, in either our preliminary work or in that of Sarwin and co-workers 4, and neither were the effects of storage on PSSG contents. Rheological analysis (extension testing) of doughs to which
Wheat Structure, Biochemistry and Functionality
226
GSH had been added tends to indicate, however, that loss of GSH would be likely to increase dough strength and perhaps bread making performance 18 . In the light of these preliminary observations, a flour storage experiment was conducted in which changes in GSH, GSSG and PSSG contents of white flour milled from grain of the cultivar Mercia were monitored as a function of storage time. The content of GSH fell to 57% of the initial value for the freshly milled flour during the first ten days of storage at 20°C from 1 49 to 85 nmoVg flour. It then remained essentially constant up to 40 days of storage (Fig. l a). The decrease in the GSH content was not accompanied by an increase in the GSSG content, however. The GSSG content of the flour also decreased, in this case to 28% of the initial value for the freshly milled flour, over the same ten day storage period from 6 1 to 1 7 nmoVg flour (Fig. l a). Neither was the decrease in the GSH content accounted for by an increase in the content of PSSG. The PSSG content also fell during the initial ten day storage period, in this case to 86% of the initial value for the freshly milled flour, from 99 to 85 nmoVg flour, and again stayed essentially constant thereafter (Fig. l a). The fall in GSH levels could not be accounted for, therefore, in terms of either oxidation to GSSG or linkage to flour protein via disulphide bonds since glutathione levels in these two pools also showed patterns of changes similar to that ofGSH (Fig l a).
1 500
1 60 'i:'
8 !+=
(b)
1 40 1 400
� 1 20
�
'-'"
'5
1 00
C!:l til til �
80
= 0 u
.... 0
C!:l til til C!:l
:t
til C!:l
0
,-..
:§, 1300 cu
E ..2 0
>
't; 1 200 0
60
...:I
40 1 100 20 1 000
0 0
10
20
30
Storage Time (d) Figure 1
40
0
10
20
30
40
Storage Time (d)
Changes during storage at room temperature in the GSH, GSSG and PSSG contents and in bread making performance in the Chorleywood Bread Process (CBP) ofwhite j10ur milledfrom the hard winter bread wheat cultivar Mercia: (a) changes inj10ur GSH (0), GSSG (0) and PSSG (A) contents; (b) changes in bread making performance as indicated by loaf volume
Low M, Sulphydryl Compounds in Wheat Flour and Their Functional Importance
227
The bread making performance of the cultivar Mercia flour was also monitored using the Chorleywood Bread Process. The results indicated that the bread making performance of the flour improved substantially during the initial ten days of storage and then remained essentially constant thereafter (Fig. I b). Thus, a substantial improvement in bread making performance occurred concomitantly with substantial decreases in the flour contents of GSH, GSSG and PSSG. The changes in the contents of the three glutathione pools were therefore related very closely, in a temporal sense, to the improvement in bread making performance, although the results do not prove a causal relationship between the two. Decreases were observed previously in flour GSH contents on storage for 60 days at 4 room temperature , but the decreases were not of such great magnitude as observed here � or in our preliminary observations . The reasons why the changes in GSH, GSSG and PSSG contents occurred to different extents in our experiments and in GSH contents are not known, but a contributory factor may be the use of different wheat cultivars. A decrease in the GSH content of flour was also noted during storage at 4°C29. The fall in GSH levels could not be accounted for in terms of either oxidation to GSSG, as suggested previously29, or linkage to flour protein via disulphide bonds since the GSSG and PSSG contents of the flour also fell during the initial ten day storage period and then remained essentially constant up to 40 days. The fate of glutathione in each of these pools is unclear. The finding that milling grain under nitrogen gave rise to flour GSH contents that were about 50% higher than when grain was milled in air4 suggests that reactions involving molecular oxygen are of importance in relation to flour glutathione contents. 2.5
Effects of Mixing on GSB, GSSG and PSSG Levels in Simple Flour-Water Doughs
Dough mixing is the first and most critical step in bread making: it influences dough processing performance, and has important effects on bread quality30. Redox reactions involving gluten protein SH groups and SS bonds, which have an effect on the polymeric structure of the glutenin protein fraction, are generalIy considered important in relation to dough rheological properties and bread making performance1, 14. Therefore, we studied the reactions of GSH, GSSG and PSSG during dough mixing in the Chorleywood Bread Process, in which the optimum work input is around 40 kJ/kg of dough. GSH, GSSG and PSSG levels were measured first for simple flour-water doughs made from cultivar Mercia flour as a function of work input (Fig. 2). The level of GSH decreased rapidly during initial low speed mixing from 60 to 24 nmoVg and decreased further to 14 nmoVg after mixing at high speed to a work input of 1 3 . 3 kJ/kg. Thereafter, there was a slower steady decline in GSH levels to 2.7 nmoVg for overrnixed dough (66.7 kJ/kg) (Fig. 2). In contrast, the GSSG level increased during low speed mixing from 22 to 3 1 nmoVg flour and again to 32 nmoVg at a work input of 1 3 . 3 kJ/kg. Thereafter, the GSSG level also declined steadily to 24 nmoVg after a work input of 66.7 kJ/kg (Fig. 2). Although the GSSG level increased at the beginning of dough mixing as the GSH level fell, only about 60% of the GSH decrease was accounted for by the increase in GSSG. Total free glutathione (GSH plus 2 x GSSG) levels decreased throughout mixing (Fig. 2). The remainder of the initial decrease in GSH level and the subsequent steady declines in both GSH and GSSG levels were accounted for by formation ofPSSG (Fig. 2). Formation of PSSG lagged behind that of GSSG such that only a small increase occurred in the first 1 00 s mixing at low speed compared with the flour PSSG content of 78 nmoVg. There was then a large increase in dough PSSG content to 1 05 nmoVg after mixing to a work input of 1 3 .3 kJ/kg and a slower increase thereafter to 123 nmoVg flour in the overrnixed dough. The total glutathione levels (GSH plus 2 x GSSG plus PSSG) remained essentially constant throughout the period of dough mixing (Fig. 2). 2.6
Contribution of Yeast to Measured Glutathione Levels in Dough
GSH and GSSG levels of yeasted doughs were about 4.3 times and 1 . 8 times, respectively, higher than those of flour-water doughs after low speed mixing, with the total
228
Wheat Structure, Biochemistry and Functionality
200 1 80 .-...
� 0
E
'-'
C!:l V) V) ,:l.; .... 0
C!:l V) V) C!:l
::d'
1 60 1 40 120 1 00
V) C!:l
80
= II) =
60
..... 0 0
u
40 20 0 0
10
20
30
40
50
60
70
Work Input (kJ/kg) Figure 2
Changes in GSH (0), GSSG (0), PSSG (tl), totalfree glutathione (GSH plus GSSG) (0) and total glutathione (GSH plus GSSG plus PSSG) (V) during mixing of cv. Mercia flour-water dough. Total free and total glutathione values are expressed as GSH equivalents. Points at zero and 3 k.f/kg work input are forflour and dough mixed at low speedfor 100s, respectively: those at 13. 3, 26. 7, 40.0, 66. 7 k.f/kg are for dough mixed at high speed
free glutathione level of yeasted dough being over twice that in flour-water dough (Fig 3a and b. The analytical procedure used apparently measures GSH and GSSG in whole dough and does not distinguish between that derived from the flour and that derived from yeast. To investigate whether glutathione contributed by yeast was available to react with flour proteins, two doughs were prepared, one with and one without yeast. After mixing to a work input of 40 kJ/kg, doughs were centrifuged at 1 05,000 g for 70 min to separate the dough aqueous phase (dough liquor) from the solid phase, including yeast cells. Measurement of the GSH and GSSG levels in dough aqueous phases showed that the GSH and GSSG contents were 20 and 23 nmoVg dough, respectively, for flour-water dough, and 28 and 22 nmoVg dough, respectively, for yeasted dough. Although the GSH level was somewhat higher for the yeasted dough than for the flour-water dough, total free glutathione in the supernatant from yeasted dough (73 nmoVg dough) was about the same as that from flour-water dough (66 nmoVg dough). Analysis of glutathione present in the supernatants indicated, therefore, that there was relatively little difference between the
Low Mr Sulphydryl Compounds in Wheat Flour and Their Functional Importance
229
1 50 (a)
1 00
10
50
"0 ...
0
3
0 0:=
�
�
'-'
C!:) til til �
1 50 (b) 1 00
...
0 C!:) til til C!:)
::d'
til C!:) ..... 0
50
200
1:
0 U
�
�
5
�
1 50
IS.
1 00
(c)
50 0
10
20
30
40
50
60
70
Work Input (kJ/kg)
Figure 3
Changes in GSH (a), GSSG (b) andPSSG (c) during mixing unyeasted (O), yeasted (O), ascorbic acid (l!.) and potassium bromate (O), doughs (ev. Mercia). Doughs described as unyeasted and yeasted were .flour-water doughs. Ascorbic acid and potassium bromate doughs were complete yeasted doughs. Points at zero and 3 k.!/kg work input are for .flour and dough mixed at low speed for 100s, respectively; those at 13. 3, 26. 7, 40. 0, 66. 7 k.!/kg for dough mixed at high speed.
230
Wheat Structure, Biochemistry and Functionality
GSH and GSSG levels of both doughs. Most GSH and GSSG contributed by the yeast to total dough values does not appear to be free in the dough aqueous phase and is presumably retained within yeast cells. Although there appeared to be decreases in both GSH and GSSG levels in yeasted dough during dough mixing, the changes, particularly that for GSSG, were somewhat less than for flour-water dough (Fig. 3a and b). There was no significant difference in PSSG levels, however, between flour-water dough and yeasted dough during dough mixing (Fig. 3c), which suggests that yeast makes little contribution to PSSG levels in dough and also appears to confirm that little if any of the GSH and GSSG contributed by yeast is free to react with flour proteins and thus to affect dough rheological properties. GSH and GSSG derived from flour itself were confirmed as being present in the dough aqueous phase, however, (see above) and were able to react with flour proteins as indicated by the increase in PSSG that occurred as dough mixing proceeded (Fig. 3c). 2.7
Effects of Oxidising Improvers on Changes in GSH, GSSG and PSSG During Dough Mixing
To determine the effects of oxidants on changes in glutathione during dough mixing, experiments were conducted with yeasted cultivar Mercia doughs with additions of ascorbic acid or potassium bromate Fig. 3). As noted above, yeasted doughs (including oxidant doughs) had higher levels of total glutathione (GSH plus GSSG plus PSSG) than flour-water doughs. In the initial mixing stage, yeasted dough without oxidants had a much higher level of GSH than that of simple flour-water dough reflecting the contribution of yeast to the dough GSH value. Addition of ascorbic acid caused a very large and rapid decrease in the GSH content of dough (Fig 3a). The fact that the GSH content felI to a level similar to that observed for simple flour-water dough means that GSH contributed by yeast is just as accessible to the ascorbic acid redox system as flour GSH. This suggests that dehydroascorbate formed in dough by the action of ascorbic acid oxidase, as welI as in non-enzymic oxidation reactions, may be able to enter yeast celIs causing oxidation of the intracelIular yeast GSH to GSSG, itself being reduced to ascorbate. As the GSH content felI in the ascorbic acid dough, there was a large increase in dough GSSG content (Fig. 3b). The magnitude of the fall in the dough GSH content was about 90 nmoVg. The initial increase in GSSG content was about 3 7 nmoVg and the increase in PSSG about 20 nmoVg. Most GSH in the ascorbic acid dough was apparently oxidised to GSSG initially. The remaining GSH may have been involved in SHiSS interchange reactions with flour protein SS bonds during dough mixing to form PSSG. An alternative possibility is that the increase in PSSG in the ascorbic acid treated dough could have occurred through reaction of protein SH groups with GSSG formed by the oxidation of GSH since this oxidation reaction occurred very rapidly in ascorbic acid treated dough. Upon further mixing, the GSH content of ascorbic acid treated dough stayed fairly constant at low levels (Fig. 3a). After its rapid increase, the GSSG content decreased substantially (from 95 nmoVg to 58 nmoVg) during high speed mixing to a work input of 40.0 kJ/kg, then remained constant up to a work input of 66. 7 kJ/kg (Fig. 3b). In contrast, large increases in the PSSG content of the ascorbic acid treated dough occurred on initially wetting the flour and even greater changes occurred during high speed mixing to the CBP optimum work input of 40 kJ/kg. Values after 1 00s of low speed mixing and after mixing to 40 kJ/kg were 1 24 and 1 75 nmoVg, respectively. Values then remained constant up to a work input of 66.7 kJ/kg (Fig. 3c). The technological significance of the observation that PSSG levels reached a plateau at the optimum level of work input for CBP doughs is not known, but it is tempting to speculate about whether or not the two are linked. In general, these observations indicate that substantial amounts of GSSG reacted with protein SH groups to form PSSG during mixing and that the reactions of glutathione in dough may be more complex than envisaged previously. . L-ascorbic acid is said to be capable of sustained action through most of the dough l processing phase . Our results do not seem to be compatible with this view since most of the GSH is removed in ascorbate treated doughs at an early stage of mixing. Furthermore,
Low M, Sulphydryl Compounds in Wheat Flour and Their Functional Importance
231
CBP doughs are rapidly depleted of O2 during mixing3', and it is known that ascorbic acid is ineffective as an improver in the CBP if O2 is excluded during mixing32 . The available evidence suggest, therefore, that ascorbic acid acts very rapidly during the early stages of mixing until all available O2 in the dough is used up. The pattern of changes in GSH, GSSG and PSSG in potassium bromate treated dough were generally similar to those in ascorbic acid treated dough, although the decrease in GSH content and the increase in PSSG content occurred to substantially smaller extents (Fig. 3). The GSSG contents of bromate and ascorbate treated doughs were virtually identical during the first half of the mixing period, even though the fall in GSH level and the increase in PSSG level occurred to lower extents in bromate treated than in ascorbate treated dough. Whether or not the observation that bromate was less effective in lowering the GSH levels in yeasted dough indicates that bromate is unable to gain access to GSH within yeast cells is not known. Potassium bromate is considered to be a slow acting oxidant, which causes a more extended oxidation of the dough into the fermentation stage and in the early stages ofbaking'. Production ofGSSG in bromate treated dough occurred just as rapidly and to as great an extent as in ascorbic acid treated dough, however. Overall, the observations are consistent with the suggestion'� that oxidation of GSH to GSSG during dough mixing is more rapid than sross interchange reactions, e.g. between protein SH groups and GSSG or between protein SS bonds and GSH. Indeed, for simple flour-water doughs, it was possible to observe a lag between formation of GSSG as a result of oxidation and formation of PSSG, which may have been due to reaction of GSH with protein SS bonds and/or to reaction of GSSG with protein SH groups and/or to direct oxidation of SH groups in proteins and that in GSH. PSSG levels in oxidant treated doughs were much greater than in simple flour-water doughs or yeasted flour-water doughs. It is not known whether all the PSSG in oxidant treated doughs is derived from flour protein or whether some might be contributed by yeast protein. Ascorbic acid, in particular, accentuated formation ofPSSG, which occurred to a very substantial degree after the initial stages of mixing and as dough was being mixed to the optimum level of work input for the CBP (40 kJ/kg). Whereas bromate caused increases in GSSG levels similar to those caused by ascorbic acid, the increase in PSSG levels was greater with ascorbate. Whether or not this indicates the possibility of direct oxidation by dehydroascorbate of protein SH groups and those in GSH is unknown. The improver reaction of ascorbic acid is generally thought to involve the enzyme glutathione dehydrogenase'4. It seems unlikely that it participates directly in reactions involving protein SH groups. Formation of PSSG may also occur through sross interchange reactions involving GSH and protein SS bonds or protein SH groups and GSSG. The protein sroGSSG reaction appears to be important during high speed mixing. Since the decrease in total free glutathione levels (GSH plus GSSG) was similar to the increase in PSSG levels, the fall in free glutathione levels could be accounted for in terms of linkage to flour protein via SS bonds. The finding that treatment of dough with ascorbic acid or potassium bromate did not result in any loss of total glutathione (GSH plus GSSG plus PSSG) indicates that reactions promoted by these oxidants are simple oxidation reactions (SH groups being oxidised to SS bonds) and sross interchange reactions. It appears unlikely that any significant oxidation of the different forms of glutathione to higher oxidation states occurs as has been observed in simple model systems containing GSH and GSSG and oxidants, such as bromate33. The reactions that oxidants promote during dough mixing also appear to be different from those during flour ageing, the effects of which oxidants used in bread making are meant to simulate. As noted above, in the case of stored flours, GSH, GSSG and PSSG levels all fell during a 1 0 day period indicating that simple oxidation of GSH to GSSG or the interaction of GSH with flour proteins via sross interchange reactions could not account for the improvement in bread making performance that occurred over the same 1 0 day period. In the simple flour-water dough mixing experiment, loss of total free glutathione (GSH plus GSSG) was about 40 nmoVg when dough was mixed to the CBP work input optimum (40 kJ/kg). Assuming the average total amount of SS bonds in flour protein is about 1 0 /lmoVg o f flour34 and all the decrease in free glutathione was involved i n cleaving S S
232
Wheat Structure. Biochemistry and Functionality
bonds in flour protein, it can be estimated that about 0.4% of gluten SS bonds were broken by glutathione during flour-water dough mixing. This is likely to be a considerable over estimate because most PSSG formation appears to be due to SWSS interchange between protein SH groups and GSSG, which does not lead directly to protein SS bond cleavage. Thus, whilst only a very small proportion of total flour SS groups are likely to be affected, it should be noted that cleavage of only one SS bond in a lawe polymer, such as glutenin, has very large effects on physical properties such as viscosity . There is considerable evidence that gluten protein depolymerisation occurs in doughs during mixing36-40, and cleavage of SS bonds by GSH may be one of the most important mechanisms Although such depolymerisation is often viewed as having adverse effects, it has been proposed that such reactions may be beneficial in terms of allowing ' molecular slippage' so that protein-protein interactions can be optimised during dough mixing or that stresses induced by mixing can relax8•41. As mentioned above only about 0.4 % at most of the protein SS bonds in flour may be involved in SWSS interchange reactions leading to SS bond cleavage during dough mixing. It may be that a certain few SS bonds are crucial to dough integrity and are more vulnerable to attack by reducing agents than others. SS bonds in residue or gel proteins (proteins unextractable with acetic acid, SDS etc.) may be particular!>' important as the amount of these proteins decreases substantially during dough mixing37,3 . Depolymerisation of residue or gel protein due to scission of inter-chain SS bonds is potentially an important effect of GSH on mixing, and this reaction may be prevented or controlled through addition of oxidants to reduce GSH levels. Work input during mixing may strain SS bonds in glutenin and make them more vulnerable to attack by SH compounds. Partial depolymerisation of protein during dough mixing may be the initial and necessary step for formation of an optimum protein network, however, and a small amount of glutathione may facilitate this. The maximum amount of glutathione that can be tolerated before adverse effects are produced will depend presumably on the gluten protein properties and on the content of other endogenous reducing agents. Although reaction of GSH with protein SS bonds may partly explain the formation of PSSG, the kinetics of the changes in GSH, GSSG and PSSG during dough mixing suggest that reaction of GSSG with protein SH groups is of considerable significance. The results appears to indicate that this may occur until most of the free GSH and GSSG have been removed from the dough. The effect of oxidising improvers may be to accentuate that reaction. If, as conjectured above, partial depolymerisation of protein during dough mixing is an initial and necessary step for the formation of an optimum protein network, the blockage of free SH groups through formation of PSSG may be necessary to maintain the protein in such a partially depolymerised state. Thus, if the bread improver effect of oxidising agents is through effects on the glutathione, it may be that the reactions involved are more complex than simply the oxidation of GSH to GSSG. A necessary second reaction may be the reaction of GSSG with protein SH groups to form PSSG. It may be necessary for such reactions to continue until most of or all the GSH is removed such that maximal blockage of protein SH groups in the form of PSSG has occurred. Another possibility for the reaction of GSSG with gluten proteins is that work imparted to dough during mixing may cause physical breakage of SS bonds at vulnerable points by homolytic scission to create thiyl-free radicals42,43. The bond energies of SS bonds are lower than those of C-C, C-N and C-S bonds44, i.e. the other bonds involved in the polypeptide backbone and in inter-chain disulphide links. But C=N double bonds have about twice the bond energies of C-N single bonds4s, and, since the peptide bond has substantial double bond character44, its bond energy will be well above those of C-C, C-N and C-S bonds. Thus, if dough mixing does cause direct rupture of covalent bonds that take part in the polymeric structure of glutenin polypeptides and glutenin polymers, homolytic scission of SS bonds is the most likely reaction to occur. Protein thiyl radicals could react with GSSG to give PSSG plus the thiyl radical form of glutathione. The glutathione radical could then go on to react with PSSP to give PSSG plus a protein thiyl radical. In this case, there would be two depolymerisation steps, one caused by mechanical work and the other by reaction of the glutathione radical with protein SS bonds. Vulnerable protein SS bonds are likely to be near the centres of the glutenin polymers42.
Low M, Sulphydryl Compounds in Wheat Flour and Their Functional Importance
233
3 CONCLUSIONS The research reported here has, therefore, provided new methodology for studying the occurrence of different forms of glutathione in flour, as well as the reactions that those different forms of glutathione undergo both in flour and in dough. The research has also begun to provide insight into the technologically important reactions of glutathione during flour and dough processing. References
1. 2. 3. 4. 5. 6. 7. 8. 9. 1 0. 1l. 12. 13. 14. 15. 16. 1 7. 1 8. 1 9. 20. 2l. 22. 23. 24. 25. 26. 27. 28. 29. 30. 3l. 32.
C. S. Fitchett and P . 1. Frazier, In 'Chemistry and Physics of Baking', Eds 1 . M . V. Blanshard, P. 1. Frazier and T. Galliard, Roy. Soc. Chern., London, U. K, 1 986, p. 1 79. I. KJones and P. R. Carnegie, J. Sci. Food Agric. , 1 969, 20, 54. I . KJones and P . R. Carnegie, J. Sci. Food Agric. , 1 969, 20, 60. R. Sarwin, C. Walther, G. Laskawy, G. Butz and W. Grosch, Z. Lebensm. Unters. Forsch. , 1 992, 195, 27. 1 . D. Schofield and X . Chen, J. Cereal Sci. , 1 995, 21, 1 27. 1. A. D. Ewart, J. Sci. FoodAgric. , 1 985, 36, 1 O l . X. Chen and 1. D. Schofield, J. Agric. Food Chem. . , 1 995, 43, 2362. T. Kuninori and B . Sullivan, Cereal Chem., 1 968, 45, 486. B. Sullivan, Cereal Chem. 13 (1936) 453-462. E. Ziegler, CereaI Chem., 1 940, 17, 55 l . E. Villegas, Y. Pomeranz and 1. A. Shellenberger, Cereal Chem. , 1 963, 40, 694. D. R. Coventry, P. R. Carnegie and I. KJones, J. Sci. Food Agric., 1 972, 23, 587. M. 1. Archer, J. Sci. Food Agric., 1 972, 23, 485 . W. Grosch, In 'Chemistry and Physics of Baking', Eds 1. M. V. Blanshard, P. 1. Frazier and T. Galliard, Roy. Soc. Chern., London, U. K, 1 986, p. 602. R . Sarwin, G . and W . Grosch, Cereal Chem. , 1 993, 70, 553. R. Sarwin and W. Grosch, In 'Gluten Proteins 1 993', Association of Cereal Research: Detmold, 1 994, p.362 I. KJones and P. R. Carnegie, J. Sci. FoodAgric. , 1 97 1 , 22, 358. W. Grosch and R. Sarwin, In 'Gluten Proteins 1 993', Association of Cereal Research: Detmold, 1 994, p. 356. D. 1. Reed, 1. R. Babson, P. W. Beatty, A. E. Brodie, W. W. Ellis and D. W. Potter, Anal. Biochem. , 1 980, 106, 55. 1. D. Schofield, In 'Wheat: Production, Properties and Role in Human Nutrition', Eds W. Bushuk and V. Rasper, Blackie Academic and Professional, Glasgow, 1 994, p. 73. P . I . Payne and KD . Corfield, Planta, 1 979, 145, 83 . 1. A. Bietz and 1. S. Wall, Cereal Chem., 1 980, 57, 4 1 5 . R. C. Bottomley, H. F. Kearns and 1. D. Schofield, J. Sci. Food Agric., 1 982, 33, 48 l . N. P. Kozmin, Cereal Chem. , 1 935, 12, 1 65. E. A. Fisher, P. Halton and R. H. Carter, Cereal Chem. , 1 937, 14, 1 3 5 . 1. A. Shellenberger, Cereal Chem. , 1 939, 16, 676. R. 1. Bothast, R. A. Anderson, KWarner and W. F. Kwolek, Cereal Chem. , 1 98 1 , 58, 309. 1. D. Schofield and X. Chen, In 'Gluten Proteins 1 993' Association of Cereal Research, Detmold, 1 994, p. 362. T. Kuninori and H. Matsumoto, Cereal Chem. , 1 964, 41, 252. T. H. Collins, In 'Master Baker's Book of Bread Making', Ed. 1. Brown, Turret Press Ltd, London, 1 982, p. l . T . Galliard, In 'Chemistry and Physics of Baking', Eds 1. M . V. Blanshard, P. 1. Frazier and T. Galliard, Roy. Soc. Chern., London, U. K, 1 986, p. 1 99. N. Chamberlain and T. H. Collins, Bakers ' Digest, 1 979, 53, 1 8.
234
33. 34. 35. 36. 37. 38. 39. 40. 41. 42. 43 . 44. 45.
Wheat Structure, Biochemistry and Functionality
1. W. Finley, E . L . Wheeler and S. C . Witt, 1. Agric. Food Chem. , 1 98 1 , 29, 404. F. 1. R. Hird, I. W. Croker and W. L. Jones, 1. Sci. Food Agric. , 1 968, 19, 602. F. MacRitchie, Adv. Cereal Sci. Techno!. , 1 980,3, 27 1 . D. K. Mecham, Cereal Sci. Today, 1 968, 13, 393. K. Tanaka and W. Bushuk, Cereal Chem., 1 973, 50, 597. G. Danno and R. C. Hoseney, Cereal Chem. , 1 982, 59, 587. A. Graveland, P. Bosveld, W. 1. Lichtendonk and 1. H. E. Moonen, Biochem. Biophys. Res. Commun. , 1984, 93, 1 1 89. P. L. Weegels, R. 1. Hamer and 1. D. Schofield, In 'Gluten Proteins 1 993', Association of Cereal Research: Detmold, 1 994, p. 362. 1. A. D . Ewart, 1. Sci. Food Agric. , 1 972, 23, 687. 1. A. D. Ewart, 1. Sci. Food Agric. , 1 986, 36, 1 0 1 . F. MacRitchie, 1. Polymer Sci. , 1 975, Symp No 49, 85. L. Pauling, 'The Nature of the Chemical Bond', 3rd Edition., Cornell University Press, New York, 1963 . R. McWeeny, 'Coulson's Valence', 3rd Edition., Oxford University Press, New York, 1 979, p. 223.
DETERMINATION OF LOW MOLECUlAR WEIGHT THIOLS IN WHEAT FLOURS AND
DOUGHS
B. Hahn, R. SalWin and W. Grosch Deutsche Forschungsanstalt rur Lebensmittelchemie, LichtenbergstraBe 4, D-85748 Garching, Germany
1 INTRODUCTION Complex redox systems consisting of glutathione (y-glutamylcysteinylglycine; GSH)/oxi dized glutathione (GSSG), cysteine (CSH)/cystine (CSSC) affect the rheological properties
of doughs 1-5 . It is suggested that the dough structure is weakened by sulphydryl!disulphide (SH/SS) interchange reactions of the thiol groups involved in these redox systems, with the interchain disulphide bonds of glutenin polymers. To get a better insight in these reactions, the concentration levels of GSH, GSSG, CSH as well as those of glutathione and cysteine present in protein-glutathione mixed disulphides (GSSP) and in protein-cysteine mixed disulphides (CSSP), respectively, have been deter mined in flours of different wheat varieties6-9. Furthermore, the losses of GSH and GSSG during the storage of wheat flours at 4°C and the changes in the levels of GSH and CSH during the mixing of doughs, which were prepared with and without different diastereomers of ascorbic acid, have been followed8,9.
Among the numerous low molecular SH compounds present in flour, the dipeptides L y-glutamylcysteine (GluC) and cysteinylglycine (CGly) have been identified 1 0, 1 1 . The pre sent paper describes the quantification of these peptides in wheat flour in addition to that of GSH and CSH. Furthermore, it describes the effects of L-threo-ascorbic acid (Asc) and potassium bromate on GSH and CSH during the preparation of a flour-water dough. The third point concerns GSH which is liberated by the drying of yeast and its rheological effect on doughs in the absence and presence of Asc. 2 EXPERIMENTAL 2.1
Material
Flour samples of the wheat cultivar DNS (E89 and E91) and of the cultivar Columbus (E92) were milled and sieved. All flours were between 13 % and 14 % moisture, and the
analytical results are expressed on an "as is" basis. The samples of dry yeast (Saccharomyces cerevisiae) were commercially available. Doughs were prepared from 1 0 g flour DNS (E91)
Wheat Structure, Biochemistry and Functionality
236
as reportedS . Dry yeast (1 5 mg) was suspended in 6 .5 mL of an aqueous solution of NaCI (D.2 g). After stirring for ID min at room temperature, the extract was clarified by centri fugation and membrane filtration and then used for the preparation of doughs from the cul tivar Columbus. 2.2
Chemicals
Gly was purchased from Bachem-Biochemical, Heidelberg, Germany. GSSG (Serva,
Heidelberg, Germany) was hydrolyzed with carboxypeptidase l2. The L-V-glutamylcystine obtained was reduced with mercaptoethanol yielding GluC. N-Phenylmaleimide (NPMI) was purchased from Sigma, Deisenhofen, Germany. CGly-NPMI, GluC-NPMI and the corresponding 14C-Iabeled derivatives were prepared as reportedS for GS-NPMI and [ 14q_GS_NPMI. 2.3
Isotope Dilution Assay (IDA) of Thiols
The procedure was the same as reported recentlyS . It consisted of the following steps: in an atmosphere of nitrogen the sample of flour or freeze-dried dough (4 g) or of dry yeast (D. l g) was suspended in a citric acid buffer (PH 4.5) containing the NPMI reagent and the corresponding labeled internal standards. After ultrafiltration and separation of the filtrate by gel chromatography on Sephadex GID, the NPMI derivatives were purified by two HPLC steps. Finally, the specific radioactivity of each of the NPMI derivatives was determined by UV and liquid scintillation measurements. 2.4 Micro-Scale Extension Test
Flour-water doughs from ID g flour were investigated by micro-scale extensigrams5 .
3 RESULTS AND DISCUSSION 3.1
Determination of GSH, CSH, GluC and CGly
The concentrations of GSH, CSH, GluC and CGly were determined in the flour DNS (ES9) by IDA. Three steps were necessary to separate and to purify the NPMI derivatives of these thiols. The first step, gel chromatography, provided two peaks (Figure 1), which then were separately subjected to HPLC. In the first run peak I yielded a double peak (Ia in Figure 2A) containing the two diastereoisomeric forms of GS-NPMI. Peak II was separated
into the three fractions lIa to IIc (Figure 2B). GS-NPMI and the fractions lIa to IIc were rechromatographed by HPLC. As shown in Figure 3, the two diastereomeric forms of GS NPMI (fraction la), CS-NPMI (lIa), GluC-NPMI (lib) and CGly-NPMI (lIc) were obtained as definite peaks. The identification of these compounds was performed by co-chromato
graphy with authentic samples and in the case of the peptides by amino acid analysis after hydrolysis (data not shown).
Low M,
237
Sulphydryl Compounds in Wheat Flour and Their Functional lmponance
1 00
( m( )
200
Figure 1. Separation of a flour extract (DNS, E89) by gel chromatography on Sephadex G-JO
10
17
51 34 ( m l )
®
17
34 ( ml ) 51
Figure 2. HPLC ofthe fractions I (A) and II (B) obtained from Figure J
Wheat Structure, Biochemistry and Functionality
238
A 2 20
la
lI a
lI e
lI b
7.5 15 22.5
7.5 15 22.5
( ml )
7.5 15 22.5
7.5
15 22.5
Figure 3. HPLC of the subfractions fa and lIa to lIc obtained from Figure 2 The appearance of two peaks for each derivative (Figure 3) enhances the accuracy of the method, as the specific radio activity of these peaks, which is the basis for the calcula tion of the amount of the analyte, have to be in agreement. If this is not the case, the purifi cation of the analytes has to be continued until the peaks are homogeneous. The losses of the analytes in the purification steps do not affect the correctness of the results as they are as high as those of the labeled internal standards, because the analytes and their standards show the same chemical and physical properties. This is an advantage of an IDA in contrast to conventional methods. The results summarized in Table
1
indicate that aSH was the major low molecular SH
compound of the flour DNS (E89). The concentration of GluC was somewhat higher than that of CSH and the dipeptide Caly amounted only to
5 % of the amount of aSH.
3.2 Eft'eet of Ase and KBr03 on GSH and CSH in Flour/Water Doughs The flour DNS (E93) was kneaded with water at 30°C for 3 min and 9 min, respectively. The latter dough was also rested for 20 min after mixing. Each dough sample was frozen immediately in liquid nitrogen, then lyophilized and finally the concentration levels of aSH and CSH were determined. The results in Table
2 indicate a decrease of aSH from 124 nmol/g in the flour to 57
nmol/g in the dough being mixed for 3 min. Simultaneously, CSH increased from
22 to 68
nmol/g. This effect of the mixing procedure on aSH and CSH was in accordance with
Low Mr Sulphydryl Compounds in
Wheat Flour and Their Functional Importance
239
Table 1. Concentration of low molecular thiols in the flour DNsG
Concentrationb (nmol/g)
Thiol GSH
100
GluC
17
CGly
5
CSH
13
a b
E 89, ash: 0.78
% by weight.
Mean values of two determinations.
Table 2. Changes of aSH and CSH in flour/water doughr prepared with Asc or KBr03
csJIl (nmol/g)b
asJIl (nmol/g)b No.
Addition
Mixingperiod (min) at 30°C 3
9
9 + 20C
3
9
9 + 2OC
1
None
57
22
17
68
28
31
2
Asc (30 mg/kg)
11
6
2
26
17
19
3
KBr03 (50 mg/kg)
40
20
11
52
26
27
a b c
The flour DNS (E93, ash: 0.76 CSH.
% by weight) contained 124 nmol/g GSH and 22 nmol/g
Mean values of two determinations. Proofing time 20 min.
results reported earlier8 . It has been suggested that the increase of CSH is due to reaction 8 of GSH e.g. with cystine . Extension of the mixing time up to 9
min
enhanced the loss of GSH and inhibited the
increase of CSH (Table 2). Most likely, GSH and CSH are consumed by SH/SS interchange reactions with proteins during the longer mixing period. In experiment no. 2 (Table 2) the addition of Asc accelerated the decrease of GSH and prevented the increase of CSH. This result is in accordance with the hypothesis explaining ,8 the improver action of Asc on dough rheolo . Asc is oxidized rapidly to dehydroascorbic
gyS
acid (DHAsc) which in turn removes GSH by an enzymatic oxidation giving GSSG. KBr0 (experiment no. 3) reacted slower with GSH than the redox system Asc/DRAsc. 3 Consequently, CSH increased from 22 to 52 nmol/g during the mixing period of 3 min. A prolongation of the mixing time to 9 min further reduced the levels of GSH and CSH. However, the subsequent proofing time of 20 min led only to an additional decrease of GSH while CSH increased somewhat.
Wheat Structure, Biochemistry and Functionality
240
Table 3. Concentration of GSH in five sarnples of dry yeast
GSH (JJ.rnol/g) a
Sarnple no.
a
3.3
1
1 1 .3
2
12.9
3
14.6
4
18.7
5
24.3
Amounts related to dry mass.
Rheological EtTect of GSH Liberated from Dry Yeast GSH was determined in 5 samples of dry yeast. As shown in Table 3, the samples
contained high amounts varying from 1 1 .3 to 24.3 JJ.mol/g. Obviously, GSH was released from yeast cells by the drying process as much smaller amounts were extractable from freshly compressed yeast cells (data not shown). Extensigrams of flour-water doughs were prepared with and without an aqueous extract obtained from the dry yeast no. 1 (Table 3). The result displayed in Figure 4A indicates that the resistance value (defined as the height of the curve) of the dough with the extract was only 54
% of that of the reference dough.
This decrease in the resistance value was also found (Figure 4A) when the yeast extract was replaced by a solution containing GSH in a concentration equal to that of the yeast sample of 15 mg. This result allows the conclusion that the dough softening in the experi ment with the yeast extract is mainly caused by the GSH released from the dry yeast. The curves of doughs prepared with and without Asc as shown in Figure 4B reveal that the extensibility of the dough was shortened by the action of Asc as was expected. However, the amount of Asc was also able to counteract the softening of the dough caused by GSH that was released from the yeast. The dough was strengthened as shown earlier for doughs 5 in which the effect of added GSH was compensated by Asc .
References 1. B. Sullivan, M. Howe, F. 2.
D. Schmalz and G. R. Astleford, Cereal Chern. ,
1940, 17, 507.
E. Ziegler, Cereal Chern. , 1940, 17, 55 1.
Cereal Chern. ,
1944, 21, 140.
Sci. FoodAgric. ,
1969, 20, 60.
3. C. O. Swanson and A.c. Andrews, 4. I. K. Jones and P. R. Carnegie, !
5. R. Kieffer, J.-J. Kim, C. Walther, G. Laskawy and W. Grosch, ! 6. M. J. Archer, !
Sci. FoodAgric. ,
7. R. Sarwin, C. Walther, G. Laskawy. B. Butz and W. Grosch, Z. 1992, 195, 27.
Cereal Sci. ,
1990, 11, 143.
1972, 23, 485.
Lebensrn. Unters. Forsch. ,
Low M, Sulphydryl Compounds in Wheat Flour and Their Functional Importance 8.
24 1
R. Sarwin, G. Laskawy and W. Grosch, Cereal Chem., 1993 , 70, 553 .
9. J. D. Schofield and X Chen, l Cereal Sci. , 1995, 21, 127. 10. R. Tkachuk, Can. 1 Biochem., 1970, 48, 1029.
1 1 . R. Tkachuk and V. J. Mellisch, Can. 1 Biochem. , 1977, 55, 295.
12.D. Strumey and K. Block, Biochem. Prep. , 1962, 9, 52.
F IN)
® 0. 25
5
10
F I N)
15
E l cm )
®
0.25
5
10
15 E l cm )
Figure 4. Micro-scale extensigrams offlour-water doughs from 10 9 flour (Columbus, E92, type
550). (A) Additions: without ( ) yeast extract (e), 17 nmol GSHper g flour (D). (B) Additions: -
,
without ( ) 20 Ilg Asc per g flour (e), yeast extractplus 20 Ilg Asc per g flour (D) -
,
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
WHEAT LIPIDS AND LIPID-BINDING PROTEINS: STRUCTURE AND FUNCTION.
D. Marion l and D.C. Clark2 I.N.R.A. Laboratoire de Biochimie et Technologie des Proteines BP1627 443 16 Nantes cedex 03 (France) 1 and Institute of Food Research, Norwich Laboratory, Norwich Research Park, Norwich NR4 7UA (United Kingdom)2. 1 INTRODUCTION In baked cereal products, lipids are present either as ingredients or additives such as fat and emulsifiers. Lipids are also minor components of wheat flour (about 2% of dry wheat flour). Whatever their composition and their origin, lipids contribute, along with starch and proteins, in providing consumers with products with good texture. In particular, wheat lipids contribute in defining the end-use quality of wheat and in the future, it is likely that they will be considered in breeding programs. Two physicochemical events are now considered to be essential for explaining the functionality of wheat lipids in cereal products: (1 ) the oxido-reducing mechanism involving lipoxygenase catalysed oxidation of polyunsaturated fatty acids and rearrangement of protein disulphide bonds of gluten proteins1,2 and (2) the involvement of lipids and lipid-protein complexes in the formation and stability of air-water (foam) and oil water (emulsion) interfaces during dough mixing, proofing and baking3.4. This review focuses on the role of wheat lipids in the formation and stabilization of gas bubbles in bread doughs. Two basic physicochemical phenomena occurring on dough mixing are essential for the expression of the surface properties of wheat lipids: (1) the water-dependent liquid-crystalline (I.c.) structures of lipids (2) the adsorption of I.c. structure from the bulk water phase of dough to the air-water interfaces. Proteins and especially those having the ability to bind lipids are involved and can interfere in the expression of lipid functionality. 2 LIQUID-CRYSTALLINE POLYMORPHISM OF WHEAT LIPIDS FROM GRAIN TO DOUGH. Due to their high hydrophobicity, lipids self-interact in aqueous solvents to give rise to different phenomena: some lipids are completely insoluble and form crystals or oil phases, while others, due to their amphiphilic structure, swell to form I. c. phases or self-aggregate to form micelles. Micelles are the most simple and stable self-assembly formed by lipids above a critical concentration and temperature. Below their critical micellar concentration these lipids exist as monomers in true solution. The size and shape of micelles depend on the lipid structure: discoidal, spherical and rod-shaped structures can be foundS. Amphiphiles can swell in lamellar, hexagonal or cubic I.c. phases and their structures have been extensively investigated since the pioneering work of Luzzati and co-workers6. The
Wheat Structure, Biochemistry and Functionality
246
lamellar phase is a bilayer structure similar to that found in the famous model of biomembranes defined by Singer and Nicolson7 . Two types of hexagonal phases are known: the normal or HI type hexagonal phase and the reverse or HU type hexagonal phase. In the HI phase, lipids are packed in long cylinders in which their polar head groups are exposed at the surface; such phases are generally formed at high concentrations of lipids which form micelles at high water concentrations. In contrast, in the Hn phase, polar head groups face inside the cylinders and form a water channel8 . In contrast with other I.c. phases, structural data have been obtained quite recently for the cubic phase which is certainly one ofthe most complex I.c. structure formed by polar lipids9. 1O . The I.c. phase behaviour of a lipid molecule is very complex and depends on its structure (structure of the polar head group and of the hydrophobic tail) and on the physicochemical characteristics of the system (pH, temperature, ionic strength, water content. . .). Some wheat lipids, such as phosphatidy1choline (PC) and digalactosyldiglycerides (DGDG), have a high propensity for forming bilayer phases while others, such as unsaturated monogalactosyldiglycerides (MGDG) and N acylphosphatidylethanolamines (N-acyIPE), preferentially form non-bilayer structures 1 1-13 . For some lipids, I.c. phase transitions can occur on heating, pH changes or the presence of divalent cationsl 2 .
NPL
Figure 1 Liquid-crystalline (I.c.) polymorphism of extracted wheat flour lipids in water.
(NPL): non-polar lipids; (PL): polar lipids; (W): water; (c); crystals; (L):lamellar I.c phase, (H1I): hexagonal II I.c. phase; (L2): L2 I. c. phase (from Larsson16).
The phase behaviour of lipids becomes very complex when more than a single lipid species is present. This has been emphasized by the work of Larsson and co-workers I 4-16 who have shown that the polymorphic phase behaviour of extracted neutral and polar wheat lipids is dependent on the water content (Figure 1). Polymorphism of lipids has been also observed in wheat seed, flour and dough by freeze-fracture electron microscopy I7-19 . In dry wheat endosperm, this technique has shown that lipids form aggregates typical of hexagonal II and cubic phases. When water diffuses in the dry endosperm numerous vesicles are observed growing from the non lamellar aggregatesl7 . This transition is also observed during hydration of wheat flour and it appears that the cubic phase is an
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
247
intennediate step in this hexagonal to lamellar phase transition19. Such I.c. transitions have already been observed in model phospholipid systems and in this case, the vesicles obtained are of the unilamellar type20. In wheat doughs numerous oil droplets are observed which certainly correspond to the oil bodies found in the aleurone layer and embryol9. Therefore, at the end of dough mixing and in extracted wheat gluten only oil droplets and lamellar vesicles are presentl8, 19. It is interesting to note that the observation of such lipid phase transitions from flour to dough and gluten is in agreement with the phase diagram obtained for extracted wheat polar lipids. Below 1 5% water content only hexagonal phases are observed while between 1 5 and 50% only lamellar structures are predicted (Figure I). However the L2 phase described by these authors has not been observed. The presence of HII phases in dry endosperm means that a transition from lamellar biomembranes to HII phases occurs during the final dehydration step of grain maturation. Since I.c. structures derive from biological membranes, lipids are probably associated with specific hydrophobic membrane proteins. Analysis of the proteins associated with dough lipid vesicles reveals that they are composed of polypeptide chains ranging from 1 5 to more than 90 kDa but most proteins have a molecular mass around 1 5 kDa 19. Since some of these vesicles derive from a series of water dependent I.c. transitions, it is reasonable to ask whether all membrane proteins are recovered. The answer is probably negative, since it has been shown in model membrane systems that such transitions cause lateral segregation of lipids and membrane proteins, causing expulsion of the so-formed protein aggregates2 1, 22. In the case of wheat, the behaviour of the membrane proteins from grain to dough is still unknown. We can reasonably assume that such proteins play an important role merely because it may be estimated that about I ()o1o of protein in wheat could be membrane associated -a value based on the fact that the mean lipid/protein ratio in membranes is I : I by weight and there is about 1% membrane lipids in a wheat flour-. protl!in bUIll..1
SEED
I I
FLOUR
DOUGH
intermediate I.e cubic pha.e
H20 - - - - membrane protainl - - �-r--��� r------�
bltannelliate Le cubic: phase
1---"'---o4I ltareh-putm-lipid matrix
Figure 2 Liquid-crystalline rearrangements of lipidsfrom wheat grain to dough Finally, it is possible to develop a general scheme of lipid and biomembrane rearrangements that occur in wheat grain and dough (Figure 2). During the final dehydration step of grain maturation, the lamellar biomembranes of the starchy endosperm become non lamellar (mainly hexagonal and/or cubic) and some· membrane proteins could be expelled into the protein matrix. In the living tissues, such as the aleurone layer and
248
Wheat Structure, Biochemistry and Functionality
embryo, the biomembranes are probably preserved and it is assumed from their ultrastructure and their lipid composition that they are mainly composed of oil bodies. These oil bodies are oil droplets surrounded by a monolayer of proteins and phospholipids. After milling and hydration of wheat flour, the lipid pool in the mixed dough is provided by the lamellar vesicles that derive from the hexagonal structure and by oil bodies coming mainly from the embryo or aleurone layer -tissues in which triglycerides are concentrated-. These lipid aggregates are interspersed throughout the glu.ten-starch network by dough mixing. Thus, these transitions lead to an effective dispersion of lipids and especially of polar lipids throughout the dough.
3 . TRANSFER OF POLAR LIPIDS FROM BULK WATER TO INTERFACES: THE KEY TO THE EXPRESSION OF WHEAT LIPID FUNCTIONALITY. The last key step in the expression of lipid functionality in breadmaking involves the transfer of the lipid vesicles from the bulk water to the air-water interface. A close relationship has been found between the effect of wheat lipids on the bread volume and their effect on the foaming properties of water soluble wheat extracts2 3 ,24 . It has been shown that non polar lipids, triglycerides and free fatty acids exhibit anti-foaming properties which are detrimental to bread volumes. In contrast, polar lipids such as wheat galactolipids improve the foaming properties of aqueous extracts and are also good bread volume improvers. These experiments revealed that the formation of a dough foam and its stability on mixing, resting, proofing and baking could be essential to the formation of aerated bread crumbs. They also revealed that aqueous soluble material and lipids are key components in dough foaming. The diffusion of polar lipid bilayers from bulk water to air-water interfaces and their spreading as a lipid monolayer are key mechanisms to the expression of the surface properties of lipids. Two types of films are formed when Iiposomes spread at air-water interfaces. At zero surface pressure there is a slow transformation of the closed bilayer into an open monolayer at the air-water interface. In constrast, when bilayer liposomes are spread against a surface pressure, a part of the multilamellar structure is preserved. Furthermore, the outer layer spread more efficiently than the inner layer25 . In fact, an equilibrium is created where lipid exchange occurs between the monolayer, the immediate sublayer of vesicles in interaction with the monolayer and the vesicles in bulk solution26. The lipid-lipid interactions in the bilayer produce an energy barrier for the bilayer monolayer transition at interfaces. For example the strong lipid-lipid interactions in saturated phosphatidylcholine bilayers prevent the spontaneous adsorption of these molecules at the air-water interface27 . However defects in the packing of lipids inside the bilayer can favour this adsorption. These defects are generally created by non bilayer Iipids27 , 28 such as lipid forming micelles (IysoPC for example) or hexagonal I.c. phases (unsaturated PE for example). It has been proposed that a mechanism similar to that occurring on bilayer fusion proceeds at the air-water interface28. During fusion it has been shown that an inverted micellar structure is formed by the non bilayer lipids at the contact between bilayers. A similar mechanism could occur at the contact between the bilayer and the air-water interface which would subsequently stimulate the spreading of lipids (Figure 3). Defects can also occur if the curvature of the bilayer is important. This is the case with small unilamellar vesicles, which spread rapidly at air-water interfaces27 No data are available for wheat lipids but it is quite interesting to note that non bilayer lipids are present in wheat either in the glycolipid fraction (e.g. MGDGl l) or in the phospholipid fraction (e.g. unsaturated N-acyIPE 13 ). Furthermore, the rearrangements of lipids during
Nature and Functionality of Wheat Lipids. Lipid Binding Proteins and Added Emulsifiers
249
hydration of wheat flour leads to small bilayer vesiclesl9. It is interesting to note that in breadmaking, small sonicated unilamellar vesicles are better improvers of bread loaf volume than large multilayered liposomes29. All these physicochemical parameters, which favour the spontaneous adsorption and spreading of polar lipids as a monolayer film, are probably enhanced by the energy put into the system by mixing.
Figure 3 Formation of inverted micelles during adsorption of liposomes at air-water interface (a) and liposomefusion (b).
4.HOW DO PROTEINS INTERFERE WITH OR ENHANCE THE EXPRESSION OF LIPID FUNCTIONALITY? In
the dough system many proteins can interfere in the expression of the interfacial properties of polar lipids: (1) the soluble proteins, albumins and globulins competitively adsorb with lipid amphiphiles and can create unstable foam films in expanding the other surface active components of dough aqueous phase (2) the viscoelastic properties of gluten proteins, g1iadins and g1utenins, can impair the gas expansion during baking; (3) lipid binding proteins can contribute to the spreading and stability of lipid and lipid-protein films.
4.1. New Data on the Structure of Wheat Lipid-Binding Proteins Since the first evidence emerged that supported the involvement of lipids in the quality of cereal products many works have attempted to look for lipid binding proteins in wheat flour. The search for lipid binding proteins in wheat flour began quite early in 1 940 with the isolation of a lipoprotein complex in the petroleum ether extract from wheat flour30. Since that time, many complicated fractionation procedures have been used to extract lipid binding proteins from wheat flour using either aqueous or organic solvents3 l-33. These procedures are generally not specific and the fact that they lead to fractions containing both proteins and lipids is not sufficient proof that both components form lipoprotein complexes. Subsequent in vitro lipid binding experiments are necessary. Thus, different proteins have been isolated and characterized as thionins30, chloroform-methanol extracted (CM) proteins3 l, Iigolin32 and S-proteins33. Lipid binding has been proved only in the case of thionins34 and Iigolins32. However, it is interesting to note that most of the protein isolated are low molecular weight and cystine-rich albumins.
250
Wheat Structure, Biochemistry and Functionality
Looking back at the literature, it is apparent that such structural features are also shared by plant lipid transfer proteins (LTP)35. These proteins are characterized by a molecular weight of about 9kDa, a basic pI and 8 cysteines forming 4 disulphide bonds. This is generally an abundant form of protein in plant seeds which accounts for up to 5% of the soluble proteins. These proteins are able to catalyze the intermembrane transfer of polar lipids, phospholipids and glycolipids. These proteins are non specific, since they transfer different types of polar lipids and are also capable of binding free fatty acids. An homologous protein which accounts for about 2% of wheat soluble proteins has been purified from wheat endosperm and its sequence has been determined36 (Figure 4). Another isoform of LTP has been found in wheat embryo which is susceptible to phosphorylation by a wheat calcium dependent kinase37, 38. The presence of different isoforms suggest that these proteins belong to a multigenic family. This is in agreement with previous obselVations with castor bean where the 4 LTP isoforms found are organ specific39. The wheat endosperm LTP is localised in the aleurone layer40 as in the case of barley LTP4 1 . Despite this peripheral localisation, approximately 50% of the total LTP found in wheat seed is carried through into wheat flour content36. These results suggest that milling could influence the lipid binding protein content of wheat flour. The structure of the wheat lipid transfer protein has been recently determined from multidimensional NMR data42, 43 . The polypeptide backbone folds into a simple and original right handed winding. It is composed of a bundle of 4 helices linked by flexible loops which are packed against a C-terminal fragment which has a non standard saxophone shape. A hydrophobic cleft formed by residues located in the second half of the protein is the probable lipid binding site. The molecular basis of the mechanism of lipid transfer is still unknown but it is probable that both adsorption of the protein at the bilayer interface and binding of a lipid molecule are involved. The helical structure of the protein is quite important for lipid binding and lipid induces a significant increase of the overall helicity of the protein36. The adsorption site to the membrane interface is still unknown but orientational studies on lipid monolayers by ATR-FTIR spectroscopy and fluorescence microscopy show that adsorption is accompanied by significant structural rearrangements of both lipids and protein44. This interaction with the bilayer interface is weak but is in good agreement with the intermembrane exchange-transfer of lipids catalysed by LTP. The second class of proteins is capable to penetrating more deeply and spontaneously in the bilayer membrane due to their amphiphilic structure which allows interaction with both the polar head group and the fatty backbone of the polar lipids. This behaviour is generally similar to that exhibited by transmembrane proteins. Therefore, in order to specifically and quantitatively recover such proteins, we have used a simple and efficient procedure, Triton X l 14 phase partitioning. Non ionic detergents are able to compete and replace the natural membrane lipids due to their amphiphilic structure so that lipoprotein organisation is lost45. Above a critical detergent content, lipid-detergent and protein detergent mixed micelles are foimed, which are easily fractionated by different chromatography procedures. TXl 14 is especially interesting since above 25°C, aggregation of micelles takes place so that two phases are formed. These may be separated after centrifugation into an upper detergent depleted phase and a lower detergent-rich phase46. Transmembrane proteins are found in the TXl 14 rich phase and in the case of wheat flour, non membrane proteins have also been found47. The partitioning behaviour of the latter suggest that they probably have the ability to penetrate bilayer membranes. This hypothesis has been strengthened by the fact that thionins, known for their membranotoxic effect were among this group of isolated proteins. Surprisingly, the major protein found in this phase was a new basic and cystine rich low molecular weight protein. This protein was purified and its sequence determined48. It contains 10 cysteines forming 5 disulphide bridges and
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
25 1
exhibits an unique tryptophan-rich domain which has contributed to naming this protein, puroindoline (from the Greek word puros, for wheat and indoline for the indole ring of tryptophan)(Figure 4). Another minor isoform of this protein has been isolated and subsequent cDNA sequencing revealed that it has a truncated tryptophan rich domain47,49. Therefore, the former isoform was named puroindoline-a and the latter puroindoline-b. Puroindolines do not exhibit sequence homology with any other known cystine-rich wheat protein but it is interesting to note that it is possible to find relatively good alignment of the sequences of LTP and puroindolines except in the zone containing the tryptophan-rich domain (Figure 4). This suggests that LTP and puroindolines could have similar tertiary structure. Finally, this homology suggests that the tryptophan-rich domain could be responsible for the transmembrane protein-like properties of puroindolines. In this regard, it has been recently suggested that tryptophan might play a major role in the transmembrane penetration and orientation of membrane proteins50. 1 2 3
--------IDCGHVDSLVRPCLSYV--------------------QGGPG DVAGGGGAQQCPVE-TKLNSCRNYLLDRCSTMKDFPVTWRWWKWWKGGCEVGGGGGSQQCPQERPKLSSCKDYVMERCFTMKDFPVTWPT-KWWKGGCE
1 2 3
PS--GQCCDGVKNLHNQARSQSDRQSACNCLKGIA---RGIHNLNEDNAR QELLGECCSRLGQMPPQCRCNI IQGSIQGDLGGIFGFQRDRASKVIQEAK HEVREKCCKQLSQIAPQCRCDSIRRVIQGRLGGFLGIWRGEVFKQLQRAQ
1 2 3
SIPPKCGVNLPYTISLNIDCSRV NLPPRCNQGPPCNIPGTIG---SLPSKCNMGADCKFPSG------
*
*
******
**
*
*
***
*
**
**
*
*
*
**
**
*
**
**
*
***
**
*
**
*
Figure 4 Alignment of the amino acid sequences of wheat lipid transfer protein (1),
puroindoline-a (2) and puroindoline-b (3). (*) Identical or similar amino acid residues conserved in LIP and puroindolines or in L TP and an isoform of puroindoline.
Probably many other lipid binding proteins still remain to be discovered in the wheat soluble protein fraction and certainly many other unknown proteins are present in the TX1 l 4 extract. Some proteins have been already discovered such as the metal-dependent phospholipid-binding proteins of the water-soluble protein fraction5 1, which are probably homologous to annexins52• 53. These proteins, for which the real biological activity is still unknown, exhibit a quite interesting inhibitory activity on phospholipase A252. 53.
4.2. Competition between Soluble Proteins and Polar Lipids for Interfaces. Proteins and polar lipids are amphipathic molecules and are capable of lowering interfacial tension and thus promoting stabilization offoams and emulsions. The majority of proteins have a high affinity for the interface, which they saturate at much lower concentrations than low molecular weight surfactants54. This is consistent with the ability of proteins to cause a greater lowering of the interfacial tension on a mole for mole basis at
Wheat Structure. Biochemistry and Functionality
252
low concentrations (Figure 5). However, at higher concentrations the converse is true, since a pure surfactant stabilized interface generally has a lower interfacial tension than that formed from adsorbed protein (Figure 5). Thus the relative amounts of protein and lipid present in solution can influence the composition of the interfacial layer in simple non interacting mixtures of protein and lipid. In solutions containing low concentrations of lipid, the protein will dominate the adsorbed layer; conversely protein will be displaced from the interface in solutions containing high lipid concentrations. 75
1:1 = .,. Vl
1:1
� .... �
65
fJ _
�
e
; �'i N
== �
e ...
�
55
45
35
0.1
1
10
1 00
[LPC] f1M
Figure
5
The surface tension of L-a-lysopalmitoylphosphatidylcholine, as a junction of increasing concentration in the absence (e) and presence (0) of O. lmglml f3lactoglobulin. All measurements were performed inlOmM sodium phosphate buffer pH 7. O.
However, the situation is often more complex due to interactions between the two components. Here an additional component in the form of the lipid/protein complex must be considered. This component may possess significantly different properties compared to free lipid and protein. Studies of these complex systems has been mostly restricted to high hydrophobic lipophilic balance (HLB) surfactant + protein systems, due to the low solubility of lipids55. An example of the changes observed in surface tension in a system where interactions between components occur is shown in Figure 5. The system illustrated is comprised of p-Iactoglobulin, the whey protein from milk and a water soluble lipid analogue, L-a.-palmitoyllysophosphatidylcholine (LPC). Two data curves are presented showing the surface tension properties of the surfactant in the presence and absence of the protein56. The features described above are evident with the protein dominating the interfacial tension properties at low concentrations and the surfactant dominating at higher concentrations. Interaction between the components is revealed by the cross over of the curves. This occurs because the free surfactant concentration is lowered by the amount complexed with the protein. In this example, the binding process is characterized by a dissociation constant (Kd) of 166mM56. We can imagine a similar mechanism with wheat
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
25 3
lipid transfer protein which is able to bind lysophospholipids. It is interesting to note that the homologous protein from barley is the major component of beer foam57. The composition of many foods results in the adsorbed layers at the interfaces of food foams and emulsions often containing both protein and lipids. The stability of such dispersions is very complex and is often only observed if appropriate temperature conditioning steps are taken to ensure that the lipid globules achieve the correct solid/liquid ratio following crystallisation of triglycerides. This is very necessary in the case of dairy foams, such as whipped cream. In this system, air bubbles are initially stabilized by the adsorption of soluble milk proteins. It is only after extended whipping that fat globules accumulate at the air-water interfaces, start to bridge between air bubbles and contribute significantly to the structure and texture of the product. Adsorption and spreading of liquid fat at the interfaces of foam lamellae (thin films) can induce film rupture and bubble coalescence in some products. This is particularly a problem in cases where there is high dispersed phase volume (e.g. in a reasonably drained foam5 8 or creamed emulsion) or the �ystem is exposed to further processing involving high shear forces54 .
(a)
(b)
(c)
(d)
Figure 6 A schematic representation of the spreading of a lipid droplet causing localfilm thinning leading tofilm rupture The adsorption of molten fat droplets and the subsequent spreading of lipid causes thin film rupture by a Marangoni effect (Figure 6). Some interlamellar liquid in the thin film is associated with the polar head groups of the lipid and is dragged away from the point of adsorption of the lipid droplet by the spreading lipid. This causes local thinning of the thin film and increases the probability of film rupture. Disruption of the structure of the adsorbed interfacial layer can occur as a result of adventitious adsorption of lipid monomers or small aggregates such as micelles. This can also cause instability in the dispersion. This arises from the different stabilization mechanisms displayed by proteins and lipids (Figure 7). In the case of lipids, provided the sample is above the transition temperature, the lipid molecules adsorbed at the interface are
254
��IUI�'" • t • U"'�
Wheat Structure, Biochemistry and Functionality
I
upld dl1Tusion
FlIm stretdl'ftft
I
No protein No Interactions or m u o l n i I rtpt: , m
I
olein deforma uon
Slow dl1Tuston
,
Reduced moblUty
Figure 7 Schematic diagram showing the different mechanisms of thin film stabilization.
(a) The Marangoni mechanism in sutfactant films; (b) The viscoelastic mechanism in protein stabilizedjilms; (c) Instability in mixed componentjilms capable of lateral diffusion in the plane of the adsorbed layer5 9. Thus, if the interface is expanded (dilation), causing a localised increase in interfacial tension, adsorbed lipid molecules can diffuse laterally from regions of lower interfacial tension (Figure 7a). This process acts to restore equilibrium interfacial tension. In contrast, protein molecules in the adsorbed layer interact with each other to form a elastic60, imrnobile61 adsorbed layer rather like a rubber sheet (Figure 7b). It is easy to imagine how such a structure acts to dissipate interfacial expansion over a large area of interface, in the manner in which the rubber skin of a balloon stretches as it is inflated. However, such a mechanism of stabilization is only effective whilst interactions between neighbouring molecules are maintained. If interactions are weak or have been destroyed in certain regions, expansion of the interface results in failure or tearing in the weak region. This is precisely what happens in an interfacial layer comprised of both protein and lipid (Figure 7c). In such a mixed system, both molecules compete for interfacial area. The importance of foam lamellae (thin film) stability in baking has not been studied systematically. One limiting factor relates to the technical problem of working with insoluble gluten. However, it is likely that the stability of these structures plays an important role during the preparation and baking of loaves and sponge cakes. The quality of these foods is inseparably linked to the expansion of gas bubbles during the proofing and baking stages. Scanning electron micrographs reveal that some bubbles grow to such an extent that they are separated from neighbours only by thin films, the aqueous interlamellar phase of which is essentially devoid of the gluten matrix62 . Therefore, prior to starch gelatinisation and the formation of a solid foam (or sponge) during the cooking process, bubbles in these foods are most probably stabilized by thin films stabilized by adsorbed layers of soluble cereal proteins and lipids.
Nature and Functionality of Wheat lipids, lipid Binding Proteins and Added Emulsifiers
255
4.3. Lipid-Binding Proteins to Improve Lipid Film Stability. 4. 3.1. Puroindoline: an example ofwhat a wheat lipid binding protein can do at an air-water interface. The functional properties of puroindoline have recently been investigated in the presence of the water soluble lipid analogue, L-a. lysopaJmitoylphosphatidylcholine (LpC)63. A summary of the main findings of this study including foam stability, the surface concentration of puroindoline and the surface diffusion properties ofFITC-labelled puroindoline are presented in Figure 8. The protein was found to bind 5 moles ofLPC per mole in a positively cooperative manner, characterized by a Kd of 54.3 f.1M and a Hill coefficient of 1 .23 . This was interesting, since separate studies have revealed that the protein binds negatively charged lipids (e.g. dimiristoyl phosphatidyl glycerol) effectively but showed little or no affinity for zwitterionic lipids such as dipalmitoylphosphatidylcholine (DPPC). The foamability and foam stability were assessed by a microconductimetric method61 . Puroindoline alone had excellent properties significantly superior t o commonly studied globular proteins. Unexpectedly, the foam stability of puroindoline increased markedly in the presence of added LPC. This effect was maximal between molar ratios (R) of 1 and 10 moles of LPC per mole of puroindoline. It is still unclear whether this observation is attributable to puroindoline or the LPC (Figure 8). Nevertheless the enhancement in foaming properties was significantly greater than that expected from the sum of the individual properties (i.e. the interaction was synergistic).
50
o
10
[LPC) pM
100
1000
10000 8000
"
\.
\. ,
6000
!
4000 .:; 2000
RI (IIpld/protein molar ratio)
�
o
Figure 8 The effect of LPC on the junctional properties of puroindoline. (O)Foam
stability as determined by conductivity remaining after 5 minutes drainage; (e) The lateral diffusion coeffiCient of adsorbed FITC-puroindoline as determined by fluorescence photobleaching measurements; (0). the change in surface concentration of FITC-puroindoline due to displacf!ment by added LPc. All experiments were performed at a protein concentration of O. lmg/ml in IOmM sodium phosphate buffer. pH 7. 0
256
Wheat Structure, Biochemistry and Functionality
This phenomenon was investigated further by detailed studies of isolated thin films. Transitions were observed in the adsorbed layers of thin films of samples in this compositional range. Firstly, the drainage properties of the thin films changed from protein-like to surfactant-like61 . Secondly the equilibrium thickness of the thin film decreased sharply from >25nm to approximately 14nm in this region. The latter was similar to film thicknesses obtained for films formed from LPC alone. Thirdly, initiation of lateral diffusion of fluorescent labelled puroindoline in the plane of the adsorbed layer was observed at R=1 .5. Finally, the amount of adsorbed puroindoline decreased sharply in the R value range 1 to 3 although there were still low levels of puroindoline present in the interfacial layer up to approximately R= l O (Figure 8). The mechanism responsible for the enhancement of foaming properties is still unclear. However, it is evident that the enhancement is observed under conditions where both puroindoline and LPC are present in the interfacial layer. In addition, the protein is known to bind the lipid analogue. It seems likely that the complex formed has enhanced surface properties and this could have important technological significance. It is quite possible that this complex is present in bread dough and may play an important role during proofing and baking. In addition, it may be possible to exploit proteins such as puroindoline, which possess lipid binding activity in the development of novel food formulations or for improvement of existing foods. For example, the presence of low levels of egg yolk lipids in separated egg white seriously impedes foaming properties. It may prove possible to selectively remove extraneous yolk lipid by introduction of low levels of puroindoline. An alternative application is protection of beer foam against lipid-induced destabilization. Preliminary results have revealed that low levels of puroindoline that comprise only 1% ( 1 O-201ig!ml) of the total protein load present in beer, can restore the foaming properties to beer adulterated with stearic acid, phospholipids or triglycerides64. Similar results have been obtained concerning the foaming properties of egg white proteins adulterated with oil65. The negative effect of the oil on foaming properties can be negated by the presence of small quantities of puroindoline. 4. 3.2. Role of proteins in the adsorption and spreading of lipids at air-water inteifaces. As previously discussed, adsorption of bilayer liposomes to an air-water interface is not spontaneous and some defect such as inverted micelles have to be created at the contact interface to facilitate the spreading of lipids. Such structures can be induced at the surface ofbilayers by peptides and proteinsl2, 66 Theoretically this can be caused by proteins which exhibit a high affinity for non bilayer lipids. Such proteins will induce a lateral segregation and a local concentration of non bilayer lipids which can favour spreading. Such mechanisms have been described in the case of pulmonary surfactant proteins. Pulmonary surfactant is a mixture of phospholipids and proteins, which helps the lungs expand by lowering the surface tension at the air/liquid interface in the alveoli67. The main phospholipid component of lung surfactant is DPPC which has the ability to greatly lower the surface tension. However, DPPC does not exhibit rapid adsorption and spreading27. Other unsaturated phospholipids (PC, PE, PG) and some specific proteins contribute to increasing greatly the spreading kinetics68-69. It is interesting to note that the most efficient lung surfactant proteins are low molecular weight amphipathic proteins. For example, SP-B is an amphiphilic basic protein of 79 residues containing 7 cysteines, and structural characteristics reminiscent of those ofwheat lipid binding proteins68. We can speculate how LTPs can facilitate the exchange of lipids between the monolayer and the underlayer of liposomes, and such a mechanism has been postulated to explain the spreading of lipids as a monolayer25. Furthermore, these proteins, which act
Nature and Functionality o/Wheat Lipids. Lipid Binding Proteins and Added Emulsifiers
257
only on the outer bilayer lipid leaflets may facilitate in some cases, the transbilayer movement of phospholipids from the inner to the outer membrane leaflet 70. This would serve to increase the yield of lipid transferred from the inner bilayer to the monolayer at the air-water interface26. We have recently shown that such mechanisms involving wheat LTP depend on the surface pressure of the lipid monolayer44.
4.4. Gluten Viscoelasticity and Interfacial Behaviour of Polar Lipids Previous studies on the organisation and dynamics of lipids in gluten using both freeze-fracture electron microscopy and phosphorus NMR have clearly show that no interactions occur between the gluten proteins and lipid organised in sma1\ vesicles18. However, phosphorus NMR has shown that the viscoelasticity influences the dynamics of vesicles in gluten network 1 8. Therefore, we can imagine that the viscoelastic dough network serves only control the expansion of gas bubbles stabilized by lipoprotein films during proofing and baking. This view is supported by breadmaking experiments carried out by adding lipids to defatted wheat flour of good and poor qualities7 1-72. The loaf volume-lipid content curves exhibit quite similar shapes with only translation towards higher volumes or higher lipid content. Furthermore by interchanging components between good and poor quality flours variations in the curves reflect only differences in the proteins. 5.CONCLUSIONS: POSSmLE WAYS FOR THE IMPROVEMENT OF WHEAT QUALITY THROUGH ENGINEERING OF LIPIDS AND LIPID-PROTEIN INTERACTIONS Although we have still a fragmented view of the role of lipids in breadmaking technology and even most of the previously described mechanisms are still speculative, the recent data described here allow us to think about possible ways for improving the breadmaking quality of wheat through manipulation of lipids, especially wheat lipids. The simple fact that adding surfactants in breadmaking is always necessary to obtain good bread crumb texture means that the polar lipid content and composition of wheat are not optimal. In the future, the challenge wi1\ be to find the means of improving the surface properties of wheat polar lipids. The genetic route is less easy for lipids than for proteins, since many enzymes and therefore many genes are involved in the synthesis of polar lipid molecules. The best way of modifYing lipid structure is certainly through use of enzymes and especia1\y hydrolytic enzymes. In this regard lipases are good candidates because they are able to generate polar lipids - monoglycerides- from non polar triglycerides and detergent-like molecules from phospholipids and glycolipids (lysophospholipids, galactosylmonoglycerides) which are good improvers of bread volume and texture. However, the main drawback in the use of such enzymes is that they also generate free fatty acids. These lipid components are known to be deleterious to the quality of cereal products so that it is necessary to limit their presence in wheat doughs. Fina11y, one of the best pathways would be to improve the functionality of polar lipids through lipid binding proteins. For example, proteins such as puroindolines can act synergistically with polar lipids to improve the stability of lipoprotein films or to prevent the destabilization of protein foams by non polar lipids. Since these proteins are encoded by a single or a limited number of genes, it is possible to introduce these proteins in breeding programs. Furthermore, the transgenic approach offers fascinating opportunities for manipulation of the genes coding for such proteins in order to improve their expression, change their localisation and their functionality using directed mutagenesis. Increasing the
258
Wheat Structure. Biochemistry and Functionality
content of these proteins could also be a way to improve the effect of commonly used bread surfactants. As shown in the case of beer foam64, this could also avoid the negative effect of free fatty acids generated by the use of lipases.
References 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13.
PJ. Frazier, In 'Lipids in Cereal Technology' ed. P.l Barnes, Academic Press, New York, 1983, p. 189. l Nicolas and D. Drapron, in 'Lipids in Cereal technology', ed. PJ. Barnes, Academic Press, New York, 1983, p. 213. F . MacRitchie, in 'Lipids in Cereal technology', ed. P J . Barnes, Academic Press, New York, 1983, p. 165. D. Marion, in 'Cereal Chemistry and Technology: a Long Past and a Bright Future', ed. P.Feillet, IRTAC, Paris, 1992, p.57. D. Small, in Handbook of Lipid Research, Plenum Press, New York, 1986, vol. 4. V. Luzzati, in 'Biological Membranes', ed. D. Chapman, Academic Press, New York, 1968, p. 7 1 . SJ. Singer and G.L. Nicolson, Science, 1972, 175, 720. l M . Seddon, Biochim. Biophys. Acta, 1987,1031, 1 . G. Lindblom and L. Rilfors, Biochim. Biophys. Acta, 1989, 988, 22 1 . M.W. Tate, E.F. Eikenberry , D.C. Turner, E. Shyamsunder, and S.M. Gruner, Chem. Phys. Lipids, 199 1 , 57, 147. K Larsson and S . Puang-Ngern, in 'Advances in the Biochemistry and Physiology of Plant Lipids,' eds L.-A Appleqvist and C. Liljenberg, Elsevier, Amsterdam, 1979, p. 27. B. De Kruijff, P.R. Cullis, A.l Verkleij, MJ. Hope, CJ.A. Van Echteld, and T.F. Taraschi, in 'The Enzymes of Biological Membranes', ed. A.M. Martonosi, Plenum Press, New York, 1985, voU , p. 1 3 1 . S . Akoka , C . Tellier , C . Le Roux, and D . Marion, Chem. Phys. Lipids, 1988, 46,
43.
22.
T. Carlson, K Larsson, and Y. Miezis, Cereal Chem., 1978, 55, 168 T . Carlson, K Larsson, and S . Poovarodom, Cereal Chem., 1979, 56, 4 17. K Larsson, in 'Chemistry and Physics of Baking'. eds lM.V. Blanshard, PJ. Frazier, and T. Galliard, Royal Society of Chemistry Special Publication 56, London, 1986, p. 62. A. AI-Saleh, D. Marion, and DJ. Gallant, Food Microstruct., 1 986, 5, 1 3 1 . D. Marion, C. Le Roux, S. Akoka, C.Tellier, and D. Gallant, J. Cereal Sci., 1987, � 101. . D. Marion, C. Le Roux, C. Tellier, S. Akoka, D. Gallant, l Gueguen, Y. Popineau, and lP. Compoint, in 'Interactions in Protein Systems", eds KD. Schwenke and B. Raab, Springer Verlag, Berlin, 1989, p. 147 and p. 373. W.I. Vail and lG. Stollery, Biochim. Biophys. Acta, 1 979, 551, 74. E.W. Simon, in 'Dry Biological Systems', eds lH. Crowe and L.M. Crowe, Academic Press, New York, 1978, p. 205. WJ. Gordon-Kamm and P.L. Steponkus, Proc. Natl. Acad. Sci. U.S.A., 1984, 81,
23. 24.
F. MacRitchie and P.W. Gras, Cereal Chem., 1973, 50, 292. F.MacRitchie, J.Sci. Food Agric., 1977, 18, 53
14. 15. 16. 17. 18. 1 9. 20. 21.
6373.
Nature and Functionality of W!zeat Lipids, Lipid Binding Proteins and Added Emulsifiers
25. 26. 27. 28. 29. 30. 31. 32. 33. 34. 35. 36. 37. 38. 39. 40. 41. 42. 43. 44. 45. 46. 47. 48. 49. 50. 51. 52. 53. 54. 55. 56.
259
F. Pattus, P. Desnuelle, and R Verger, Biochim. Biophys. Acta, 1 978, 507, 62. H. Schindler, Biochim. Biophys. Acta, 1 979, 555, 3 1 6. RH. Notter, IN. Finkelstein and RD. Taubold, Chem. Phys. Lipids, 1 983, 33, 67. S-H. Yu , P. Harding, and F. Possmayer, Biochim. Biophys. Acta, 1 984, 776, 37. D. Rajapaksa, AC. Eliasson, and K. Larsson, J. Cereal Sci,. 1 983, 1, 53. AK. Balls and W.S. Hale, Cereal Chem., 1 940, 17, 243. D.G. Redman and lAD. Ewart, J.Sci Food Agric., 1 973, 24, 629. P.l Frazier, N.W.R. Daniels, and P.W. Russel-Eggit, J. Sci. Food Agric., 1 98 1 ,32, 877. U. Zawistowska, F. Bekes, and W. Bushuk, Cereal Chem., 1 985, 62, 284. F. Bekes, I . Smied, Acta.Alimentaria., 1 98 1 , 10, 229 lC. Kader, in 'Lipid Metabolism in Plants' ed 1.S.Moore Jr, CRC Press, Boca Raton, 1 993, p 309. A Desormeaux, lE. Blochet, M. Pezolet, and D. Marion, Biochim. Biophys. Acta 1 992, 1 121, 137. G.M. Polya, S. Chandra, R. Chung, G.M. Neumann, and P.B. H0j, Biochim. Biophys. Acta, 1 992, 101, 545. G.M. Neumann, R Condron, B. Svenson, and G.M. Polya, Plant Sci., 1 993, 92, 1 59. S. Tsuboi, 1. Suga, K. Takishima, G. Mamiya, K. Matsui, Y. Ozeki, and M. Yamada, J. Biochem., 1 991, 1 10, 823. L. Dubreil, L. Quillien, M.A. Legoux, lP. Compoint, and D. Marion, in 'Proceedings of the Wheat Kernel Proteins- Molecular and Functional Aspects', Universita della Tuscia, C.N.R. 1994, p. 33 1 . l Mundy and lC. Rogers, Planta, 1 986, 169, 5 1 . lP. Simorre, ACaille, D. Marion, D. Marion, and M. Ptak, Biochemistry, 1 991, 30, 1 1 600. E. Gincel, lP. Simorre, A Caille, D. Marion, M. Ptak, and F. Vovelle, Eur. J. BiochemiStry, 1 994, 226, 413. M. Subirade, C. Salesse, D. Marion, and M. Pezolet, Biophys. J. , in press. AHelenius and K. Simons, Biochim. Biophys. Acta, 1 975, 415, 29. C. Bordier, J. Bioi. Chem., 1 98 1 , 25, 1604. lE. Blochet, A Kaboulou; lP. Compoint, and D. Marion, in 'Gluten Proteins 1 990', eds W. Bushuk and R Tkachuk; American Association of Cereal Chemists, St Paul, Minnesota, 1 99 1 , p. 3 14. J.E. Blochet, C. Chevalier, E. Forest, E. Pebay-Peyroula, M.-F. Gautier, P. Joudrier, M. Pezolet, and D. Marion, FEBS Lett., 1 993, 329, 336 M.-F. Gautier, M.E. Aleman, A Guirao, D. Marion, and P. Joudrier, Plant Mol Bioi., 1 994, 25, 43 . M. Schiffer, C.H. Chang, and FJ. Stevens, Protein Engineer., 1 992, 5, 2 1 3 . lG. Fullington, J.Lipid Res., 1 967, 8, 609. C.B. Kee, Biochemistry, 1 988, 27, 6645 . M. Smallwood, IN.Keen, and OJ. Bowles. Biochem. J., 1 990, 270, 1 57. l Chen, E. Dickinson, and G. Iveson, Food Structure, 1 993, 12, 1 3 5 . E. Dickinson and C.M. Woskett, in 'Food Colloids' Royal Society of Chemistry Special Publication No.75, eds. R.D.Bee, lMingins, P.Richmond, 1 989, p. 74. D.K. Sarker, PJ. Wilde, and D.C. Clark, Colloids and Surfaces B: Biointerfaces, . 1 995, 3, 349.
260
Wheat Structure, Biochemistry and Functionality
57.
S.B. Sorensen, L.M. Bech, T.B. Muldlberg, and K. Breddam, MBAA Technical Quater. 1993, 30, 136. M. Coke, P.I. Wilde, E.I. Russell, and D.C. Clark, J. Colloid Interface Sci. , 1 990, 138 489. Z.I. Lalchev, P.I. Wilde, and D.C. Clark, J. Colloid Interface Sci. , 1 994, 167, 80. D.C. Clark, P.l Wilde, D. BerginK-Martens, A Kokelaar, and APrins, in 'Food Colloids and Polymers: Structure and Dynamics', Royal Society of Chemistry Special Publication. 1993, p.354. D.C. Clark, M. Coke, A R Mackie, AC. Pinder, and D.R Wilson, J. Collaid Intetjace Sci. , 1 990, 138, 207. Z. Gan, RE. Angold, M.R. Williams, P.R Ellis, lG. Vaughan, and T. Galliard, J. Cereal Sci., 1990, 12, 1 5 . P.I. Wilde, D.C. Clark, and D.Marion, J. Agric. Food Chem. , 1 993, 41, 1 570. D.C. Clark, P.I. Wilde, and D. Marion, J. Inst. Brew., 1 994, 100, 23 . F. Husband, P.I. Wilde, D. Marion, and D.C. Clark, in 'Food Macromolecules and Colloids', eds E. Dickinson and D. Lorient, Royal Society of Chemistry, Cambridge, 1 995, p. 285. C.IA Van Echteld, B. De Kruijff, A.I. Verkleij, l Leunissen-Bijvelt, and l De Gier, Biochim. Biophys. Acta, 1982,692, 1 26. Rl King Rl in 'Pulmonary Surfactant' eds. B. Robertson, L.M.G.Van Golde and lJ.Batenburg, Elsevier, Amsterdam, 1984, p. 1 . S. Hawgood and lA Clements, J. Clin. Invest. , 1 990, 86, 1 . S. Hawgood, B.I. Benson, l Schilling, D. Damm, lA Clements, and RT. White, Proc. Natl. Acad Sci. U.S.A., 1 987, 84, 66. K.WA Wirtz, lAF. Op Den Kamp, and B. Roelofsen, in 'Progress in Lipid Protein Interactions' eds A Watts A and lJ.H.H.M. De Pont, Elsevier, Amsterdam, 1986, p. 22 1 . F. MacRitchie, J.Food Technol, 1 978, 13, 1 87. F. MacRitchie, Bakers Dig., 1980, 54, 10.
58. 59. 60. 61. 62. 63 . 64. 65. 66. 67. 68. 69. 70. 71. 72.
STARCH LIPIDS, STARCH GRANULE STRUCTURE AND PROPERTIES
William R. Morrison Department of Bioscience and Biotechnology University of Strathclyde Glasgow Gl l XW
1
INTRODUCTION
Historically, lipids in cereal starches have aroused little interest1.3 because they are minor components of the starch granules, and apparently inert For example, lipids in wheat starch are exceptionally resistant to oxidation and chlorination,4 they do not articipate � in any of the biochemical and physical processes that affect dough properties and they can be extracted efficiently only by using hot polar solvent systems that partially disrupt granule organisation.6- 1 1 However, recent studies have shown that the lipids occur as inclusion complexes with amylose, located in amorphous domains within the granules, which do modify starch gelatinisation and swelling properties. These studies have also led to a more detailed model of starch granule organisation, but important questions concerning the biosynthesis of the granules have still to be addressed. Although this paper is primarily concerned with wheat starch, there are many references to starches from barley, which is very similar to wheat but often provides a better choice of samples for study.
2 CHEMICAL PROPERTIES
2.1 Amylose-Lipid Complexes in Starch Granules It has been known for some time that cereal starches contain small quantities of monoacyl lipids such as free fatty acids (FFA) 12 and lysophospholipids (LPL). 13'IS The fatty acid composition of the lipids is typically one-third saturated (palmitate > stearate) and two-thirds cis-unsaturated (linoleate > oleate > linolenate). 4-6.8. 1S Since FFA and LPL form inclusion complexes with amylose in which they are resistant to oxidation and to solvent extraction, it was naturally assumed that this was how they occurred in cereal starch granules,14. 19 although most properties of the starch granule lipids could be explained equally well if they were merely trapped in interstices within the granules. 17 Proof that amylose-lipid inclusion complexes do exist in native starch granules, and that they are not artefacts formed during starch isolation, was obtained eventually using 13C-CPIMAS-NMR, supplemented with other evidence. 20-23 Cis-unsaturated fatty acids and solvent-extracted starch-lipids are liquid at ambient temperature, and when mixed with dry amylose ( 1 :7) they do not give any solid-state cross-polarisation NMR signal. 2o.23 However, when an inclusion complex is formed the fatty acid chains are immobilised within the amylose helix, and they give a clear methylene carbon signal with a chemical shift of 3 1 ppm, while glucosyl C- l of am�lose gives a sharp peak at 1 03- 104 ppm characteristic of the V -helical conformation. 0.23 These features were found in spectra from non-waxy starches of barley,2° rice, maize, oats,22 and from the lintner residues of barley and wheat starches?1
262
Wheat Structure, Biochemistry and Functionality
It was also concluded from other evidence20 that lipid was not distributed uniformly throughout the amylose fraction, and that in all probability there are two types of amylose, namely lipid-complexed amylose (LAM) and lipid-free amylose (FAM) , For barley and wheat, LAM 7 x LPL content,20 and LPL can be taken as approximately 16.3 x starch phosphorus content 15 In the colorimetric assay for amylose24 that was used, apparent amylose (measured in the presence of starch lipids, which interfere with iodine binding) is the same as FAM, while the difference between total amylose (measured on delipidated starch) and apparent amylose is the same as LAM. It is generally assumed that the residue obtained on lintnerisation is from the acid resistant crystalline parts of amylopectin in a starch granule,25 and, by inference, that amylose is totally degraded, but in barley starches FAM and LAM are more resistant than 16) in the residue are derived from amylopectin?1 The shortest chains (CL amylopectin, while intermediate length chains (CL 46) are from FAM that has been partially hydrolysed and then retrograded into resistant double helices. The longest chains (CL 77- 1 30) are from the V-helical segments of LAM.21 The lintner residue of ball-milled wheat starch is comprised of similar residues from LAM and FAM.21 Many properties of amylose-lipid inclusion complexes (LAM) are quite different from those of water-soluble amorphous FAM.1.3 Amylose in the collapsed single helical (V-) conformation has six glucosyl residues per turn (with bulky ligands there are seven or eight), stabilised by hydrogen bonds between hydroxyl groups of adjacent glucos�l residues, i.e. 0-2 .... 0-3(2) and 0-2 . . . . 0-6(7), located on the outer surface of the helix. 6 The helix cavity is effectively a hydrophobic tube. The hydrocarbon chain of the fatty acid or lipid lies within the amylose helix, and is stabilised by van der Waals contacts with adjacent C(5)-hydrogens of amylose,27 but the polar ends of the lipid are not inside the helix cavity :3.27 Amylose complexes with most lipids are insoluble and amorphous (type I), but complexes with FFA and monoglycerides can be annealed into a semi-crystalline form (type II). Type I complexes, which are probably the form in most cereal starches20, generally dissociate at 94- 100°C when heated in water?8,29 Type II com�lexes, originally found in starches after gelatinisation/o dissociate at l 00_ 1 25°C.18,28,29,31, 2 Only the type II complexes give strong wide-angle X-ray diffraction patterns.29 =
=
=
=
2.2 Starch Isolation and Purification When studying the minor constituents of starches, such as lipids, it is essential to have very pure preparations5,11,33-38 to avoid misleading results due to artefacts and impurities_ It is well known that starch granules swell reversibly, according to their level of hydration, at temperatures well below the onset of gelatinisation. When this happens they can absorb monoacyl non-starch lipids (usually FFA, which can be confused with true starch lipids) and inorganic salts such as phosphates (phosphorus contentJ l,39 is then no longer an accurate measure of lipid phosphorus and hexose phosphate1 1,15). The granules can also retain traces of adsorbed proteins and other lipids which are normal non-starch components of the endosperm, Thus, the presence of diacylglycerolipids and triglycerides (which do not form inclusion complexes) reported in some starches is clear evidence of contamination with non-starch lipids.9 These considerations led to the recognition of two types of lipid artefacts that should be clearly distinguished from the true (internal or integral) starch lipids - namely, loosely associated non-starch lipids, and lipids absorbed into the surface layers of the granules,9 The nitrogen content of a starch sample is a useful index of gluten contamination (which also implies the presence of non-starch lipids), although well purified starches from soft wheat species still have small quantities of friabilins on their surface,40 In four purified wheat starches we found (per l 00g starch) 14- 1 9mg lipid N (from 592-794mg LPL), 3 .4-8.6mg surface N (from friabilins) and 1 3- 14mg integral N (from c, 80mg integral proteins which include granule-bound starch synthase),36
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
263
2.3 Amylose-Lipid Relationships Cereal starches are unusual, compared with root, tuber and pith starches, in that they contain monoacyl lipids (FFA and LPL) in amounts closely related to amylose (AM) content,IS In wheat, barley, rye and triticale the lipids are almost exclusively LPL, while in the other cereals they are comprised of characteristic proportions of FFA and LPL. IS In barley starches the fatty acid composition of the lipids becomes progressively more unsaturated as lipid content increases,41 but in wheat starches the fatty acid composition of the smaller granules (which contain more lipids) is more saturated than in the larger granules.42-44 In starches from wheat and barley harvested at various stages of grain development, both amylose and LPL contents increase with maturity, and this has given us a model of a large A-type starch granule that has gradients (from the hilum to the periphery) of increasing amounts of amylose and LPL.3S.4S-47 To extend our studies of the am lose-lipid relationship we also used starches from J F barley (normal x high-amylose) and maize (normal x waxy, normal x amylose 2 extenderi7 to obtain gene dosage effects, and starch from grain grown at different temperatures49.SO (the most important component of site/environmental variation affecting amylose and lipid contents, and starch properties). Different regressions were required to describe the amylose-lipid relationships in starches from mature diploid cereals, from waxy and non-waxy barleys, and also in starches taken at various stages of grain development,2o.s 1 In practice, this means that starches from waxy barleys and from all types of maize have variable amounts of amylose comprised of FAM and LAM in constant proportions, while non-waxy barley and wheat starches have an additional increment of FAM.sI Typical FAM and LAM contents are <5.2% of each ( 1 : 1) for waxy barley starches, 20.3-25.9% FAM and 4.48.3% LAM for non-waxy barley starches, and 21 .5-25.9% FAM and 5.0-7. 1 % LAM for wheat starches. Several interesting questions remain to be answered concerning the biochemistry of LAM.sI Monoacyl lipids are usually associated with deterioration and lipolysis, and LPL are potentially harmful because they can cause lysis of cell membranes - so why are these lipids accumulated in normal healthy cereal starch granules? If the composition of the starch lipids indicates that they can not be formed by simple partial hydrolysis of amyloplast lipids (e.g. there are no monoacylgalactosylglycerides in any pure cereal starch, and no FFA in Triticeae starches), how are they formed? Is LAM synthesised in parallel with FAM (i.e. compartmentalised) or sequentially (by saturating of fraction of FAM with lipid subsequently)? The starch lipids, which are not readily mobilised on germination, represent only a small part of the total fatty acids in the grain, and the phosphorus content of the LPL is small compared with reserves in phytate, hence it is most unlikely that these lipids are storage reserves. Also, it no longer seems possible that starch lipids serve as primers or terminators of amylose synthesis, or that they are part of a lipoprotein complex with granule-bound starch synthase37 - so what is their natural function (bearing in mind that most waxy starches have negligible lipids)?
3
PHYSICAL PROPERTIES
3.1 Gelatinisation and Swelling Since amylose-complexing lipids and surfactants affect starch gelatinisation and swelling, 16.17 it was decided to study the effects of the native starch lipids on these In this context it was essential to exploit natural variations in starch properties. composition and properties (above), because treatments to extract starch lipids,1O or adding lipids (intentionally or artefactually), can alter starch 2ranule structure and crystallinity (e.g. by partial gelatinisation and/or annealingyr·IO.11.49.S2�4 and hence invalidate conclusions concerning native starch granules. Gelatinisation and swelling are comparatively simple primary events that can be
264
Wheat Structure, Biochemistry and Functionality
related to several aspects of starch granule composition and structure (below), whereas pasting, gel rheology, and retrogradation are much more complex properties that relate less directly to the primary structure of the starch granule. The gelatinisation endotherm obtained by differential scanning calorimetry is an overall measure of the progressive loss of lon -, medium- and short-range order in starch granules as they are heated in excess � water. Ge1atinisation temperature (GT) is a qualitative index of crystallite structure, while gelatinisation enthalpy (Mf) is a quantitative measure of order. Order derives from crystallites formed by the packing of clusters of double helices, composed of pairs of the 8 external ends of A- and B-chains of amylo ectin.3,25,55 .5 All evidence indicates that g amylose (i.e. FAM and LAM) is amorphous. 5 GT, and to a lesser extent Mf, may be affected quite strongly by plant growth . temperature and seasonal effects,47.49 50,59,60 and hi her temperatures sometimes cause � substantial increases in LAM and FAM contents. 9,50,54,59,60 We have found that the natural range of wheat starch GT, which is probably determined by ambient temperature during grain filling, can account for significant variations in oven spring, bread loaf volume, and rate of crumb firming during staling,61 and this may be a hitherto unrecognised quality factor in wheat. It is normal practice to measure the gelatinisation enthalpy (�H) of starch without taking into account its amylopectin content, but when this is done, the enthalpy of disordering of the amylopectin fraction, Mf(AP), is found to be very similar for near isogenic waxy and non-waxy lines in which amylopectin structure should be identical.20,49,62,63 If free (added) lipids capable of forming inclusion complexes with FAM are present during starch gelatinisation, the exothermic heat of complex formation partially offsets the simultaneous endothermic heat of amylopectin gelatinisation, but this does not happen with native starch granule lipids because they are already part of the LAM complex.20 In some studies, using sets of starches (e.g. waxy and non-waxy barleys) in which amylopectin structure was effectively constant, small increases in GT could be attributed to the effect of LAM content (which would not dissociate at these temperatures), while FAM appeared to have an opposite effect by promoting granule disordering and lowering GT. 20 Thus, variation in the proportions of LAM and FAM in a cereal starch could have some effect on GT, although variations in amylopectin crystallinity are always likely to have a much greater effect. At temperatures below GT, starch granule swelling in response to absorbed water content is reversible on subsequent drying because there has been little disturbance of the ordered regions in the granule, but it is not reversible above GT due to irreversible loss of crystalline order in the swollen gel. However, some undefined order is retained in the gelatinised starch gel (unless it is disrupted mechanically) , because swelling power is temperature-dependent and reproducible. We use a blue dextran dye exclusion method to measure true granule swelling,63 since older water uptake methods do not distinguish between water within the swollen granules (gel) and water in the interstices between the swollen granules. Swelling is primarily a property of intact amylopectin molecules.63,64 It can be reduced by slight acid hydrolysis, which is presumably fairly random, but the endo-acting enzyme a.-amylase evidently reaches particularly sensitive sites within the amylopectin molecule (in gels) because swelling power can be destroyed by extremely low levels of enzymic hydrolysis.64 Since swelling power above GT is primarily a property of amylopectin, like gelatinisation enthalpy (above), it is useful to compare swelling factors (normally at 70° or at 80°C for wheat and barley starches) for the amylopectin fraction, i.e. SF(AP). Swelling of normal undamaged starches above GT is accompanied by the leaching into solution of part of the FAM fraction20,63,65,66 and there is negligible amylopectin or LAM in the supernatant unless the gel breaks up (spontaneously in the case of some barley starches, or by mechanical disruption). At 95- 100°C most LAM dissociates into soluble FAM and dispersed lipid.20,66 Soluble material does not contribute to the measured swelling factor (blue dextran method63) of the starch gel. In small sets of starches SF(AP) was negatively correlated with lipid content, so we
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
265
concluded that FAM was an inert diluent and that swelling was inhibited by LAM.41 .49.62.63.67 However, when results for a large set of barley starches were examined the data could not be described by a simple linear correlation, but required an equation which implies that swelling was due to amylopectin plus the unleached fraction of FAM, while LAM inhibited swelling. 20 An active role for FAM in swelling above GT seems quite likely, in view of its probable role in the reversible swelling at ambient temperatures of undamaged and damaged granules (below).
3.2 Damaged Starch It is well known that when physically (mechanically) damaged starches are placed in cold water they swell spontaneously giving a gel that is non-birefringent. In many respects this process could be described as cold gelatinisation, and it was therefore of interest to extend our studies of starch gelatinisation and swelling by heating to include the roles of AP, FAM and LAM in the swelling of physically damaged starches. The method we used to determine damaged starch,67 which is almost identical to one developed concurrently in Australia,68 is based on the rapid hydrolysis to glucose of the gel and soluble material produced by hydration of the damaged fraction, followed by enzymic assay of glucose. The method is an adaptation of our standard assay for any (X glucan,69 without the starch gelatinisation step, and it is effectively a small-scale version of the standard AACC method. The initial enzymic hydrolysis step can also be used to remove damaged material from starch samples, so that undamaged (native) starch granules and birefringent remnants of granules that had been partially damaged can be recovered.7°-73 For most of our work we used ball-milling of dry starches to obtain controlled levels of damage, but very similar results were obtained with wheat flour millstreams containing various levels of damaged starch. In the 9ry state physical damage causes loss of crystallinity (measured by an X-ray method)/o,74 double helix content (measured from \3C-CPIMAS-NMR spectra), and all order contributing to the DSC endotherm?O Examination of wheat and maize starches (after removal of damaged starch with fungal amylase) by Coulter Multisizer and scanning electron microscopy indicated that small B-granules of wheat starch are more susceptible to damage than large A-granules, and where granules are partially damaged this occurs preferentially towards the centre.71 It was suggested that the curved shape of concentric crystalline shells in the granule (see model, discussed below) focuses shock waves towards the centre which has less crystallinity than the periphery, and hence is more readily damaged.7 1 ,72 Chemical analysis shows that amylose is scarcely affected by physical damage to the granule, but amylopectin (AP) is progressively degraded to low molecular weight fragments (LMWAP).72.75 On hydration below GT, the solubles are comprised of LMWAP and a little FAM, while the gel is comprised of AP, residual LMWAP, most of the FAM, and all of the LAM.72,73 Above GT the solubles contain all of the LMWAP 1 most of the FAM, and a little AP, while the gel consist of the remaining AP and LAM.7 Swelling factors calculated for the various fractions indicate that only AP and unleached FAM contribute to gel volume, and that swelling depends on both the temperature of hydration and the extent to which AP structure was "loosened" during ball-milling.72,73 In contrast to undamaged starches, swelling is not inhibited by LAM. Maximum swelling factors of the gel from the most severely damaged starch samples approach the swelling factors of roller-dried starch.73
3.3 A Modified Model of Starch Granule Structure Current concepts of starch granule structure1 .3,25,30,56-5 8,76 are not adequate to explain all of our results, and several modifications have been proposed. Strictly, these apply only to the large A-type granules of wheat and barley starches which were used in most of our work, but they are probably valid for most other normal cereal starches. In many plant species the amylose content of starch increases as it accumulates.77 In wheat 1 8,35,48 and barley45,46 the numbers of large A-granules remain nearly constant
266
Wheat Structure, Biochemistry and Functionality
Figure 1 Model of a starch granule comprising essentially
continuous concentric shells of crystalline (ordered) amylopectin, possibly forming a spiral layer, separated by broad amorphous zones of FAM, lAM and some amylopectin.
",
crystalline amylopectin amorphous amylose
(FAM + LAM)
Figure 2 Model ofpart of an amylopectin molecule showing possible fracture points following mechanical damage. Crystalline domains formed by double helices are shaded grey, and a-I, 6-glycosidic branch points are shown by small arrow heads. All detail in this figure is contained within a single crystalline shell shown in figure 1. A break in a B2, B3 or B4 chain traversing the narrow amorphous zone between two consecutive clusters of helices at position a is most likely, and would give multibranched IMWAP of DP > 50. Breaks at positions b and c are unlikely, and would give fragments of DP < 30. Single reducing terminus on C-chain at this end of molecule
crystalline domain
narrow amorphous zone
crystalline domain
external ends of chains in double helices � direction of shear
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
267
throughout the later stages of starch deposition, so that changes in composition are due to much higher proportions of amylose and lipid phosphorus (and hence FAM and LAM) in the outer layers of the granule. Evers' studies of developing A-granules in wheat show that starch is deposited mostly on the surfaces parallel to the equatorial plane,78 and we concluded3� .4�.47 that there are asymmetric gradients (from hilum or core to periphery) of AP (decreasing), and of FAM and LAM (increasing). These gradients may explain the characteristic distortion of wheat and barley A-granules granules when they swell in hot water above GT.63 There is also optical birefringence evidence for an anisotropic distribution of crystallini in the amylopectin fraction, increasing in a similar manner towards the periphery, .�6 although some authors contend that the oriented molecules are in the amorphous zones.79 Small increases in gelatinisation temperature and enthalpy with granule maturity in waxy and normal barley starches4 are consistent with this observation, and we believe that there are probably gradients of increasing physical ordering (in decreasing amounts of AP) from the hilum to the periphery, comparable with the quantitative gradients of AP, FAM and LAM described above. Consequently, the centre of the granule is the preferred site for localised physical damage, enzymic digestion, hydration, and leaching of solubles. I .2�.7 1 It is generally accepted that starch granules have alternating layers of crystalline and amorphous material arranged concentrically around the hilum, and that crystallinity is a property of the amylopectin fraction. In our model (Figure 1 ) radially oriented amylopectin molecules form essentially continuous concentric shells of crystalline material traversed by narrow amorphous bands where the chain branch points are concentrated.70 The novel point here is that the continuity, and hence the strength, of these concentric shells can explain several observations (below). All FAM and LAM, and some AP, are located in the broad amorphous zones between the shells, but some physical connections between adjacent amorphous material and a crystalline shell are possible - for example, through AP molecules which could traverse both regions. 2� Several authors have suggested that parts of FAM molecules could form short double helices with external chains of AP in the crystalline shells,3.�6 but leaching experiments66 indicate that the majority of the FAM must be amorphous and unconnected, or, the postulated helical sections must be very easily dissociated during hot leaching. At present it is not obvious how individual V-helices of LAM could form links, other than by entanglement (as in a gel) with AP from the crystalline shell, but some connections are implied by the fact that LAM raises GT slightly and strongly inhibits the swelling of AP in gelatinising starch granules. The resistance of the surface of undamaged granules to digestion by endo-acting enzymes such as fungal amylase (as used in assays for damaged starch) is attributed to a substantially perfect crystalline layer formed by external chains of amylopectin in which only the terminal glucosyl residues are accessible.70 This implies that there is negligible amorphous LAM or FAM on the surface, and no long protruding ends of amylopectin molecules, as has been suggested. 7� Our model is also consistent with the observation that amyloglucosidase (an exo-acting enzyme that hydrolyses single glucosyl residues from the non-reducinf ends of (X.-glucan chains) acts at a rate proportional to starch specific surface area. � Since granules can swell and shrink reversibly below GT according to the level of hydration, with no change in crystallinity, swelling is attributed to the broad amorphous zones2�.�6 in which the components that swell will consist of FAM and possibly a little AP. We believe that swelling is limited because it is severely constrained by the essentially continuous shells of crystalline AP, and it is reversible because the crystalline shells are not disturbed to any extent.70.72 When a granule is fractured to give birefringent remnants (one form of physical damage), FAM and AP in the broad amorphous zones at the newly exposed fracture surfaces hydrate more readily and with less constraint from the broken shells of crystalline AP, so that birefringent remnants swell more than undama�ed granules, and they gelatinise at a lower temperature and with less enthalpic change. It is also suggested that the forces causing physical damage are translated internally
�
Wheat Structure, Biochemistry and Functionality
268
into tangential shear forces which act across the radially oriented axes of amylopectin molecules and crystallites,7o,n This causes amylopectin to break at the most exposed glycosidic bonds in the narrow amorphous bands between crystallites to give LMWAP fragments (Figure 2),12 as well as causing complete disordering either locally or throughout the granule.71 The newly formed amorphous material in damaged starch hydrates and swells freely at ambient temperature because, unlike amorphous starch in the broad amorphous zones of native granules, it is not constrained by crystalline shells.no73 Evidently, the links between LAM and gel-forming components in native starch-Rranules are rather tenuous, since LAM does not inhibit swelling of damaged starch72. as it does in undamaged granules. 4 CONCLUSIONS Various amylose-lipid relationships have been found in starches from mature cereal species, and from wheat and barley at several stages of grain (and starch granule) development. The starch lipids are fully complexed with a fraction of the total amylose, and hence there are two amylosic fractions (LAM and FAM), which have been shown In native granules much of the AP is in concentric to have contrasting properties. crystalline shells, but there is probably also some AP (together with LAM and FAM) in the broad amorphous zones between the shells. Physical damage to starch granules converts crystalline AP into amorphous AP, with formation of some LMWAP fragments. Thus, there may be only two polysaccharide fractions (crystalline and amorphous AP in native waxy starches), or as many as five polysaccharide fractions (crystalline AP and amorphous AP, LMWAP, FAM and LAM in a sample of damaged non-waxy starch) that affect gelatinisation and swelling properties. Gelatinisation and subsequent swelling of native (undamaged) starch granules heated in water is primarily a property of amylopectin, affected in opposite ways by LAM (inhibition) and FAM (promotion). In practice plant growth temperature, and to a lesser extent differences between growing seasons, are also significant sources of variation through their effects on AP crystallinity, and on LAM and FAM contents. Swelling of physically damaged starch granules in cold water is due to spontaneous gel formation by amorphous AP and FAM, with little contribution from LMWAP (which is mostly soluble), and there is no inhibition from LAM. A modified model of the structure of a starch granule is proposed to explain these observations. References 1. 2. 3. 4. 5. 6. 7. 8. 9. 1 0. 11.
W. Banks and C. T. Greenwood, 'Starch and its Components ' , Edinburgh University Press, Edinburgh, Scotland, 1975. R. L. Whistler, J. N. BeMiller and E. F. Paschall, ' Starch: Chemistry and Technology', 2nd edn., Academic Press, New York, 1 984. H. F. Zobel, ' Developments in Carbohydrate Chemistry', R. J. Alexander and H. F. Zobel (eds.), Am. Assoc. Cereal Chern., St. Paul, MN . , 1992, p. 1 . W. R . Morrison, 1. Sci. Food Agric., 1 978, 29, 365. D. L . Mann and W . R. Morrison, 1. Sci. Food Agric. , 1 974, 25, 1 109. W. R. Morrison, D. L. Mann, S. Wong and A. M. Coventry, 1. Sci. Food Agric. , 1 975, 26, 507. H. Bolling and A. W. EI Baya, Chem. Mikrobiol. Technol. Lebensm. , 1 975, 3, 161. W . R . Morrison, S. L. Tan and K . D . Hargin. 1. Sci. Food Agric. , 1 980, 31, 329. W. R. Morrison, Starch/Stiirke, 1 98 1 , 33, 408. W. R. Morrison and A. M. Coventry, Starch/Stiirke, 1 985, 37, 83. W. R. Morrison, 'Modern Methods of Plant Analysis, New Series' , Vol. 1 4, Seed Analysis, H. F. Linskens and J. F. Jackson (eds.), Springer-Verlag, Heidelberg, 1 992, p. 1 99.
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
12. 13. 14. 15. 16. 17. 18. 19. 20. 21. 22. 23. 24. 25. 26. 27. 28. 29. 30. 31. 32. 33. 34. 35. 36. 37. 38. 39. 40. 41. 42. 43.
44.
45. 46.
47. 48. 49. 50.
269
T. 1. Schoch, J. Am. Chem. Soc. , 1 942, 64, 2954. A. Nakamura, T . Kono and S . Funahashi, Bull. Agric. Chem. Soc. Japan, 1958, 22, 320. L. Acker, Fette Seifen Anstrichm. , 1977, 79, 1 . W. R. Morrison, J. Cereal Sci. , 1988, 8, 1. W. R. Morrison, Adv. Cereal Sci. Technol. , 1 978, 2, 22 1 . W. R. Morrison and T. P. Milligan, 'Maize: Recent Progress in Chemistry and Technology', G. E. Inglett (ed.), Academic Press, New York, 1 982, p. 1 . W. R. Morrison, 'New Approaches to Research on Cereal Carbohydrates. Progress in Biotechnology' , Vol. 1 , R. D. Hill and L. Munck (eds.), Elsevier, Amsterdam, 1985, p. 6 1 . W. R. Morrison, 'Wheat: Chemistry and Technology' , 3rd edn., Vol. 1 , Y. Pomeranz (ed.), Am. Assoc. Cereal Chern., St. Paul, MN., 1988, p. 373. W. R. Morrison, R. F. Tester, C. E. Snape, R. Law and M. J. Gidley, Cereal Chem. , 1993, 70, 385. W . R . Morrison, R. F. Tester, M . J . Gidley and J . Karkalas, Carbohydr. Res. , 1993, 245, 289. W. R. Morrison, R. V. Law and C. E. Snape, J. Cereal Sci., 1 993, 18, 107. C. E. Snape, W. R. Morrison, M. Marota-Valer, J. Karkalas and R. A. Pethrick, J. Am. Chem. Soc. , 1 995, in press. W. R. Morrison and B. Laignelet, J. Cereal Sci., 1983, 1, 9. D. French, 'Starch Chemistry and Technology' , 2nd edn., R. L. Whistler, 1. N. BeMiller and E. F. Paschall (eds.), Academic Press, New York, 1 984, p. 1 83. G. Rappenecker and P. Zugenmaier, Carbohydr. Res. , 1981, 89, 1 1 . M. C. Godet, V. Tran, M. M. Delage and A. Buleon, Int. J. BioI. Macramol. , 1 993, 15, 1 1 . S. Raphaebdes and J. Karkalas, Carbohydr. Res. , 1988, 172, 65. C. G. Biliaderis, Can. J. Physiol. Pharmacol. , 199 1 , 69, 60. H. F. Zobel, Starch/Starke, 1 988, 40, 1 . M . Kowblansky, Macromolecules, 1985, 18, 1776. 1. Karkalas, S. Ma, W. R. Morrison and R. A. Pethrick, Carbohydr. Res. , 1995, in press. J. B. South and W. R. Morrison, J. Cereal Sci., 1 990, 12, 43. A. B. Soulaka and W. R. Morrison, J. Sci. Food Agric. , 1 985, 36, 709. W. R. Morrison and H. Gadan, J. Cereal Sci., 1987, 5, 263. B. D. Sulaiman and W. R. Morrison, J. Cereal Sci., 1990, 12, 53. J. B. South, W. R. Morrison and O. E. Nelson, J. Cereal Sci. , 1 99 1 , 14, 267. W. R. Morrison and J. Karkalas, 'Methods in Plant Biochemistry' , Vol. 2, Carbohydrates, P. M. Dey (ed.), Academic Press, London, 1990, p. 323. W. R. Morrison, Anal. Biochem. , 1964, 7, 218. W. R. Morrison, P. Greenwell, C. N. Law and B. D. Sulairnan, J. Cereal Sci. , 1 992, 15, 143. R. F. Tester and W . R. Morrison, Cereal Chem., 1 992, 69, 654. P. Meredith, H. N. Dengate and W. R. Morrison, Starch/Starke, 1 978, 30, 1 19. H. Gadan, PhD thesis, University of Strathclyde, 1984. A. B. Soulaka, PhD thesis, University of Strathclyde, 1 984. A. M. L. McDonald, J. R. Stark, W. R. Morrison and R. P. Ellis, J. Cereal Sci., 1 99 1 , 13, 93. A. H. Schulman, R. F. Tester, H. Ahokas and W. R. Morrison, J. Cereal Sci. , 1 994, 19, 49. W. R. Morrison, 'Wheat is Unique', Y. Pomeranz (ed.), Am. Assoc. Cereal Chern., St. Paul, MN. 1989, p. 193. W. R. Morrison, 'Cereals in a European Context', I. D. Morton (ed.), Ellis Horwood, Chichester, 1987, p. 438. R. F. Tester, 1. B. South, W. R. Morrison and R. P. Ellis, J. Cereal Sci. , 199 1 , 13, 1 1 3. R. F. Tester, W. R. Morrison, R. H. Ellis, 1. R. Piggott, G. R. Batts, T. R.
Wheat Structure, Biochemistry and Functionality
270
51. 52. 53. 54. 55. 56. 57. 58. 59. 60. 61. 62. 63.
64.
65. 66. 67. 68. 69. 70. 71. 72. 73. 74. 75. 76. 77. 78. 79.
Wheeler, J. I. L. Morison, P. Hadley and D. A. Ledward, 1. Cereal Sci. , 1 995, in press. W. R. Morrison, ' Seed Storage Compounds: Biosynthesis, Interactions and Manipulation' , P. R. Shewry and A. K. Stobart (eds.), Oxford Univ. Press, Oxford, 1 993, p. 1 75. B . R. Krueger, C. A. Knutson, G . E. Inglett and C. E . Walker, 1. Food Sci. , 1987,
52, 7 1 5.
W. R. Morrison, T. P. Milligan and M. N. Azudin, 1. Cereal Sci. , 1 984, 2, 257. W. R. Morrison, D. C. Scott and J. Karkalas, Starch/Starke, 1986, 38, 374. D. Cooke and M. J. Gidley, Carbohydr. Res. , 1 992, 227, 103. J. M. V. Blanshard, ' Starch Properties and Potential' , T. Galliard (ed) . , John Wiley, Chichester, UK, 1987, p. 1 6. R. E. Cameron and A. M. Donald, Polymer, 1992, 33, 2628. P. J. Jenkins, R. E. Cameron and A. M. Donald, Starch/Starke, 1993, 45, 4 17. W. R. Morrison and M. Nasir Azudin, 1. Cereal Sci. , 1 987, 5, 35. Y.-c. Shi, P. A. Seib and J. E. Bernardin, Cereal Chem., 1 994, 71, 369. A. B . Soulaka and W . R. Morrison, 1. Sci. Food Agric., 1 985, 36, 7 1 9. R. F. Tester and W. R. Morrison, 1. Cereal Sci. , 1 993, 17, 1 1 . R. F. Tester and W. R. Morrison, Cereal Chem., 1 990, 67, 55 1 . R. F. Tester and W. R. Morrison, Cereal Chem. , 1990, 67, 558. D. R. Prentice, J. R. Stark and M. J. Gidley, Carbohydr. Res. , 1 992, 227, 1 2 1 . P. A. Seib, Oyo Toshitsu Kagaku, 1 994, 41, 49. J. Karkalas, R. F. Tester and W. R. Morrison, 1. Cereal Sci. , 1 992, 16, 237. T. S . Gibson, H. Al Qalla and B . V. McCleary, 1. Cereal Sci. , 1 992, 15, 1 5. J. Karkalas, 1. Sci. Food Agric. , 1 985, 36, 1019. W. R. Morrison, R. F. Tester and M. J. Gidley, 1. Cereal Sci., 1 994, 19, 209. R . F . Tester, W. R . Morrison, M . J . Gidley, M . Kirkland and J. Karkalas, 1.
Cereal Sci. , 1 994, 20, 59.
W. R. Morrison and R. F. Tester, 1. Cereal Sci. , 1994, 20, 69. R. F. Tester and W. R. Morrison, 1. Cereal Sci. , 1994, 20, 1 75. J. Le Lievre, Starch/Starke, 1974, 26, 85. J. R. Stark and A. Lynn, Biochem. Soc. Trans. (UK), 1992, 20, 7. A. Imberty, A. Buleon, V. Tranh and S. Perez, Starch/Starke, 1 99 1 , 43, 375. J. C. Shannon and D. L. Garwood, ' Starch: Chemistry and Technology' , R. L. Whistler, J. N. BeMiller and E. F. Paschall (eds.), Academic Press, New York, 1 984, p. 25. A. D. Evers, Starch/Starke, 1 97 1 , 23, 1 57. H. F. Zobel, Starch/Starke, 1988, 40, 44.
MONOCLONAL ANTmODIES AGAINST WHEAT GLYCOLIPIDS : NEW TOOLS TO INVESTIGATE MECHANISMS OF GAS RETENTION IN BREAD DOUGH
Z. Gan and J.D. Schofield The University of Reading Department of Food Science and Technology PO Box 226, Whiteknights Reading RG6 6AP, United Kingdom
1 INTRODUCTION Gas cell stabilisation and gas retention in bread doughs are of considerable technological importance; the mechanisms are not well defined, however 1,2. Gluten proteins clearly make an important contribution to the gas holding capacity of dough, but recent studies have indicated that surface active materials, such as wheat non-starch polar lipids and proteins in the dough aqueous phase, may also play a significant role in gas cell stabilisation and gas retention2. They are thought to stabilise interfacial films at gaslliquid interfaces in bread doughs during yeast fermentation and baking2.3. Direct experimental proof is lacking, largely due to difficulties in investigating the organisation and distribution of lipids and surface active proteins in food systems. Monoclonal antibodies (Mab) could provide a valuable tool for studying the functional role of such components in bread making. Recently we demonstrated the immunogenicity of wheat mono galactosyldiglyceride (MGDGt. Here we describe the development and use of an ELISA technique for the detection and characterisation of a high-titre anti-MGDG Mab. 2 EXPERIMENTAL 2.1
Monoclonal Antibody Production
Female Balb/c mice were immunised using wheat MGDG4. Hybridomas were produced by polyethylene glycol (pEG)-aided (50%, w/v, PEG 4000 in RPMI 1 640 medium) fusion of the harvested spleen cells with mouse Sp2/0-Ag1 4 myeloma cells. Briefly, 1 x 1 08 immune spleen cells were fused with 1 x 107 - 1 X 108 Sp2 myeloma cells by dropwise addition of 50% (w/v) PEG (I mL) over 1 min. This was followed by the addition of RPMI 1640 medium (5 mL) over a 3 min period, and, finally, RPMI 1 640 medium (14 mL) was added over 2 min. The fused cells were centrifuged at 200g for 5 min and resuspended in HAT (hypoxanthine-aminopterin-thymidine) selective medium (30 mL). This cell suspension was distributed 0. 1 mL per well in �hree 96-well plates, which had been seeded previously with normal mouse macrophages, and incubated at 37° C in an atmosphere of 5% CO2. 1 0-14 days after fusion, the hybridoma cells were screened by enzyme-linked immunosorbent assay (ELISA). Positive cells were expanded
272
Wheat Structure. Biochemistry and Functionality
and cloned by limiting dilution. Useful amounts of Mab were finally obtained in vivo in ascites fluid. 2.2
Development of an ELISA Technique for Anti-MGDG Antibody Detection
The optimum antigen concentration was determined by draughts (checker) board experiments, and the optimum temperature was determined by comparing antibody binding reactivity at 4°C, 20°C or 37°C. These temperatures were chosen because they represent the most commonly used assay temperatures in anti-glycolipid antibody (aGL) studiess-s . In the final ELISA protocol4, microtitre plates were coated by incubating with lipid antigen (3 1 .3 llg/mL ethanol, O.OS mL per well) overnight at 4°C. All subsequent incubations were carried out at 37°C for 60 min. PBS was used for washing and SuperBlockTM in PBS used as blocking agent. Mab isotypes were determined using antigen-mediated ELISA reported elsewhere4. Possible involvement of plasma cofactors in anti-MGDG antibody binding was assessed in a modified ELISA using affinity purified MG40S with 0.3% (w/v) gelatin as antibody diluent and blocking agent. 2.3
Antibody Purification
MG40S was purified using an affinity column containing immobilised goat anti-mouse IgM. The Mab was dialysed against I .2SM NaCl, 0.02M Tris-HCl, pH 7.4, 0.02% (w/v) sodium azide overnight at 4°C before being diluted with an equal volume of Mouse IgM Binding Buffer. The diluted sample (2 mL) was then applied to the affinity column, which had been equilibrated with the Mouse IgM Binding Buffer. Unbound proteins were removed from the column by extensive washing with Binding Buffer (approximately 25 mL). The bound IgM was eluted using AbZorb™ IgM Elution Buffer; 2 mL fractions were collected, mixed with Neutralisation Buffer and the absorbance measured at 280 nm. The protein fractions were pooled and concentrated using Centricon- l 00 Concentrators to a final concentration of approximately 2.5 mg/mL. 2.4
Preparation and
I3
C NMR Characterisation of Galactosylglycerol
Galactosylglycerol (monogalactosylglycerol, MGG) was prepared by saponifying wheat MGDG (10 mg) in 1M KOH in 95% ethanol (O.S mL) overnight at 2 1 °e. After dilution with deionised water (O.S mL) and adjustment of the pH to 6.8, the aqueous phase was extracted with diethyl ether (3 x O.S mL). After de-salting the aqueous phase on a mixed-bed ion exchange resin, the identity of the product was verified by 13C nuclear magnetic resonance (NMR) spectroscopy using a JEOL (JNM-EX400) FT NMR spectrometer. Data were acquired over 30, 1 20.5 Hz into 32,768 data points at room temperature (about 23°C). A DEPT (distortionless enhancement by polarisation transfer) spectrum was also obtained to distinguish carbon resonances of the CH2 and CH groups. 2.5
Antibody Specificity
Cross reactIvIty was assessed using L-a-phosphatidy1choline and L-a phosphatidylethanolamine, which represent the major classes of wheat phospholipids.
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
273
Antigenic specificity was determined in inhibition studies using various concentrations of MGDG, MGG, galactose, glycerol or a mixture of fatty acids as inhibitor. Results are expressed as percentage inhibition ofMGDG binding reactivity. 3 RESULTS
Establishment and Optimisation of an ELISA for MGDG
3.1
3. 1. 1 Optimum Antigen Concentration. The greatest distinction between the binding reactivity of MG405 and that of the negative control was observed at an antigen concentration of about 3 1 .3 IlglmL (Fig. 1 ). This concentration was used subsequently as optimal in the final ELISA protocol. Normal mouse serum produced some slight background colour compared with 1 0% (v/v) FBS alone. 0 30
.
r ··
r
--' 0 25 e-_
�
j
0.15
0.10
0 05
0 00
I
\.
"-
._._.
._._.
•
•
,
'.,
-
·-·-.-:�i .-.
;'0��)-C�)oooC>-4:)-()
• • • • • • • • •
•
-\
. .
•
125 82.5 31.3 15.6 7.6
•
•
•
•
•
•
•
3.9 1.95 0.96 0.48 0.24 0.12 0.06
MGDG concentration (lIg1ml)
•
Figure I. Binding reactivity of MG405 (culture supernatant) to wheat MGDG at various concentrations of the latter. The culture supernatant was diluted 1.' 20 with either 10% (v/v) FBS (e) or with 10% FBS containing 0. 05% Tween 20 (0). Resultsfor normal mouse serum (.) and 10% (v/v) FBS control (dotted line) are also shown.
0
3. 1.2 Effect of Detergent. The use of 0.05% (w/v) Tween 20 in antibody diluents has been reported to enhance antilipid antibody binding9, 10 . In contrast, we observed that it reduced the binding reactivity of our Mab substantially, with no antibody binding being detected at antigen concentrations of about 1 5.6 IlglmL and below (Fig. 1). This was probably a result of the lipid antigen's being washed away by the detergent, a widely reported observation in anti-lipid antibody immunoassaysll, 12. 3. 1.3 Effect ofIncubation Temperature, Time and Blocking Buffer. Incubation at 37° C enhanced antibody binding considerably compared with incubations carried out at lower temperatures (Fig. 2). The length of the incubation time of the Mab with MGDG had no effect on its binding reactivity. All buffers tested for blocking in the ELISA [ 1 % (w/v) BSA, 0.3 % (w/v) gelatin, 1 0 % (v/v) ABS, 1 0% (v/v) FBS and SuperBlockTM in PBS] produced reasonable results. Freshly made 1 0% (v/v) FBS and SuperBlockTM gave slightly better blocking (results not shown). 3. 1.4 Role of a Plasma Cofactor. When 0.3% (w/v) gelatin was used as antibody diluent and blocking agent to exclude any cofactor that may be present in bovine serum,
Wheat Structure, Biochemistry and Functionality
274
�E
0 20
Figure 2. Binding reactivity to MGDG of serial dilutions of MG405 culture supernatant at 3 7 'C (_), 20 'C (0) and 4 'C (.) .
o
U
5
m
20
�
�
�
�
_
Reciprocal of cuHure supernatant dilution
the binding reactivity of the affinity purified MG405 was about 30% lower than that of the same Mab diluted in 10% (v/v) FBS. The addition of human plasma J32Glycoprotein I (J32GPI) to the 0.3% (w/v) gelatin diluent in the same assay produced only a small increase in antibody binding, and no inhibition was produced by J32GPI over a concentration range of 0- 1 00 IlgimL. 3.2
13C NMR Verification of MGG Structure
The carbon atom resonances in the NMR spectra (Figure 3a,b,c) were assigned by comparison with the chemical shifts given in the literature13• 1 4, together with those identified by the DEPT experiment (Figure 3c). Signals characteristic of those of fatty acid chains were absent from the MGG spectrum, which showed only those representing the anomeric carbon atom and galactosyVglycerol backbone carbon atoms (Figure 3b). It was concluded that the saponification had been carried out successfully and that the product was indeed MGG. 3.3
Antibody specificity
Pre-incubation of the Mab with lipid standards containing 1 6:0, 1 8:0, 1 8 : 1 , 1 8 : 2, and 1 8 : 3 fatty acids typical of those present in wheat MGDG, MGG, galactose and glycerol produced only a small degree (5- 1 8%) of inhibition. However, addition of MGDG inhibited antibody binding almost totally (99.8%) at high concentrations. In an experiment using purified phospholipids from a variety of animal, plant and microbial sources as antigen, no binding reactivity with these lipids was detected irrespective of their origin. 4 DISCUSSION Anti-glycolipid antibodies, like other antibodies directed against carbohydrate determinants, have generally been found to have low titre and affinity compared with anti-peptide antibodies. This low affinity, together with the amphipathic nature of the lipid
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
275
a)
I lSI
b)
'"
I !IO
I 100
�'ybB
I 100
c)
�
I
!!II I
0
'\..I
..,
�'ybB ..,
I
I 10
..
..
I I
10
�
I
..
AIM
•
Figure 3. High resolution HC NMR spectra, showing a) The five main spectral regions for MGDG with signals at approximately (ppm): / 73 (C1, carboxyl carbon), 127-130 (acyl chain olefinic carbons), 104 (anomeric carbons), 62-69 (galactosyllglycerol backbone carbons), 14-34 (acyl chain aliphatic carbons); b) Signals for MGG at approximately (ppm): 106.4 (C-1, anomeric), 78. 6 (C-5), 76. 1 (C-3), 74. 3 (C-2), 74. 1 (C-6), 73.9 (C-4), 72. 1 (C-2'), 65.8 (C-J'), 64. 4 (C-3'); and c) DEPT spectrum (() 3;&14) showing signals from the three CH2 groups at 74. 1, 65.8 and 64. 4 ppm, respectively. =
276
Wheat Structure, Biochemistry and Functionality
antigen, makes it difficult to measure accurately small amounts of antibody in solid phase immunoassays, which require extensive washing to minimise unspecific binding of proteins. It is not surprising, therefore, that many different procedures have been reported in the literature for ELISA protocols for aGL detection6. Primary antibody incubations, for example, were carried out at room temperatureS, at 37°C with the use of PBS/Tween7, 10, or at 4°C for various time periods8, despite the fact that a recent workshop recommended overnight incubation at 4°C and discouraged the use of PBS/Tween for washing6. Our data also indicated that the inclusion of Tween 20 in the antibody diluent reduced the binding reactivity ofMG405 with MGDG. The greater reactivity observed for antigen-antibody binding at 37°C than at lower temperatures, however, is contrary to the workshop's recommendations. Early observations with anti-phospholipid antibodies (aPL) have led to proposals that temperature-dependent binding reactivity may be due to the physical state of the lipid antigen 1 S, 16. It may also be related to the properties of different antibody isotypes; IgM antibody, for example, was reported to fix complement most efficiently at 37°C, and IgG most efficiently at 4°CI7,18. Lockshin et aI., however, found that the binding of IgG type aPL was temperature dependent but not that of the IgM type l9. This is contrary to the results obtained here with MG405, which is of the IgM isotype, but its MGDG binding reactivity was found to be temperature dependent. It had been recognised for a number of years that the use of bovine serum-based diluents and blocking solutions greatly improves the discrimination between positive and negative samples for anticardiolipin antibodies2o,2 1 . Recent reports have indicated that some aPL bind to anionic phospholipids only in the presence of 132GPI22.24, a highly glycosylated, single chain polypeptide of 326 amino acids and of M, 50k2s. Although the inclusion of 132GPI at 5J.lglmL enhanced the binding of MG405 with MGDG, the degree of enhancement was small, suggesting that a factor other than 132 GPI may have been responsible for the somewhat reduced binding reactivity when FBS was replaced by gelatin in the modified ELISA. The Mab did not recognise 132GPI immobilised on ELISA plates, and neither did pre-incubation of the Mab with 132 GPI inhibit the antibody's binding to immobilised MGDG. MG405 therefore appears not to be an intrinsically low affinity antibody to 132GPI unlike aPL. Galactose, the non-reducing terminal residue of the Type II chain (Galpl�GlcNAcp I �R) and the Type II chain H structure (Fuca l �2Galpl �4GIcNAcPI �R) were identified as the antigenic determinants for some aGL 1 1 ,26 Other closely related structures, such as those based on the disaccharide Galpl �3GIcNAc, which may be carried on both 0- and N-linked oligosaccharide chains in glycoproteins and on both short chain and complex glycosphingolipids, were also established to be determinants for blood group specific antigens27. The complete inhibition produced by MGDG suggested that MG405 was directed against the whole MGDG molecule and not its carbohydrate (galactose residue or the galactosyVglycerol backbone) or lipid moieties. An alternative explanation for the inhibition result is that MGDG may be present in micellar form, which may present the actual epitope multivalently and which therefore binds better than the water soluble univalent MGG. This research has resulted in the development of a monoclonal antibody against MGDG, which has unique specificity characteristics amongst anti-polar lipid antibodies. Preliminary immunolocation studies have shown that the Mab binds to cytoplasmic
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
277
membranes in the developing wheat caryopsis. It is potentially useful in immunohisto chemistry and other studies.
References 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 1 1. 12. 13. 14. 15. 16. 1 7. 18. 1 9. 20. 21. 22. 23.
A. H. Bloksma, Cereal Foods World, 1990, 35, 228. Z. Gan, R. E. Angold, M. R. Williams, P. R. Ellis, 1. G. Vaughanf and T. Galliard, J. Cereal Sci. , 1990, 12, 390. Z . Gan, P. R . Ellis, and 1 . D . Schofield, J. Cereal Sci., 1 995, 21, 2 1 5 . Z . Gan, P. R . Ellis, and 1. D . Schofield, J. Cereal Sci., 1 993, 18, 207. H. Ozawa, M. Kotani, I. Kawashima, and T. Tai, Biochim. Biophys. Acta, 1 992, 1 1 23, 1 84. D. M. Marcus, N. Latov, B. P. Hsi, and B. K. Gillard, J. Neuroimmunol., 1 989, 25, 255. T. Ariga, T. Yoshida, T. Mimori, and R. K. Yu, Clin. Exp. Immunol., 1 99 1 , 86, 483 . A. A. Llyas, F. A. Mithen, Z. W. Chen, and S. D.Cook, J. Neurol. Sci., 1 99 1 , 102, 67. H. M. Cheng, and S. F. Yap, J. Immunol. Methods, 1 988, 109, 253. M. H. Ravindranath, R. M. H. Ravindranath, D. Morton, M. C. Gaves, J. Immunol. Methods, 1 994, 169, 257. W. W. Young, 1. Portoukalian, and S. Hakamori, J. Bioi. Chem., 1 98 1 , 256, 1 0,967. E. N. Harris, A. E. Gharavi, B. M. Patel and G. R. V. Hughs, C/in. Exp. Immunol., 1 987, 68, 2 1 5 . S. R . Johns, D . R . Leslie, R . I . Willing, and D. G. Bishop, Aust. J. Chem., 1 977, 30, 823 . F. Adebodun, 1. Chung, B. Montez, E. Oldfield, and X. Shan,. Biochemistry, 1992, 31, 4502. 1. Rauch and A . S. Janoff, Proc. Natl. Acad Sci. USA ., 1 990, 87, 4 1 12. 1. Rauch, M. Tannenbaum, H. Tannenbaum, H. Ramelson, P. R. Cullis, C. P. S. Tilcock, M. 1. Hope, and A. S. Janoff, J. Bioi. Chem., 1 986, 261, 9672. B. D. Stollar and A. L. Sandberg, J. Immunol., 1966, 96, 755. A . L . Sandberg and B. D . Stollar, J. Immunol., 1 966, 96, 764. M. D. Lockshin, T. Qamar, R. A. Levy and M. P. Best, J. C/in. Immunol., 1 988, 8, 1 88- 1 92. S. Loizou, 1. D. McCrea, A. C. Rudge, R. Reynolds, C. C. Boyle and E. N. Harris, Clin. Exp. Immunol., 1985, 62, 738. A. E . Gharavi, E. N. Harris, R. A. Asherson and G. R . V . Hughs, Ann. Rheum Dis., 1 987, 46, I . H. P. McNeil, R. 1. Simpson, C. N. Chesterman and S. A. Krilis, Proc. Natl. Acad Sci. USA, 1 990, 87, 4 1 20. M. Galli, P. Comfurius, C. Maassen, H. C. Hemker, M. H. de Baets, P. 1. C. van Breda-Vriesman, T. Barbul, R. F. A. Zwaal and E. M. Bevers, Lancet, 1 990, 335, 1 544- 1 547.
Wheat Structure, Biochemistry and Functionality
278
24.
E. Matsuura, Y. Igarashi, M. Fujimoto, K. Ichikawa and T. Koike, T. Lancet,
1 990,
336, 1 77. 25.
1. Lozier, N. Takahashi and F. M. Putman, Proc. Natl. Acad Sci. USA, 1 984, 81,
26.
1. A. Benjamins, R. E. Callahan, I. N. Montgomery, D. M. Studzinski and C. A. Dyer, J. Neuroimmunol., 1 987, 14, 325. W. M. Watkins, Pure andAppl. Chem., 1 99 1 , 63, 56 1 .
3 640.
27.
ASPECTS ON THE FUNCTIONALITY OF DATEM IN BREADMAKING
N. O. Carr and P. 1. Frazier Dalgety pic Food Technology Centre Station Road Cambridge CB 1 2JN
1 INTRODUCTION The emulsifier DATEM (diacteyl tartaric esters of mono- and di- glycerides) has a critical role to play in modem bread production, particularly in high-volume, granary and wholemeal formulations, whereby a small addition (typically 0.35% flour weight basis) provides tolerance against dough collapse and atlows satisfactory loaf volume to be achieved. Thus, while DATEM generally can be shown to increase the volume of standard white bread, it is more usual to measure the quality of DATEM using the so-called "bang test" where its affects become exaggerated. Here dough from a high-volume recipe (that is dough prepared from an extended-proof and with a high yeast addition) is subject to a controlled degree of mechanical shock and this leads to dough collapse in the absence of good-quality DATEM. The inclusion of DATEM eliminates the requirement for hard fat in the Chorleywood Bread Process and it is likely that both hard fat and DATEM function through similar mechanisms. The present work has attempted to elucidate this mechanism using baking and analytical procedures on a number of commercial DATEMs and other fats and emulsifier systems. 2 METHODS For the "bang-test", dough (500g) was prepared using commercially-milled English flour with 5% (flour weight basis, fwb) bakers yeast, 2% (fwb) salt, 1 .6% (fwb) soy flour, 0.7% (fwb) bakery fat, 0.02% (fwb) ascorbic acid, and water equal to the Farinograph absorption at 500 BU. To avoid dispersion problems that can be encountered with certain fats, emulsifiers and fats were generalIy coated onto a small proportion of the flour (typicalIy 8% of the total flour) using chloroform, which was then evaporated. Dough was developed according to the Chorleywood Bread Process, divided into 8x60g pieces, moulded and prooved for 75min at 40°C. Four of the doughs were subject to "banging" by rolling a 76.5g balI down a 20cm ramp set at an angle of 55° in order to shock the loaf-tin. AlI dough pieces were then baked at 200°C for 20min. Loaf volume was determined using a standard rapeseed-displacement method. When defatted flour was evaluated, the "bang test" was not used was and standard white bread was made. Conditions were as above except: 2.5% yeast was used, bakery fat was omitted, dough' was divided into 4x1 20g pieces, proof time was 60min, and, obviously, the "banging" was avoided. Emulsifiers and
280
Wheat Structure, Biochemistry and Functionality
fats were obtained from Grindsted, Croda, Quest, AB Foods or Sigma. Where defatted flour was used, this was prepared by extracting flour four-times with light petroleum using approximately 1 1 of solvent for each 1 kg of flour. Analysis of emulsifiers on the basis of polarity used an HPLC either according to the protocol described by Carr et al I (termed Gradient 1 ) or according to the following gradient (termed Gradient 2): t=Omin, A= l OO%; t=7.5min, A=S5%, B=1 5%; t=9min, A=20%, B=52%, C=2S%; t=l l . 5min, A=30%, B=70%; t= 1 2 . 5min, A=1 00%, t= 1 5min, A= 1 00% . The composition of solvent A, B and C are as described by Carr et al. 1 The method utilises light-scattering detection and, while able to provide qualitative profiles, is unreliable for routine quantification. Pure DATEM ( l -palmitoyl-3-diacetyl tartaric ester of monoglyceride: I -DATEM), used in this method as a standard, was prepared by the esterification of I -palmitoyl glycerol with diacteyl tartaric anhydride? Preparative-scale quantitative fractionation of DATEM, used silica columns from Bond Elut. Material fractionated for evaluation in baking used a 1 09 column (-2.5g sample), conditioned with 40ml chloroform:acetic acid (9S:2). Using the same solvent, sample was applied in 40ml and, after applying a further 20ml, fraction FA was recovered. Fraction Fa was obtained using 1 40ml of this solvent while application of SOml chloroform:propan-2-01 (94:6) gave fraction Fe. Fraction FD was obtained by applying SOrnl methanol. A similar method was used to characterise a range of commercial DATEM samples, by quantifYing selected fractions. In this case, 0.5g columns were used conditioned with 2ml chloroform:propan-2-01 (9S :2). Sample (- 1 00mg) was applied in 3rnl of the same solvent and a neutral fraction was recovered using a further 3ml of the same solvent. A mid-polar fraction was obtained using 4ml chloroform:propan-2-01 (94:6), while a polar fraction was obtained using 4ml methanol. After solvent evaporation, emulsifier fractions could be determined gravimetrically. For assay of tartaric acid, glycerol and acetic acid, samples of DATEM (-0. 1 2g) were saponified in 0.42M sodium hydroxide ( 1 5ml) at 1 00°C for 60min. Sample pH was then adjusted to between 4-5 using 5M hydrochloric acid, and the total volume was made up to 25ml. After filtering, acids and glycerol were quantified using an organic-acid-analysis column (300x7.Smm, Aminex HPX-S7H) using 0.005M sulphuric acid at a flow rate of 6mllmin. Components were detected by refractive index.
3 STUDY OF COMMERCIAL DATEMS Fourteen samples of commercial DATEM were obtained from a number of suppliers including samples that were both liquid and solid (differential thermal analysis was used to confirm that the liquid samples were free of solids at proof temperature). Evaluation of these samples in baking at a low inclusion level of 0. 1 % (fwb) using the "bang-test" indicated a range offunctionalities (results not shown). However, the quality of the samples could not be related to the physical form of the material (i.e. whether liquid or solid) nor to the composition given by three analytical approaches. These approaches included: (i) qualitative profiling by HPLC on the basis of polarity, (ii), quantitative fractionation of the samples into neutral, mid-polar, and polar components and, (iii), assay of tartaric acid, acetic acid, glycerol, and fatty acid after hydrolysing the material. Some of the "fingerprint" chromatograms are shown in Figure 1 and this serves to illustrate that commercial DATEMs are complex and varied in composition. Moreover a range in the level of pure 1 DATEM within these samples was also indicated but was found not t o correlate with quality.
28 1
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
1-------'
I-
L.._____-�-Fc
------FD
_ _ _ _ _ _ _
Whole commercial OATEM
o
2
4
6 Minutes
I-OATEM 10
Figure 1 Analysis ofa number of commercial DA TEMs andpure I-DA TEM (HPLC Gradient 2)
o
2
4
6 Minutes
8
10
Figure 2 Analysis offractions obtainedfrom a commercial DA TEM that subsequently were evaluated in baking (HPLC Gradient I)
Preparative fractionation was used to prepare four cuts from a selected commercial DATEM which were then evaluated in baking (whole commercial DATEM included at a level of 0.34%, fwb; fractions included according to the proportion present in whole commercial DATEM). The fractions obtained are shown in Figure 2 and the baking results are shown in Table 1 . Reconstituted DATEM was found to perform in a comparable way to the untreated sample, but no individual fraction was found to confer full functionality. Thus, commercial DATEM would seem to function as a consequence of the overall properties of the blend rather than because of presence of specific components (including pure I -DATEM). This conclusion is consistent with the findings obtained from assessing a range of commercial DATEMs.
Table 1 Influence of commercial DA TEMfractions on loaf volume and on tolerance of dough to col/apse on banging Sample
Loaf volume (ml)
DATEM-free Whole DATEM (0.34%) Fractions FA Fa Fc Fo (0.34%)
868 944 937
Loaf volume of "banged" dough (ml) 746 915 934
Fractions FA Fa (0.34% x 0.47) Fractions Fc Fo (0.34% x 0.53)
863 892
763 817
Fraction FA (0.34% x 0.32) Fraction Fa (0.34% x 0. 1 6) Fraction Fc (0.34% x 0.34) Fraction Fo (0.34% x 0. 1 8)
867 863 905 915
764 774 822 793
Note to Table: Inclusion levels shown in parentheses are expressed on fwb. Standard deviation
1%
282
Wheat Structure, Biochemistry and Functionality
Previous publications 3,4 have found evidence that bakery fat provides benefit only in the presence of "free" wheat lipid (i.e. lipid that can be extracted from flour by solvents such as light petroleum). In order to ascertain whether the requirement for DATEM was also dependent on free wheat lipid, bread was baked from untreated, defatted and reconstituted wheat flour in the presence and absence of commercial DATEM. Results are shown in Figure 3, where it can be seen that DATEM provides benefit only in the presence of free wheat lipid. Furthermore, results are most suggestive that free wheat lipid is a detrimental component of flour, and that commercial DATEM works by overcoming these detrimental properties. Intriguingly, commercial DATEM would seem to be itself a detrimental ingredient in the absence of the free lipid of wheat flour.
DATEM-free
DATEM 0.34% fwb Untreated flour
Reconstituted flour
Defatted flour
Figure 3 Assessment of commercial DA TFM (0. 34%fwb) in bqking using untreated, defatted and reconstituted wheatflour
4 STUDY OF OTHER FATS AND EMULSIFIERS A number of fats and emulsifiers were evaluated in baking at an inclusion level of 0.8% (fwb). The purpose of the work was to contrast function against structure, rather than to catalogue fats and emulsifiers comprehensively, and so this work attempted only to provide a crude screening. Thus, in the first instance only one dough was prepared (permitting eight loaves to be baked, of which four w.ere from "banged" doughs) and, with the exception of citric acid esters, only materials exhibiting some degree of functionality were re-tested. Arbitrarily the materials have been divided into five groups of functionality (strong, medium, low, none and deleterious), but because the work is based on limited experimentation it should be remembered that certain substances could have been grouped incorrectly. The high inclusion level was chosen so that materials exhibiting some degree of functionality could be identified more easily. Results of this work are given in Table 2. Interestingly, on the basis of "text-book" structure 5.6 emulsifiers of "strong" function are of a contrasting nature (i.e. DATEM, polysorbate 65 and certain sucrose esters have substantial differences in structure), while other emulsifiers share a similar theoretical
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
283
structure yet have dissimilar functions (in particular DATEM and citric acid esters). Furthermore, use of HPLC to fingerprint these samples, found some samples to be of similar profile but not of similar function (e.g. sorbitan mono-oleate and DATEM, results not shown). However, a characteristic that appeared of some use in discriminating between emulsifier-functionality was the HLB value (hydrophilic-lipophilic balance). Thus emulsifiers of strong function had cited HLB values between 9_1 3 ,5-7 those of medium function were either between 5-7 or were essentially hard fat (i.e. HLB 1 or less), while those of lower function had HLB values that were mostly outside these ranges. Notable exceptions to this pattern included polyglycerol esters (HLB 1 0) and citric acid esters (HLB 1 1) which might have been expected to provide strong function but, in practice, provided none.
Table 2 Relativefunction ofa range offats and emulsifiers in baking at an inclusion level of 0. 8% (fwb)
HLB value
EmulsifierlFat
Emulsifierljat
HLB value
No Function:
Strong Function: 13
Sucrose ester F 140
Acetic acid esters
3
9
Lactic acid esters
3
Sucrose ester F I lO
II
Citric acid esters
II
Polysorbate 65
II
Polyglycerol esters
10
Propan diol esters
2
Sorbitan monostearate
5 4
DATEM
Medium Function: 0
Sorbitan mono-oleate
Monopalmitin and mono-olein
7
Polysorbate 60
15
Calcium stearoyl lactylate
5
Polysorbate 80
15
Sodium stearoyl lactylate
7 7
Sucrose ester F20
Hard fat ?
Soy lecithin
2
(No addition)
Sucrose ester FlO Deleterious Function:
Low Function:
Hydrogenated soy lecithin ?
Hard fat ?
0
Egg lecithin
7
Glyceryl mono/di-stearate Sorbitan tristearate
7
3
3
Note to Table: Materials of "strong jUnction " gave a non-banged loaf volume (NBLV) in the
range 99-101% and a banged loafvolume (ELV) in the range 96-100%, relative to a good quality
commercial DATFM.
For the other groups the NBLV and BLV fell in the respective ranges:
"mediumjUnction " 97:t3% & 90:t3%, "lowjUnction " 95:t1 % & 86:t2%, "no jUnction " 90:t2% &
83:t3%, "deleterious jUnction " 81:t1 % & 80:t1 %. Materials marked with question-marks indicate s7 queried results. Where possible HLB values were obtained from published work. - No values could be found for pure monoglycerides and these were estimated by molecular formula. No reliable HLB value could be found for polyglycerol esters, egg lecithin or hydrogenated soy lecithin, and in these instances a value was estimated according to the dispersion-properties in water. 5-7
The HLB scale is based on an empirical measure of the ability of an emulsifier to stabilise oil in water, and arbitrarily has been set between 0-20.' Lipophilic emulsifiers are of low HLB and tend to promote water-in-oil emulsions. Hydrophilic emulsifiers are of high HLB and these tend to have good water-dispersion properties, promoting fat-solubilisation and foam-
Wheat Structure, Biochemistry and Functionality
284
stabilisation. An HLB of l O is, by definition, the mid-point between a hydrophilic and a lipophilic emulsifier and this is optimum for the stabilisation of oil in water. Since an HLB value of around l O is associated with emulsifiers of strong function in baking it is suggestive that such systems may work by producing oil-in-water emulsions. This being the case, one would have to assume that other factors have bearing on functionality in order to account for the anomalous results involving non-functional emulsifiers that are of an HLB around 1 0 (i.e. polyglycerol esters and citric acid esters). An aspect of the HLB scale is that when emulsifiers are blended they provide a system that gives an HLB value according to the overall average. Accordingly, blends were prepared containing various proportions of low-HLB-emulsifier (GMS of HLB 3 and sucrose ester F20 of HLB 2) and high-HLB-emulsifier (polysorbate 60 and polysorbate 80, both of HLB 1 5) to cover the HLB scale between the extremes of the emulsifiers used. In these instances, the low- and high- HLB-emulsifiers, that were non-functional when used alone at an inclusion level of 0.8% (fwb), became comparable to DATEM when used in blends giving an HLB value of around 10. Data from one such experiment, using various blends consisting of GMS and polysorbate 60, is shown in Figure 4.
950
I
�
'0 >
i...
900 850
___ Non-banged dough
800 750
-+- Banged dough
2
4
6
8
10
HLB value
12
14
16
Figure 4 Loaf volume of banged and non-banged doughs prepared using mixtures of
polysorbate 60 and GMS (glyceryl monoldi-stearate) providing a range of HLB values; emulsifier included at 0.8%fwb
These results, however, are not unequivocal because subsequent experimentation using incremental additions of polysorbate 60 or polysorbate 80 (i.e. the high-HLB-emulsifiers), showed that polysorbate gave similar functionality to that achieved with the blends containing polysorbate at the corresponding addition level (results not shown). Thus, the presence of low-HLB-emulsifier would appear to have had little influence on the functionality of the polysorbate in baking and, accordingly, the relationship shown in Figure 4 may have no direct bearing to the HLB scale. However, it is suggested that polysorbates used in isolation of low-HLB-emulsifier still show an optimum addition level because the native wheat lipids in this instance are participating as low-HLB-emulsifier. This explanation is preferred on the grounds that: (i) intuitively wheat lipids would be expected to perform as a low-HLB-emulsifier, (ii), DATEM does not show an optimum addition level like the polysorbates, and rather maintains functionality once it is beyond a threshold addition, which is consistent with the performance expected of mixing a high- and low HLB-emulsifier and, (iii), the pattern illustrated in Table 2 is consistent with the HLB scale having a bearing on emulsifier functionality.
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
285
5 CONCLUSIONS
From baking and analytical evaluation of a number of DATEMs and other emulsifiers, evidence has been obtained to indicate that DATEM functions as a consequence of the chemical properties of the overall blend rather than because the presence of specific components. The overall properties can be described reasonably well according to the HLB scale, although a number of exceptions have been found. While evidence is not unequivocal, it is thought that emulsifiers of high HLB can be blended either with low HLB-emulsifier, or with the endogenous lipids of flour, to provide a system with the same HLB as DATEM and, under such circumstances, similar functionality to DATEM is obtained. An HLB of around 1 0 would seem to be optimal for functionality and this, by definition, is also optimal for the stabilisation of oil in water. Work with defatted flour has indicated that only in the presence of flour lipid is there a requirement for DATEM and that DATEM may function by overcoming the deleterious properties of this lipid. Accordingly, the above findings suggest that DATEM, or other emulsifiers of a similar HLB, sequester native wheat lipid within emulsions thereby reducing the availability of wheat lipid to destabilise the gas/liquid interfaces of dough. In this way a more robust dough-structure is derived. Likewise, usage of bakery fat (providing similar although less pronounced benefit to DATEM) may also work by interacting with endogenous lipid and, thereby, retarding the migration of these lipids to the gas/liquid interfaces of dough.
Acknowledgements The authors are pleased to recognise the contributions of Prof N.W.R. Daniels, Forge, Mr D. Heavens and Dr T. Podgorski to this work.
Mr
C.D.
References 1 . N.O. Carr, N.O., N.W.R. Daniels, and PJ. Frazier, "Wheat End-Use Properties, Proceedings ofICC meeting", Helsinki, 1 989, p. 1 5 1 . 2. T A Podgorski, Dalgety Internal Report (GRU09/90) . 3 . OK Chung, Y. Pomeranz, K.F. Finney, M.D. Shogren and D. Carville, Cereal Chem., 1 980, 57, 1 06. 4. OK Chung, Y. Pomeranz, M.D. Shogren, K.F. Finney, and B .G. Howard, Cereal Chem. , 1 980, 57, I l l . 5 . Anon. Food Techno/., 1 988, 42, 174. 6. F.VK Young, C. Poot, E. Biernoth, N. Krog, LA O'Neill and N.GJ.Davidson, "The Lipid Handbook", eds. F.D. Gunstone, lL. Harwood and F.B. Padley, Chapman and Hall, London. 1 986, p. 1 8 1 . 7 . G . Schuster and W . F . Adams, Adv. Cereal Sci. & Technol. , 1 984, 6, 139.
CHANGES OF WHEAT FLOUR COMPONENTS INDUCED BY BREAD IMPROVER
M. Soral-Smietana, M. Rozad and A. Cielem«cka Centre for Agrotechnology and Veterinary Sciences, Polish Academy of Sciences, Tuwima 10, 10-81 7 Olsztyn, Poland,
1 INTRODUCTION Unified flour quality is the condition for obtaining good bakery products in automatized bakeries. Due to diversified agricultural conditions wheat grain has no unified quality parameters. Thus, flour has no fully reproducible technological properties, which unfavourably affects the quality of bakery products. Therefore, there are applied multicomponent bread improvers which act throughout the whole baking process, affect water absorption capacity of flour, improve dough structure, its texture and volume and elongate its freshness. Improvers are made of various substances, among others emulsifiers which combine the basic components of dough, sugars which ensure appropriate dough fermentation and crest colour, and ascorbic acid which permits dough to absorb the maximum amount of oxygen during kneading. There are two groups of emulsifiers: ionic (anion-active or kation-active) and non-ionic (mainly acylglycerols). Ionic compounds catalyse the hydrolysis of peptide bonds and strenghten gluten proteins. Anionic substances bind with their non-polar part to protein thus lowering its electric charge. This results in reduced electrostatic repulsion of particles and makes their association easier thus strenghtening dough structure. Non-ionic compounds (mono- and diacylglycerols) are used in the baking industry for catalysing of starch complexing. As a result, helix structure is formed from the linear fraction of amylose. Amylose helix is stabilized by the inbuilt hydrocarbon chain of fatty acid from emulsifier [1]. A study was made on the effect of Polish bread improver called AKO added to wheat bakery products during dough making and the range of its interactions with macrocomponents of wheat flour.
2 EXPERIMENTAL
The aim of the study was to investigate the effect of 2% addition (in relation to wheat flour) of a complex bread improver AKO. For experimental baking (250 g dough) there was used improver containing glucose, maltodextrin, emulsifier,
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
287
ascorbic acid and wheat flour. The effect of AKO's action on the rheological properties and structure of dough were characterized. Transformation range of wheat flour components was determined by means of: -studies on protein fractions changes during dough making; -estimation of fatty acids of free lipids of flour and dough; -characterizing of wheat starch isolated from dough following fermenation and from bakery products after 1, 24, 48 and 72 h storage.
2.1. Material Commercial wheat flour (chemical composition in Table 1, technological characteristics in Table 2) was investigated.
Table 1 Chemical composition of commercial wheat flour Chemical composition of wheat flour
Moisture Ash Proteins [%NxS.7] Free lipids Fractions of free lipids: neutral glycolipids phospholipids
13.47 % 0.53 % d.m. 10.13 % d.m. 1 . 14 % d.m. 19.5 % 63.1 % 18.4 %
Table 2 Technological properties of wheat flour Gluten content Deliquescence Number of sedimentation Falling number Water absorption capacity (500 B.U.)
24.3 % 12.2 mm 22 408 57.7 %
2.2. Analytical methods
2.2. 1. Proteins. Sedimentation test was performed acc. to Zeleny. Protein fractions were separated acc. to Osborne with the following solvents: redistilled water, O.5M NaO, 70% �HsOH, O.5M CH3COOH at 5°C. Nitrogen content was
288
Wheat Structure, Biochemistry and Functionality
determined ace, to Kjeldahl. 2.2.2. Lipids. Quantitative analyses of free lipids followed cold extraction with petroleum ether. Fatty acids composition was determined by the GLC method following methylation. 2.2.3. Starch. Native starch was isolated with 0.5% NaCI [2], and with distilled water during the technological process [3]. Amylose-lipids complexing index was determined as the ability to bind iodine by amylose made avalilable during gelatinisation in 1 M NaOH at 50"C for 1 h [4]. Absorbance was measured at A 600 nm. Complexing index was determined from the equation: CI
=
[(A., - A.)/A.,] x 100
(1)
where A., - absorbance of amylose-iodine complex (control) A. - absorbance of amylose-iodine complex (sample) Gelatinisation degree was calculated based on digestion with bacterial a-amylase and measurement of colour complex with iodine at A 625 nm [5] from the following equation: GD%
=
[(a-b)/a] x 100
(2)
where a - absorbance of total starch fraction b - absorbance of nonavailable starch fraction. 2.2. 4. Scanning electron microscopy. Samples of wheat dough (2x3 mm) were
fixed in 2.5% glutaraldehyde solution in 0.1 M phosphate buffer (pH 7.4) at 4°C for 24 h. Following washing out with distilled water samples were dehydrated in acetone series, and dried by CO2 at critical point, sprinkled with carbon and gold, and with analysed by SEM.
3 RESULTS AND DISCUSSION 3.1 Protein-Lipid Interactions vs. Structure Forming Analysis of chemical composition (Table 1) of commercial wheat flour revealed that among native lipids the ratio of neutral to polar lipids was 1 :4. In the polar fraction, in tum, glycolipids made over 75% which indicates some additional action toward aggregation of technologically weak gluten proteins (Table 2) with glycolipids during dough kneading [6]. Joining of glycolipids with glutenins is considered to be mediated by hydrogen and electrostatic bonds [7]. Fatty acids
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
289
composition of free lipids of wheat flour is dominated by C18:2 (Table 3). Complex improver AKO brings in mainly C18 and C16 which interact with wheat proteins during dough making. This is illustarted by SEM micrograms of fibrous structures of gluten network (Figure 1). At the same time joining of native lipids of wheat flour with the improver added resulted in a clear transformation of unsaturated into saturated fatty acids and levelling of their ratio to 1 : 1 (Table 3). Especially evident quantitative changes were found for linoleic and stearic acids. Addition of AKO improver to wheat flour of weak baking qualities resulted in quantitative levelling of prolamins and glutelins ratio (Table 4). From the technological point of view, the phenomenon is advantageous as rheological properties of gluten depend on the prolamins to glutelins proportion and on hydrophobicity of prolamins [8]. On the other hand, increase in gluten strenght is accompanied by an increase of the protein fraction with the highest molecular weight. Also dough kneading in oxygen access favours oxygen polymerization of protein fractions ofvery high molecular weight. Moreover, the possibility of forming ionic bonds by dipolar ions affects rheological properties of wheat proteins. Thus, the use of ionic emulsifiers for wheat flour strongly affects the structure of proteins and the dough made [8].
Table 3 Changes in main fatty acids of the material studied. Material
Fatty acid composition [%J CI6
CI8
CI8:I
CI8:2
CI8:]
Wheat flour AKO improver Control dough
18.8 29.2 21.5
0.8
13.3 1.2 22.8
62.3 2.4 47 8
3.8 0.1 3.8
Dough with AKO improver
26.2
14.0
39.0
2.4
61.3 1.8 15.9
.
Table 4 Protein characteristics and changes in protein fractions Protein content [%N d.m.
Flour Control dough Dough with AKO
x
5. 7J
Total
Albumins
Globulins
Prolamins
Glutelins
Residue
10.1
2.2
1 .2
2.6
1.8
2.7
9.3
1.2
0.6
1.0
2.6
3.9
9.1
1.4
0.8
2.2
2.3
2.4
290
Figure 1
Wheat Structure, Biochemistry and Functionality
SEM micrograms ofstructure ofcontrol dough (a) and dough with AKO improver (b)
3.2 Amylose-Lipid Interactions vs. Limiting of Starch Retrogradation
Changes in physical and functional properties of starch depend on the interactions of the molecule caused by such environment factors as water content, pH, temperature and others (Figure 2). Transformation dynamics of hyper-molecular structure and interactions between starch and other food constituents depends on the mobility of amorphic phase of a given system. And so, water, acting as a plastifier, lowers the temperature of changes and affects the kinetics of phase transformations and reactivity of starch [9]. These conditions are ensured by, among others, dough forming and baking during which amylose released from starch molecules can crystallize already in the first hours following termination of the process. This accounts for forming of helical inclusion amylose-lipids complexes at increase in starch gelatinisation degree (Table 5). Inbuilding of 12 to 18 carbon atoms into monoglyceride chains is the most effective in watered environment at 60"C [ 10]. Mono- and polyunsaturated acids play a significant role in complexing of starch with lipids [4]. Their potential for joining amylose helix depends on geometrical isomerism of cis- and trans- chains of fatty acids [10, 1 1]. It appears interesting that the complexes formed during baking are the most active for up to 24 h and next they gradually dissociate (Table 5). Hence, amylose concentration decreases and its molecule elasticity diminishes as a result of adsorptive and helical inclusion interactions between amylose and lipids which gives a chance of slowing down the retrogradation rate of starch and its fractions.
Nature and Functionality of Wheat Lipids, Lipid Binding Proteins and Added Emulsifiers
Table
S
291
Effect of baking improver on starch-lipid interactions and changes of gelatinisation degree
Starch isolated from:
Complexing index· control
Wheat flour
with AKO
Degree of gelatinisation control
/%}
with AKO
19.9
0
Wheat dough: 0.8 0
before fermentation after fermentation Wheat bread:
1.1 1.2
2.8 2.2
19.9 6.9
1 h after baking
1.4
55.3
2.2 8.6 9.2
2.8 19.4 9.2 6.4
69. 1
24 h after baking 48 h after baking 72 h after baking
57.0 66.6 68.9
69.4 55.5 55.8
*Complexing index calculated against starch of wheat flour
Figure 2
SEM micrograms of wheat starch isolated from control dough (a) and dough with AKO improver (b)
292
Wheat Structure, Biochemistry and Functionality
3.3 Conclusions Native lipids of wheat flour with the improver added were transformed from unsaturated into saturated fatty acid and approached 1 : 1 ratio. Evident quantitatve changes were found for linoleic and stearic acids. Addition of the improver to wheat flour of weak baking qualities resulted in quantitative levelling of prolamins and glutelins ratio of fibrous structure of gluten which formed network. The helical inclusion amylose-lipid complexes are formed after baking at increase in starch gelatinisation degree, These complexes are the most active for up to 24h after baking and next they gradually dissociate. References
1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11.
N, Krog, Cereal Chern ., 1981, 58, 158. J. Whattam and H, Cornell, Cereal Chern., 1991, 68, 152. R. D. Dragsdorf, Cereal Chern., 1980, 57, 3 10. M. Soral-Smietana, Acta Acad. Agricult. Techn. Olst., Technologia Alirnentorurn, 1992, 24B, 3. H. Tsuge, E . Tsaumi, N . Ohtani and A . Nakazima, Starch/Starke, 1992, 44, 29. F. Bekes, U. Zawistowska, R. R. Zillman and W. Bushuk, Cereal Chern ., 1986, 63, 327. R. C. Hoseney, K. F. Finney and Y. Pomeranz, Cereal Chern ., 1970, 47, 135. H. D. Belitz, R. Kieffer, W. Seilmeier and H. Wieser, Cereal Chern ., 1986, 63, 336. D. E. Rogers, K. J, Zeleznak, C. S. Lai and R. C. Hoseney, Cereal Chern., 1988, 65, 398. T. Riisom, N. Krog and J. Eriksen, J. Cereal Sci., 1984, 2, 105. A . C. Eliasson and N. Krog, 1 Cereal Sci., 1985, 3, 239.
Rheological Properties and Functionality of Wheat Flour Doughs
EXPERIMENTAL AND CONCEPTUAL PROBLEMS IN THE RHEOLOGICAL CHARACTERIZATION OF WHEAT FLOUR DOUGHS
E. B. Bagley" F. R. Dintzis" and Sumana Chakrabartib "National Center for Agricultural Utilization Research, Agricultural Research Service, U.S. Department of Agriculture, 1815 N. University St. , Peoria, IL 61604, USA. bKrafi General Foods, 801 Waukegan Road, Glenview, IL 60025, USA
1 INTRODUCTION
Wheat flour doughs, as viscoelastic materials, have attracted the attention of numerous eminent scientists over the years. In addition to the intellectual challenge of determining and understanding the complex behavior of these common materials, there are practical reasons for investigating the flow properties of doughs. In evaluating new wheat varieties it is important to measure and understand the effects of such factors as growing conditions and varietal effects on processing and final product characteristics. Our ability to develop new processing methods will benefit enormously from increased sophistication of process engineering calculations. These calculations in tum require both experimental data input and an understanding of the relevant constitutive equations applicable to describing wheat flour dough behavior. Experience gained in the polymer industry has shown the value of rheological data for quality control purposes and for evaluation of effects of other ingredients, for instance additives. In the food industry rheological information is of value in minimizing the costs associated with the use of texture panels in evaluation of food textural properties. It has been evident from the earliest days of the scientific approach to evaluation of dough properties that wheat flour doughs were complex indeed. Schofield and Scott Blair in 19321 recognized that time during which stress was applied to a dough is as important as the magnitude of the stress itself. In 1970 Tschoegl et al.2 noted that "Wheat flour doughs are subjected to considerable deformation during the make-up and baking process" and emphasized that "few attempts have been made to describe the large deformation behavior of doughs in terms of fundamental quantities. " They found that dough properties depended on a variety of factors including rest period, mixing time, mixing atmosphere, flour variety, etc. Smith et al. 3 looked at dynamic methodology as a method to determine viscoelastic properties under small deformation or at short observational times, determining that the dynamic shear modulus was dependent on strain amplitude, frequency, and time. It is not feasible here to even attempt a review of the many other fine contributions made to our understanding of dough behavior. It is worth noting, with no attempt or pretence of claiming completeness, some recent general reviews, for example Faridi and Faubion,4 "Fundamentals of Dough Rheology" and "Dough Rheology and Baked Product Texture, lIS and the book by Blanshard et al. ,6 "Chemistry and Physics of Baking. "
296
Wheat Structure, Biochemistry and Functionality In recent years it has been recognized that for complete characterization of a
rheologically complex material testing in more than one deformational mode is required . Measurement in simple shear is perhaps the most commonly used rheological testing mode, but extensional flows have attracted a great deal of interest in polymer work since extensional or elongational flows are basic to such processes as spinning as discussed by Petrie . 7 Thus, in addition to a shear viscosity it would be most useful to have information on the extensional viscosity of a dough. The chain of events reported in this manuscript started with the recognition that uniaxial compression of dough discs
in an Instron Universal Testing Machine was imposing on the sample a biaxial
deformation in the two directions perpendicular to the applied force. This is the same
type of deformation that is generated in a Chopin Alveograph and the same as that imposed during bubble expansion which occurs during the baking of doughs. As normally operated, however, the Chopin Alveograph does not yield rheological data which can be converted to absolute units of stress (force per unit area) and strain. In contrast, the Instron compressional data can be quantified so that the stresses and strains can be determined during the compressional experiment.
From such data an
extensional , as opposed to a shear, viscosity can be determined. Such absolute data can then be examined in detail and fitted to appropriate constitutive relationships .
Actual
compressional data obtained on doughs have been examined in this way and were found to be quite well represented by the Upper Convected Maxwell Model (UCMM)8 yielding two parameters, a viscosity and a relaxation time . Figure
1 , taken from Bagley et al. 8 shows the biaxial extensional viscosity of a hard
wheat flour dough plotted against extensional rate .
The lines are computed from the
UCMM for two choices of the parameters , shear viscosity and relaxation time.
5.0 �------------------------------�-_--_ ----' _ -_.� . . _ _ _ _ _ . ��_.. 4.9
.- 4.8 II)
; 4.7
Q..
.� 4.6 , I- 4.5
-
g> 4.4
...J
4.3
4.2
.
,
· · • ·
jt.
, , , ,
..
Exptl }..
}..
= =
15.1
S, 1} = 3.8
26.4 S, 1} = 6.6
• •
104
Pc
104
Pc
• •
S S
4. 1 +-----�----�---4--+---� - 1 .3 - 1 .5 - 1 .4 - 1 .7 - 1 .6 - 1 .8 - 1 .9 Log
t (5-1)
Figure 1 Logarithmic plot of the biaxial extensional viscosity versus strain rate for a hard wheat flour dough. The experimental points were obtained by uniaxial compression of the dough and the solid and dotted lines were computed using the Upper Convected Maxwell Model with parameters as shown. (Bagley et al. 8)
297
Rheological Properties and Functionality o/Wheat Flour Doughs
An obvious question was whether or not the shear viscosity evaluated in fitting this compressional data agreed with an actual direct measurement of a viscosity in shear. The clear need was to determine a shear viscosity for the dough independently and to compare with the one computed from the UCMM. confmnation of the value of the model .
This would provide independent
A second question was why only one single
relaxation time did such a good job in fitting the compressional data since doughs are known to have a broad distribution of relaxation times.
The work below addresses
these questions in more detail.
1.1 Determination of the Shear Viscosity of Doughs Attempts to determine shear viscosity directly in a cone-and-plate rheometer failed because sample rolled out of the gap before a steady-state condition was reached. Bloksma and Nieman9 maintain this occurs at a total applied shear strain of about 20 units . The problem can be avoided by measuring the transient build-up of viscosity at various shear rates. The mirror image of the viscosity/time plots yield the steady-state values for viscosity/shear rate plots (e.g. , Gleissle and MukherjeelO) . Figure
2
shows the mirror image of the transient viscosity/time plot determined
using a Mechanical Spectrometer in the cone-and-plate mode . The viscosity values are shear rate dependent but appear to be approaching a constant viscosity level, the
1 0 6 ,-------------__________________________________--, Len 89
Cone and Plate •
0.5 Hours
� 1 .4
· 2. 1 + 2.7 Capillary, UR = 40 + 3.5
Shear Rate (S-I )
Figure 2 Apparent viscosity of a dough prepared from a wheat flour (Len 89) versus shear rate. Cone-and-plate data shown are the mirror images· of the logarithmic plots of transient viscosity versus time measurements (Gleissle and MukherjeeIO). Capillary data were obtained using a pressure driven capillary rheometer.
Wheat Structure, Biochemistry and Functionality
298
Newtonian viscosity, at the lowest shear rates. However, for the same flour, viscosity values for preparations of different ages were found to vary by as much as half a decade . In addition to this difficulty there was also the uncertainty as to whether or not the "mirror method " did, in fact, give the "correct" shear viscosity values for these doughs.
An additional independent determination of the shear viscosity was needed.
The tried and true extrusion methodology was adopted to provide an alternate approach to the measurement of the shear viscosity .
In this method nitrogen pressure
is applied to force material to flow from a reservoir through a capillary die of length L and radius R.
The value of LlR chosen was large in the hope of minimizing effects
of pressure losses in the barrel of the viscometer in calculating the viscosity. given applied nitrogen pressure P the output rate, Q, in cc/sec is determined.
For a Values
of Q for a range of applied pressures are found and the results converted to shear stress/shear rate or viscosity/shear rate plots.
As can be seen from Figure 2, there is
a gap between the cone-and-plate and the extrusion data.
Further, the slope of the
extrusion plot is different from that of the other data. Data such as that shown in Figure 2 left unanswered a number of questions including the critical one as to whether or not the LlR value is high enough to mask the effects of flow within the barrel.
Such effects within the barrel are accounted for by
the "end corrections " which describe quantitatively the pressure drops within the barrel as material accelerates towards the die (capillary) . the effective length of the capillary as (L
+
The end correction term, e, gives
eR) .
The shear stress, T, corrected for pressure losses within the barrel, is given by T
=
PRl2(L + eR)
. . . . . . . . . . . . . . . . . . (1)
The apparent shear rate , -Y is computed as 1'.
=
4Qf7rR3 . . . . . . . . . . . . . . . . . . . . . . . . . . . (2)
and then the apparent viscosity is 'Y/.
=
7rPR4/8Q(L + eR) . . . . . . . . . . . . . . . . (3)
If e is small enough, or the length of the capillary large enough, then eR can be neglected and the expression for viscosity reduces to 7rPR4/8LQ, the well-known Poiseuille relation.
(The correction to the computation of shear rate for the non
Newtonian character of the material, the Rabinowitsch correction, is readily made but need not concern us here . ) Equation P
=
(1)
2T(LlR)
can be rearranged to give
+
2Te . . . . . . . . . . . . . . . . . (4)
so that at constant shear rate a plot of pressure needed to attain that shear rate against the length to radius ratio of the die should be linear.
From such plots the end
correction e can be determined. These end corrections can be very large indeed for wheat flour doughs and even for gluten alone as is illustrated in Table
1.
These values of e were computed from data published by Kieffer et al . l l and indicate
299
Rheological Properties and Functionality of Wheat Flour Doughs
Table 1 End Corrections for a Dough and for the Co"esponding Gluten, Calculated from Data Given by Kieffer et al. 11
Calculated from Data in Kieffer et al Lebensmittel U ntersuchung und Forschung -
.,
-
Dough (no additives) Shear Rate (S·1 ) 3.6 7 18 36 71 1 75
-
-
-
-
,
(1 982)
Gluten
End Correction -
-
-
-
-
-
-
-
- 1 38 - 1 29 - 1 23 - 1 66 - 1 70 - 206
-
-
-
-
-
-
-
-
-
-
-
-
- 63 .7 - 5 1 .3 - 52 7 . - 69 .3 - 7 1 .2 - 1 09 5 .
Capillary Diameter 0.76 mm Viscometer Length 150 mm
that the die lengths used in obtaining Figure 2 were not long enough. Clearly, a more detailed investigation of these end corrections for wheat flour dough systems was needed. An additional, and quite fascinating, feature of the Kieffer data given in Table 1 is the absolute size of the end corrections.
For many synthetic high polymers and for
polymer solutions values of e above the range 10 to 15 are rare. Kieffer's high values of e for doughs are not unique; similar high values have been reported by others, including ourselves. Note, however, that for Kieffer's experiments the value of eR is 206x.38
mm or 78 mm, more than half the length of the viscometer barrel, which is
The physical significance of such large values needs to be carefully 150 mm! considered, particularly with regards to the reliability and significance of data obtained when more
than half of the barrel charge has been extruded.
1.2 Extensional Viscosities from Capillary Flow Experiments Another reason for such capillary end correction studies was that from the end correction data information on extensional flow properties of the dough can be determined. This was first proposed by Cogswell some years ago and a more recent theoretical analysis by Binding12 has revived interest in the approach. Figure 3 illustrates the physical processes going on during extrusion from a reservoir through a capillary die. A pressure is applied at the top of the reservoir and material is forced through the tube at the bottom.
Along the center line material is
being subjected to an extensional deformation. Material off the center line undergoes increasing proportion of shear deformation as the distance from the center line is increased. Pressure in this flow process drops from P to atmospheric in passing down through the barrel and the capillary .
From the pressure drop in the barrel an
300
Wheat Structure, Biochemistry and Functionality
extensional viscosity is computed following Binding. capillary the shear viscosity is determined.
From the pressure drop in the
This extrusion experiment, in principle ,
completely characterizes the shear and extensional rheological behavior of a material . Figure
4
indicates how the separation between pressure drop in the barrel and
pressure drop in the capillary is made experimentally. obtained for a number of dies of different
LlR values.
Pressure/shear rate plots are From these plots, the pressure
required to give a given shear rate is determined for each plotted as P versus
LlR
as in Figure
LlR value and the results are
4.
The value o f the end correction e i s determined from the intercept o f these linear
T
�PC
=
PA
HtH
PEN - PEX L -' ..
..
+- 2 R o
. - - - PEN
..,..-- - - - PEX +- 2 R
Die Swell
=
RlRo
Figure 3 Diagrammatic illustration offlow of a viscoelastic fluid from a reservoir
(ba"el) through a capillary or die of radius Ro and length L. The total applied pressure is PA, and the pressure at the die exit is PEl{' usually atmospheric pressure. From pressure drops in the ba"el and capillary the extensional and shear viscosities, respectively, can be evaluated.
LlR plots
O.
on the P
=
0 axis.
The pressure drop in the barrel is the pressure at
LlR
=
Knowing this value the pressure drop in the capillary can be determined . Following
Bindings analysis then both the extensional and shear viscosities can be found . Preliminary experiments with a number of different spring and winter varieties gave results shown in Table
2.
It appears that the ratio of extensional to shear viscosity is
high for the spring and low for the winter varieties. However, in attempting to replicate data, experimental problems became very evident.
Specifically, as illustrated in Figure
4,
it can be hard to get data to the
precision needed to obtain good values either of the intercept at
LlR
=
0
or of the
slope of the plot (which gives the true shear stress at the capillary wall and hence the shear viscosity) .
It is not enough to simply fit the data statistically; one needs good
straight line plots of high precision and accuracy such as can often be obtained with synthetic polymers . For doughs, however, two problems exist that are normally absent
Rheological Properties and Functionality of Wheat Flour Doughs
301
in synthetic polymer systems. First, dough samples change properties significantly as they age so the effects of sample age are of major concern. In consequence of this aging effect, it becomes necessary that each set of points at a given LlR is obtained with one batch of dough. A fresh batch is made up (and appropriately aged) for the next set of points at a new LlR. It is extremely difficult to prepare the replicate batches to the desired level of precision to yield acceptable values of either the slopes of the plots (which give the true shear stress) or the intercept at LlR (from which the calculation of extensional viscosity is made).
Bagel Flour 2-22,27-1 993 R = 0.053cm
p
(psi) 1000
400 8 "
800 •
-40
-20
o
20
40
(UR)
60
80
100
Figure 4 Pressure versus capillary (L/R) for a bagel dough (no yeast) for two shear rates. The potential data variability is indicated by the two lines fitted to the lower shear rate line, this variability leading to significant uncertainty in intercepts at both LlR 0 and P O. =
=
1.3 Sample Heterogeneity In establishing our ability to replicate data, to determine variability from laboratory to laboratory and to explore for time variations, extrusion experiments were conducted using both a gas pressure driven rheometer and a Rosand piston driven rheometer. For both instruments large and unexpected data fluctuations were observed. In the case of the Rosand piston-driven rheometer data were obtained in the form of pressure versus time at constant output rate. In the gas-driven rheometer, output rate was monitored
302
Wheat Structure, Biochemistry and Functionality
as a function of time at constant applied gas pressure . Surprisingly large fluctuations in output rate at constant pressure were observed as illustrated in Figure barrel used.
5
where output rate is plotted against volume of sample in the
(Using this volume measure is equivalent to using time as the abscissa . )
Such large fluctuations make i t impossible to obtain end corrections o r barrel pressure drops to the precision needed for adequate characterization of dough properties for applications such as quality control. Equivalent variations in pressure at constant output rate were found with the Rosand viscometer. fluctuations appear to
For a given flour and a given mix the
be quite random and the magnitude of the fluctuations seems to
be approximately the same for replicate mixes.
However, a detailed and careful
statistical study of the fluctuations has not at this time been carried out.
Table 2 Values of the Ratio of 1 and k, the Parameters Computedfrom Experimentally Determined Shear and Elongational Viscosities, Obtained for a Number of Spring and Winter Wheat Varieties. Protein Levelsfor the Particular Samples are also Tabulated.
11 s = kyn-l
11 E = ,R £ t-l
Spring Wheats Marshall (#354)
Protein % Ilk
Protein % Ilk
1 4.9 1 09
ROC�
Guard (#31 8)
Stoa (#304)
Butte (#350)
Len (#31 5)
1 6.5 157
17.1 215
1 5.5 231
1 9.5 417
Winter Wheats
(#403
Newton (#446)
Yolo (#41 1 )
Arkan (#433)
Chisholm (#421 )
1 7.6 30
1 3.4 32
7.8 36
1 4.5 80
1 2.7 1 61
That these variations are associated with sample heterogeneity was conflrmed by direct visual observation of the actual dough filament extrudates .
One could see
signiflcant fluctuations in extrudate diameter as the filaments emerged from the dies. An obvious way to make the samples less heterogeneous is to overmix them.
In
preparing dough samples the usual standard mixing procedures were employed in which water levels were adjusted and samples mixed to a peak in the Brabender mixing unit of
500
Brabender Units.
fluctuations seen in Figure
When samples were deliberately overmixed the output rate
5 disappeared,
and output rates which varied little with time
(or volume extruded) were observed (Figure
6).
303
Rheological Properties and Functionality of Wheat Flour Doughs
LEN-92-7
P = 60psi; UR = 49.4; R = 0.1 52em
0.1 0 0.09 0.08 U CD
�
.2-
�
II:
�
0
u::
0.07 0.06 0.05 0.04 0.03 0.02 0.01 0
60 40 Volume used (ee)
20
0
100
80
Figure 5 Variations inflow rate during capillary extrusion at constant appliedpressure plotted against total volume of sample extrudedfrom the barrel (which is equivalent to time). Flour used is a LEN mixed to 500 BU. 21 ·C, UR
=
48.4 R
=
LEN-92b-33
0.052em (ovmix 40 min 400BU) P
=
250psi
500 .------,
400
300
200
1 00
I
I��ooo ooo r
1
- 1 64 ± 3 - - 1 70 ± 2 ---------..
O �--_.--_.----._--r_--��_.-
o
20
40
60
80
1 00
Volume used (ee)
Figure 6 Variations in flow rate during capillary extrusion of a LEN dough that has been overmixed. (Compare with Figure 5.) The variations in output rate are shown for the initial portion, last portion and total curve and it is evident that overmixing has reduced the fluctuations to something of the order of 1 % .
Wheat Structure, Biochemistry and Functionality
304
Thus with ovennixing, the output rate at constant pressure is constant, during the time that the barrel is being emptied, to within about 1 % as is seen on the Figure
6.
Such experimental precision i s needed t o obtain adequately precise end correction results and to reduce the variability of P versus
LlR plots illustrated in Figure 4.
Such
improved data precision is absolutely essential to obtain data good enough to differentiate among varieties and to compute " good" extensional and shear viscosities. The problem is that it is not the ovennixed doughs we really want to characterize . There are two obvious ways to proceed.
If the objective is shifted to answering the
question concerning the degree of heterogeneity of a dough mixed to the "optimum" level of 500 BU, then the fluctuations observed in these extrusion studies could be used to evaluate quantitatively the degree of sample heterogeneity. One could also use other methods involving very small samples of the dough, for instance cone-and-plate viscometry, and running a number of different samples.
The results from a series of
samples would, no doubt, fluctuate and these fluctuations could again be analyzed to provide a quantitative measure of sample heterogeneity . On the other hand , if the objective remains characterization of the shear and extensional viscosities through the capillary viscometer approach, then larger samples need to be used.
If samples are large enough, a better approximation to the " true "
output rate at constant pressure for the sample could be obtained .
This would lead to
end correction plots with less variability and hence more data precision.
Larger
samples would, for capillary viscometry , mean larger radii dies and this in tum means larger reservoirs and the approach could rapidly become unwieldy .
An alternate approach to using a "batch" type rheometer, where the dies or capillaries are being fed from a reservoir of limited capacity, is to feed the dies continuously from an extruder.
This approach has been successfully applied by, for
example, Senouci and Smith13.14 and Bhattacharya and coworkers . 15 There are, naturally , problems with the use of extruders , particularly if large radius dies are to used.
Operation at high shear rate can be very profligate of material and
the method is obviously unsuited to experiments where only small quantities of material are available.
Further, output rate has to be controlled and monitored . The control of
output rate can be done in various ways, for example, by changing the rate of rotation of the screw.
This will affect the amount of work and the rate of work input into the
dough and thus alter the properties of the material being investigated . One can operate with a starved screw13 or control output through the die by taking material off a side stream. 15 For an extrusion process measurements of the type discussed above may be very useful for process control or for monitoring of product properties.
However, it is not
clear whether or not the extrusion data (say through a slit die) can be obtained with the precision and accuracy desirable for a scientific investigation of such issues as how best to
evaluate protein quality and how protein quality relates
environmental effects, etc.
to
varietal
and/or
Some of the factors affecting extrusion studies and some
aspects of experimental errors involved in such studies have been discussed by Padmanabhan and Bhattacharya. 16 Frequently in published work general trends can be readily seen but often the data are plotted on log-log scales and scatter on such scales and the corresponding variations in the absolute values of the quantities being measured can be for many purposes unacceptably large.
Rheological Properties and Functionality o/ Wheat Flour Doughs
305
1.4 Relaxation Times The measurement and interpretation of relaxation times in wheat flour doughs represent another area of challenge. data for the dough of Figure this is a wide variation.
1
are
The two relaxation times chosen for fitting the
15.1
and
26.4 seconds.
Percentagewise, of course,
Further, even a cursory look at dough behavior reveals that
much longer relaxation effects can be present indicating relaxation processes occupying hundreds or even thousands of seconds. 17 Nevertheless, the values from Figure
20
s) were not out of line with values, which were in the range
Frazier et al. 18
12-50
1
(
-
s, reported by
This later reference is of especial interest because some effects of
protein level, wheat variety , and work input during dough preparation are described though it should be remarked that the method used by Frazier et al. to evaluate relaxation time is arbitrary, yet nevertheless effective for their needs. One approach to measuring the distribution of relaxation times for polymers is to measure dynamic properties over a decade or two of frequency and to do this at a variety of temperatures. Master curves can then be drawn, using the Williams-Landel Ferry shift factor. These master curves extend over numerous decades of time and thus a picture of the relaxation times and relaxation time distribution can be obtained . For doughs , as for most biopolymers, the concept of measuring over a range of temperatures just is not workable, since the properties of doughs change irreversibly with temperature .
Dough heated to 80°C is quite a different substance than dough at
room temperature . 19 The fact remains , though, that there is sufficient evidence in the literature to conclude that it would be valuable to have a better insight into the relaxation times,
and
hence
relaxation processes,
of doughs .
More detailed
investigations of, and theoretical and molecular analyses of, relaxation behavior of doughs could be most informative .
2
CONCLUDING COMMENTS
In spite of excellent contributions from many cereal scientists over the years , the problems associated with determination of the rheological properties of wheat flour doughs continue to provide ongoing challenges.
Theoretical considerations make it
clear that testing of such complex materials as wheat flour dough requires application of a variety of testing modes, two common testing modes being extension and simple shear.
Having obtained the rheological data, a critical subsequent step is to describe
the material behavior mathematically through the use of an appropriate constitutive equation or model.
Such a model can be used in a variety of ways, for example in
engineering calculations or to provide parameters that can be checked through independent experimental measurements to confirm both the value of the model and the validity of the experimental data. The dependence of dough properties on such factors as time , work input, and rate of work input coupled with the extreme sensitivity of dough properties to water level and biological activity (e .g. , activity due to the presence of specific enzymes) complicate the task of obtaining reliable and meaningful data. The difference between " reliable" and "meaningful " can be illustrated with reference to the heterogeneity of wheat flour doughs mixed to the normal level of
500 BU:
The data obtained on such
a mixture fluctuates over a range determined by the degree of heterogeneity and the sample size. These fluctuations can be minimized by overmixing the sample, but while
Wheat Structure. Biochemistry and Functionality
306
the data so produced are reliable they are not particularly meaningful because the market for overmixed dough is pretty limited though interest in the mixing process is high! 20. 21 This paper was to describe the experimental and conceptual problems arising in the rheological characterization of wheat flour doughs. It is essential to recognize first of all that any experimental method chosen (say to measure a shear viscosity) will yield numbers of some sort. It is necessary somehow to obtain independent checks of these numbers. To obtain these independent checks is not easy . The experimental problems can be very frustrating, as in the case of sample "roll-out" from a cone-and-plate viscometer. Methods developed with materials other than doughs, for example the Gleissle mirror image methodology, may or may not be valid for doughs. The applicability of a particular methodology needs to be confirmed. Other problems may arise unexpectedly, as for instance the effect of sample heterogeneity arising with doughs mixed to an "optimum" level. Such experimental problems give rise to conceptual problems. Heterogeneity can be overcome by making measurements on samples large enough so the heterogeneity is not observable, for instance by continuous extrusion using large dies. But how are the effects of extrusion processing on dough properties to be taken into account for a material so sensitive to moisture level, time, and shear history? How should we treat the question of relaxation times of doughs when certain data are well fitted with a single relaxation time when we know that there is a very broad distribution of relaxation times (from tenths of seconds to thousands of seconds) that can be significant as seen in stress relaxation experiments? What molecular and structural features exist in doughs to give rise to this broad distribution of relaxation times? How do we obtain a broad spectrum of modulus\time plots when time-temperature superposition methods cannot be used with a temperature sensitive material such as dough? These and numerous other questions remain to provide opportunities for advances both in our understanding of dough behavior and protein quality and in our ability to apply our knowledge to improve processing procedures and final product quality. Among ways available for the cereal scientist to exploit these opportunities one can include the application of the sophisticated computational methodology currently available today. These methods can be used to examine rheological data in the light of a variety of constitutive equations and rheological models. There also seem to be opportunities to apply some of the newer concepts of fractals, chaos and advances in treatment of non-linear systems in general, to examine in detail such effects as the output rate fluctuations observed during dough extrusion at constant pressure. Not least among the opportunities is the chance and need to obtain more experimental rheological information on well characterized flour systems to more fully delineate the behavior of wheat flour doughs. ACKNOWLEDGMENTS : Thanks are due to F. Alaksiewicz (NCAURIUSDA) and to R . Tames (Kraft General Foods) for first-class technical support.
References 1.
R. K. Schofield and G. W. Scott Blair, 'The Relationship between Viscosity, Elasticity ,and Plastic Strength of Soft Materials as Illustrated by some Mechanical Properties of Doughs' , Proc. Royal Soc. (London) , 1 932, A 1 3 8 , 707-7 1 8 .
Rheological Propenies and Functionality of Wheat Flour Doughs
2. 3.
307
N. W. Tschoegl, J. A. Rinde, and T. L. Smith, 'Rheological Properties of Wheat Flour Doughs' , I. - "Method for determining the large deformation and rupture properties in simple tension" , J. Sci. Fd. Agric. , 1970, 21, 64-70. J. R. Smith, T. L. Smith, and N. W. Tschoegl, Rheol. Acta, 1970, Band 9, Heft
2, 239-252. H. Faridi and J. M. Faubion, Editors, 'Fundamentals of Dough Rheology ', American Assoc. of Cereal Chemists, 1986, St. Paul, Minnesota. 5 . H. Faridi and J. M. Faubion, Editors, 'Dough Rheology and Baked Product Texture' , Van Nostrand Reinhold, New York, 1990. 6. J.M.V. Blanshard, P. J. Frazier, and T. Galliard, 'Chemistry and Physics of Baking' , Royal Soc. of Chemistry, Burlington House, London, 1986, WIV OBN. 7. C.J.S. Petrie, 'Elongational Flows - Aspects of the Behavior of Model Elasticoviscous Fluids' , Pitman Publishing Ltd . , London, 1979, WC2B 5Pa. 8. E. B. Bagley, D. D. Christianson, and J. A. Martindale, 'Uniaxial Compression of a Hard Wheat Flour Dough: Data Analysis Using the Upper Convected Maxwell Model' , J. Texture Stud. , 1988, 19, 289-305 . 9. A. H. Bloksma and W. Nieman, 'The Effect of Temperature ori the Rheological Properties of Some Wheat Flour Doughs' , J. Texture Stud. , 1975, 6, 343-361 . 10. W. Gleissle and D. Mukherjee, "Measurement of transient and steady-state shear and normal stresses in filled polymers" , Progress and Trends in Rheology II, Proceedings of the Second Conf. of European Rheologists, Prague, June 17-20, 1986, Edited by H. Giesekus and M. F. Hibberd, Springer-Verlag, New York,
4.
1988. 1 1 . R. Kieffer, J. Kim, M. Kempf, H-D Belitz, J. 12. 13. 14. 15.
Lehman, a. Sprossler, and E. Best, 'Untersuchung Rheologischer Eigenschaften von Teig und Kleber aus Weizenmehl durch Capillarviscosimetrie' , Z Lebensm Unters Forsch, 1982, 174, 216-22 1 . D. M . Binding, 'An Approximate Analysis for Contraction and Converging Flows' , J. Non-Newton. Fluid Mech. , 1988, 27, 173-189. A. Senouci and A. C. Smith, 'An Experimental Study of Food Melt Rheology. I. Shear Viscosity Using a Slit Die Viscometer and a Capillary Rheometer' , Rheol. Acta, 1988, 27 , 546-554. A. Senouci and A. C. Smith, 'An Experimental Study of Food Melt Rheology. II. End Pressure Effects' , Rheol. Acta, 1988, 27, 649-655 . K . Seethamraju, M . Bhattacharya, U. R. Vaidya, and R. G. Fulcher, 'Rheology and Morphology of Starch/Synthetic Polymer Blends' , Rheol. Acta, 1994, 33, 553-
567. 16. M. Padmanabhan and M. Bhattacharya, 'Flow Behavior and Exit Pressures of Com Meal Under High-Shear-High-Temperature Extrusion Conditions Using a Slit Die',
J. Rheol. , 1991 , 35(3) , 315-343.
17. E. a. Bagley and D. D. Christianson, 'Stress Relaxation of Chemically Leavened Dough-Data Reduction Using the BKZ Elastic Fluid Theory' , J. Rheol. , 1987, 31(5), 405-413. 18. P. J. Frazier, N.W.R. Daniels, and P.W.R. Eggitt, 'Rheology and the Continuous Breadmaking Process' , Proc. of Symp. on Rheology of Wheat Products. Cereal Chem. , 1975, 52(3) , l06r-130r. 19. J. D. Schofield, R. C. Bottomley, M. F. Timms, and M. R. Booth, 'The Effect of Heat on Wheat Gluten and the Involvement of Sulphydryl-Disulpbide Interchange Reactions' , J. Cereal Sci. , 1983, I , 241-253.
308
Wheat Structure, Biochemistry and Functionality
20. K. Okada, Y. Negishi, and S. Nagao, 'Factors Affecting Dough Breakdown in Mixing ' , Cereal Chem. , 1987, 64(6) , 428-434 . 2 1 . G. Danno and R. C. Hoseney, 'Changes in Flour Proteins During Dough Mixing ' , Cereal Chem. , 1982, 59(4) , 249-253 .
PHYSICAL FACTORS DETERMINING GAS CELL STABILITY IN A DOUGH DURING BREAD MAKING
T van Vliet Department of Food Science Wageningen Agricultural University P.O. Box
8129 6700 EV Wageningen
The Netherlands
1
INTRODUCTION
A good quality bread should have a high gas volume and a fine, regular crumb structure. During mixing of bread dough a small amount of air is entrapped , in the form of small spherical gas cells. The number of gas cells is between with a diameter of about
10-100
1012
and
1014
m-3
",m. During fermentation and baking some of these
gas cells will grow, initially due to carbon dioxide produced by the yeast and later mainly due to the temperature increase and water evaporation. I The number of visible gas cells in the crumb of bread is about between
10-4
and
10-2
1010
per m3 solid material which is only
of the estimated number of gas cells in dough after mixing .
Obviously a large number of gas cells have disappeared (or became invisible) because they were physically unstable or did not grow out. Physical instability processes that play a crucial role during the bread-making process are Ostwald ripening and coales cence.2 Ostwald ripening or disproportionation is the growth of large gas bubbles at the expense of smaller ones due to the higher overpressure (Laplace pressure) of the gas in the small gas cells resulting in a higher gas concentration in the vicinity of these cells. It causes diffusion of gas towards larger cells. Coalescence of gas cells is due to rupture of the dough film between them. It is the main instability mechanism at the end of the tin proof and during baking and extensive coalescence then would result in a irregular and coarse crumb structure. Copious coalescence leads to contact of gas ceUs with the outside air, hence to a large loss of bread volume. Another process that is important for obtaining a regular crumb structure is that the gas cells growing out do so at roughly equal rate. If only surface properties would be involved the lower Laplace pressure in the large gas ceUs would cause that the gas produced diffuses preferentially to these gas cells, resulting in an irregular coarse crumb structure. In this paper we will discuss the various physical parameters that may play a part in the stability of a bread dough against disproportionation and coalescence and for obtaining equal growth of gas cels during fermentation and baking.
Wheat Structure, Biochemistry and Functionality
310
2
OSTWALD
RIPENING
Ostwald ripening is caused by the gas pressure difference between gas cells of different size. Due to the curvature of the gas-liquid interface a pressure difference
tlP (the so
called Laplace pressure) exists over this interface, which is given by: tl p
where -y is the interfacial tension and
R
2 .1.
=
R
(1)
the radius of the gas cell This excess pressure
results in an enhanced equilibrium gas concentration around a gas cell, which is higher around a small gas cel than around a large one. This concentration difference results in transport of gas through the liquid mass by diffusion from the small to the large gas cells. The end result will be the disappearence of the small gas cells. An order of magnitude calculation on the shrinkage rate of the small gas cells due to Oswald ripening can be made by using the de Vries equation, which reads:3
4 R TDSy Ph
where
'I
is the bubble radius at time t,
constant (8. 3 1
J . KI . mol-I), T
the dough (about 10-9 m2 • S-I),
t
(2)
'0
temperature
the initial radius (5-50 I'm) , R the gas (K), D diffusion coefficient of the gas in
S solubility of the diffusing gas (about 0.43 mmol . m-3
• Pa-I for CO and 2 % of it for N gas), -y the surface tension (about 40 m N · m-I), P 2 2 atmospheric pressure (lOS Pa) and h the average thickness between the small and the much larger surrounding gas cells. Due to the increasing difference in the Laplace pressure the disappearence of a smal gas cell is a self accelerating process. According to Eq. 2 gas cells with a diameter of 10 to 20 I'm would disappear within a minute for
h
is 100 I'm. For larger ones it may take an order of magnitude longer. On average it
will take about half an hour before the yeast has produced enough carbon dioxide for the liquid dough phase to become saturated . During that time most small gas cells would have disappeared already. Ostwald ripening in dough may be retarded or stopped for several reasons: - The Laplace pressure in large gas cells is smaller than in small ones and so the driving force for Ostwald ripening will decrease after the disappearence of the smallest cells. - During shrinkage of a gas cell its gas-liquid interface decreases and, depending on the properties of the surface active material present in the surface, its surface concen tration will increase. Such an increase results in a lowering of -y and thereby in the gas cell considered . Shrinkage of a gas cell will stop if the decrease in
R
tlP of
is off-set
by a decrease in -y. The response of the surface tension is expressed in the surface dilational modulus Ed == d-yldlnA , where A is the surface area. 4,s If Ed > 0, shrinkage of the gas cell is slowed down and if
Ed
�
Ih-y, it stops. However, due to the
viscoelasticity of the gas dough surface, the modulus will be smaller at longer times scales; consequently this mechanism would not stop Oswald ripening in dough. It does cause a decrease in the shrinkage rate of the small bubbles, to an extent that can be affected by the action of emulsifiers added to bread dough . 6 However, as long as
Ed
<
Ih-y Ostwald ripening will continu during fermentation and its relative rate may even increase due to the decreasing distance between the gas cells with increasing volume
31 1
Rheological Propenies and Functionality o/Wheat Flour Doughs fraction of gas.
- During growth of a gas cell the dough around it is extended biaxially which gives rise to a bulk stress
u opposing further growth.7 The driving force for Ostwald
ripening will also be diminished if this additional resistance to growth of the largest
gas cells would compensate for the difference in Laplace pressure.8,9 The driving force will be zero if
U1 - U.
=
I1P. - I1P..
where the subscript s denotes the smaller and
I the
larger gas cell. Moreover, to obtain a stable situation in which a small disturbance
does not lead to Ostwald ripening, the increase of has to be larger than the increase in taking changes in
I1P.
UI due to ongoing Ostwald ripening
due to the accompanying decrease in size
U. and in I1P1 into account. So:
dOl dRl
+
dl1Pl dRl
--
dos dRs
dl1 Ps dRs
> -- +
(3)
U is not simple. I1P acts over an area 7rIf while U acts u(r) depends on the biaxial strain E and on biaxial strain rate E, and both decrease with Estimation of the relevant
as a first approximation on a spherical shell around the gas cell. However, increasing distance from the gas cell surface. For an isolated gas cell;
(4) where
r is the distance from the centre of the gas cell and 'Y the surface tension. For a r, E and E can be calculated .7 The relation between u(r) and E and between u(r) and E is known from experiments, and the effec tive u acting on the gas cell can thus be estimated by a numerical approximation for an isolated gas cell. It results in u is about 0.4 · u(R) where u(R) is the biaxial stress in
given gas production the relation between
,
the dough directly adjacent to the gas cell. In reality however, gas cells are not isolated
and the
u(r) developing around a gas cell will interfere with those around adjacent u and u(R) to become larger than 0.4.
cells. This would cause the ratio between
Arbitrarily we have chosen a ratio of volume fraction. As said above
I1P
0.5,
although it will actually depend on the gas
equals to 2'YIR. Shrinking of gas cells in a dough would cert
ainly lead to a lowering of 'Y while, in principle, 'Y around a growing gas cell would become somewhat higher. However, due to the low strain rates involved
5
•
(E
of about
l O-4f the increase in 'Y will be very small and insignificant compared to the other
factors. The decrease in 'Y for a shrinking gas cell will be much more substantial, as the relative rates of shrinking of the interface around these gas cells are much higher than the relative expansion rates around the larger ones. Taking into account that dRl is positive and dR. is negative and assuming that initially 'Y is the same for the small and the large gas cells, formula
3
dO l dRl
can be rewritten as: _
� Rf
After multiplication of both side by
after some rearrangements:
>
dos dRs
+
� R;
_
2� Rs dRs
(l/(UIUJ and making use of dE
(5) =
dR/R) one obtains
312
Wheat Structure, Biochemistry and Functionality
For not too small e it is often found that dlnol de is independent of e . 7 After multiplica tion of both sides by u.R1> taking u
[
]
=
0.5
u(R) and by making use of de,
=
-
(RI3/R,3) . del one obtains some rearrangements and taking into account that dlnu, is negative, the next formula:
dlna ( R) l _ R; a ( Rs) de R{ a ( R1 ) For u(R,)
=
0 and
(d')'/dR)
=
0
7,
+
2 Y I Rs Rl a ( R1 ) Rs
formula
dlna ( R ) de
In the derivation of formula
(
>
7
>
Rs] Rl
[
reduces to.
2 Y IRs Rl Rs + a ( R1 ) Rs Rl
_
2_ R l � a ( R1) Rs dR
_
]
(7)
(8)
effects due to varying strain rate are neglected. Due to
the smaller R, the strain rate by which the continuous phase around the smaller gas cell is compressed is higher than the strain rate by which the larger gas cell is expanded . This makes that dlnu(R,)/de and dlnu(RJ/de are not the same as was implicitely assumed in deriving formula
7.
In the latter stage, however, a correction for this effect
would be rather small as the dependency of dlnu(R) on the strain rate is much smaller than that on the strain .6,7 As follows from the derivation of equation
7
the dependency of ')' on R for the
small gas cell leads to an extra term {-2RI/U(RJR,} ' {d')'/dR} at the right hand side. Because d')' and dR are both negative, d')'/dR is positive, which implies that the crite rion expressed by formula
7
will be fullfilled easier if d')'/dR is larger. Consequently
surface rheological effects will enhance the retarding effect on Ostwald ripening due to bulk rheology and will help to stop it completely, even after the bulk rheological properties have become the main factor.
3
EQUAL GROWTH OF GAS CELLS
In the absence of bulk stresses growth of a gas cells will occur if the gas concentration in the material adjacent to the cell is higher than the gas concentration in equilibrium with its Laplace pressure. In viscoelastic materials the gas concentration for growth has to be higher, due to the extra resistance against (further) biaxial extension. The amount of dissolved gas must be high enough to compensate for stress u. For u
=
0.5 · u(R)
!:lP and the opposing biaxial
equal growth of gas cells with the same size due to gas
production in their surrounding would occur if:
�(l:. a ( R ) + 2 :1.. ) dR 2 R If ')' is independent of R and using deB
=
> 0
(dRIR) the next criterion is obtained :
(9)
313
Rheological Properties and Functionality of Wheat Flour Doughs dIna
de
( R)
2_ � _
>
a
( 10 )
( R) R
This equation is equal to equation 8 for R, RI• The criterion for obtaining equal growth of gas cells of similar size thus depends on the ratio of the Laplace pressure 2"(/R over the biaxial stress and on the strain hardening of the continuous phase. The criterion is fulfilled easier if the extent of strain hardening is stronger and/or the biaxial stress is higher. An estimate by Kokelaar et al.8 of the values of the Laplace pressure and of u(R) during breadmaking indicate that for most cultivars u(R) would become larger than the Laplace pressure already during the first proof, but the precise stage at which this would be the case depends on the cultivar. For gas cells of different sizes, the analysis is somewhat more complicated. Due to the higher Laplace pressure in small gas cells than in large cells, gas formed in the continuous mass between various gas cells will diffuse preferentially to the larger cells. To obtain preferential growth of the small gas cells, the large overpressure in these cells has to be compensated by a larger biaxial stress around the larger cells. This will be the case if the condition given by formula 3 is fulfilled. The only difference with the analysis for Ostwald ripening is that in this case both gas cells grow at a low strain rate, so d"(/dR will be very small and can be neglected. The end result is: =
dIna
de
( R)
[1 -
R; R{
which is equal to formula 7 for d"(/dR
a
a
( Ra ) ( R1 )
=
1
>
2y IRs
a
( R1 )
[
Rl Rs
+
Rs Rl
J
( 11 )
O.
3 COALESCENCE Coalescence of gas cells involves rupture of the dough film between them. It will be primarily important after the transformation of the dough from a foam with spherical gas cells into one with polyhedral ones. For a very high-volume bread this transition may occur at the end of the fermentation stage, in other cases it will be during baking. During growth of the gas cells the dough films between them are extended biaxially.1 The stability of these films against biaxial extension will determine the stability of the dough against coalescence. Two mechanism may cause rupture of the dough films. The first is due to the development of weak spots caused by accidental local thinning and the second is due to a too small rupture strain of the film . Van Vliet et al.1 derived criteria that relate the stability of dough films between two gas cells against local thinning and so against rupture, to the relative increase of the biaxial stress u (dlnu )over the accompanying increase of the biaxial strain e (de). If this ratio is greater than 2 a thinner, which implies a relatively more extended, part of the dough film will have a higher resistance towards further extension than the thicker, i . e. less extended parts. However, since dough is a viscoelastic material and because the biaxial strain rate of the dough around a larger gas cell will be smaller than that around a small gas cell (at constant gas production), a correction has to be made. This results in the next condition:
Wheat Structure, Biochemistry and Functionality
314
( 12 )
where Eb is the biaxial strain rate. The factor alnE/ae corrects for the dependence of the biaxial tensile strain rate of the dough around the gas cells on the biaxial strain of the dough, its value depends on the stage of the bread-making process. During fermentation the quotient is about -3, while during baking it was observed to vary between + 1 .5 and +2. 1 ; hence, the criterion given by formula 1 2 is more strict at the end of the fermentation stage than during the baking stage.7 Often, the transition of a foam structure with spherical gas cells to one with polyhedrical cells occurs only during the baking stage. If this is the case lower requirements are set to the strain hardening properties of the dough and vice versa. Kokelaar showed that the variation in strain hardening among cultivars at 20 °C is also present at a 55 °C.6 At the end of the baking stage the dough films between two gas cells may become as thin as the size of a starch granules. 10 The film then can not be considered anymore as a homogeneous dough film but will behave more as a hydrated gluten (+ other soluble components) film containing starch particles. Also hydrated gluten films exhibit strain hardening both at 20 and at 55 °C . 6, 1 1 The second mechanism of film rupture occurs if the biaxial fracture strain (the biaxial "extensibility") of the dough is too small. That there is a relation between the baking behaviour of a bread and the extent to which a dough film can be extended before it breaks was shown by de Bruijne et al. 12 They also illustrate that for obtaining a good relation it is essential that the extension experiments are done at the relevant (low) rate of elongation . The high elongation rates in instruments like the extensograph and the alveograph seriously limit their value for determining rupture strain. Moreo ver, in the extensograph and in the experiments done by de Bruijne the dominant deformation was uniaxial extension in stead of biaxial. How seriously this affects the applicabilty of their results is not known.
4 GENERAL DISCUSSION The discussion given above show that for all the three physical mechanisms important for obtaining a good quality bread, more than one physical parameter determines the bread-making potential of a dough. A summary of the relevant physical parameters is in table 1 . These physical parameters should be determined at the relevant low strain rates and the right (large) strains. As discussed above, not all three mechanism are equally important during each stage of bread-making. Kokelaar did not observe variation in the surface tension or the surface dilational modulus among various (4) wheat cultivars . 6 This would imply that the variation in baking behaviour among the cultivars studied was due to variation in bulk rheological properties. In accordance with this, both in the study of Kokel� and that of Janssenll the ranking of the bread-making performance could be done on basis of bulk rheologi cal properties. However, for definitive conclusions more research has to be done. Surface rheological properties can be affected by the addition of emulsifiers and so they will clearly affect the disproportionation process and with that bread-making performance.6,1 3 Emulsifiers did not affect strain hardening properties.
Rheological Properties and Functionality of Wheat Flour Doughs
315
Table 1 Relevant physical parameters during bread-making i n relation to the various mechanism discussed above + relevant, - not relevant, ? relevance not clear but probably small. 6,8 Physical Parameter
Disproportionation
Equal growth gas cells
Coalescence
-
?
+
+
?
Biaxial stress
+
+
Strain hardening
+
+
Surface tension
+
Surface dilational modulus
Fracture strain (in biaxial extension)
-
-
-
+ +
References 1. 2. 3. 4. 5. 6. 7. 8.
9. 10. 11.
12.
13.
A.H. Bloksma, Cereal Food World, 1990, 35, 228. T . van Vliet, A.M. Ianssen, A.H. Bloksma and P . Walstra, J. Texture Stud. , 1992, 23 439. A.I. de Vries, Recueil Trav. Chim. , 1958, 77, 209. I. Lucassen, in 'Anionic Surfactants: Physical Chemistry of Surfactant Action' (E.H. Lucassen-Reinders, ed.) Dekker, New York, 198 1 , p. 2 17. P. Walstra, in 'Foams: Physics, Chemistry and Structure' (A.I. Wilson, ed.) Springer-Verlag, London, 1989, p. 1. 1.1. Kokelaar, 'Physics of Breadmaking, ' Ph D Thesis, Wageningen Agricultural University, Wageningen, The Netherlands, 1994. T van Vliet, A.M. Ianssen, A.H. Bloksma and P. Walstra, J. Texture Stud. , 1992, 23, 439. 1.1. Kokelaar, T. van Vliet and A. Prins, in 'Food Colloids and Polymers: Stability and Mechanical Properties, (E. Dickinson and P. Walstra, eds.), Royal Soc. Chem. ,Cambridge, 1993, p. 272. T. van Vliet and 1.1. Kokellku , in 'Progress and Trends in Rheology' , Proc. Fourth Eur. Rheol. Conf. (C. Gallegos, ed.), Steinkopff, Darmstadt, 1994, p. 201 . R.M. Sandstedt, L . Schaumberg and I . Fleming, Cereal Chem. , 1954, 31, 43 A.M. Ianssen, 'Obelisk and Katepwa Wheat Gluten, A Study of Factors Determi ning Bread Making Performance, Ph.D. Thesis, State university Groningen, Groningen, The Netherlands. D.W. de Bruijne, I de Loof and A. van Eulem, in 'Rheology of Food, Pharma ceutical and Biological Materials with General Rheology' (R.E. Carter, ed), Elsevier Aplied Sci . , 1990, p. 269. 1.1. Kokelaar, T. van Vliet and A. Prins, in 'Food Macromolecules and Colloids' (E. Dickinson and D. Lorient, eds.), Royal Soc. Chem. , Cambridge, 1995, p. 277.
STRAIN HARDENING EXTENSION
&
DOUGH GAS CELL WALL FAILURE IN BIAXIAL
BJ. Dobraszczyk RHM Technology Ltd.
The Lord Rank Centre Lincoln Road
High Wycombe HP12 3QR
1. INTRODUCTION There has long been a conviction amongst bakers that baking performance is in some way related to the rheological properties of the dough, probably due to the common practice amongst bakers of stretching the dough by hand. Although this is a very subjective method of measuring rheology, it tells us something about the sort of rheological measurements we should be making in order to predict baking performance. Correlations between rheological measurements on dough and baking performance have often produced inconsistent and conflicting results. One reason may be that the rheological instruments measure dough properties at different stages of development: the torque recording mixers, such as the Farinograph, provide information on the short-term transient molecular changes in dough rheology during mixing, whilst devices such as the Extensograph and Alveograph, which measure force against extension, measure dough properties at some time after mixing, and would be expected to reveal the more permanent structural changes occuring in dough as a result of mixing. Secondly, most rheological measurements are performed at rates and conditions very different from those experienced by the dough during baking. For example, rates of expansion in proving doughs have been calculated as approximately 5 x lO-4s-l, compared with measuring rates in rheological tests several orders of magnitude greaterl . Conventional rheological tests also usually operate at small strains in the order of up to 1 % , whilst strain in gas cell expansion during proof is expected to be in the region of several hundred percent. Furthermore, many rheological tests are carried out in shear, whilst most large-strain deformations in dough (Le. mixing, sheeting and baking) are extensional in nature. Therefore, any predictive tests on dough should be carried out under conditions close to those of baking expansion. The Alveograph was considered to approximate these conditions best since it can, with certain modifications, be operated at rates and strains close to those observed during baking expansion, and can be used to obtain fundamental tensile rheological properties under conditions close to those of baking expansion. Bloksma2 proposed equations from which Alveograph data could be converted directly into rheological units of stress, strain and strain rate from a precise knowledge of the bubble height, pressure and inflation rate with time.
Rheological Properties and Functionality o/Wheat Flour Doughs
317
2. MATERIALS & METHODS Doughs were mixed on a Brabender Docorder 300g bowl at 150rpm to peak: work input. Two flours were used: (1) a standard commercial Chorleywood Baking Process (CBP) white flour, and (2) a soft non-breadmaking wheat cultivar, Apollo. The resulting dough was tested according to standard Alveograph procedures3. Dough temperature was monitored by inserting a thermocouple probe into one of the dough samples. Each dough piece was placed in the Alveograph head in turn and compressed to a thickness of 2.5mm. The sample was then inflated at a given flow rate, and bubble height and pressure were monitored throughout inflation. Test baking was performed on the doughs used in these experiments, using 56g dough in a micro-bake tin. Proof height was measured after 60 minutes, and the loaves were baked for 20 minutes at 225 °C in a Simon rotary oven. Loaf volumes were measured by seed displacement. The Alveograph was modified as follows. Pressure change during inflation was measured using an electronic pressure transducer (Furness Controls Ltd.), with a maximum range of 20 in. water (5kPa) and a resolution of 0. 1 in. water. Pressure readings during inflation were recorded via the analogue input of a BBC microcomputer. Bubble height was recorded using a laser ranger (Electronic Automation Ltd.) with a sensitivity of 0.5mm, and the output fed into the RS423 digital input of the BBC microcomputer. Inflation rate was controlled using compressed air and flow regulators and measured using a flow meter. Flow rate was varied between 10 and 2000 cm3/min, corresponding to maximum strain rates of 1x1Q-3s-1 to 2x lO-ls-l, the lower limit approaching rates of baking expansion. The pressure and height data were transformed directly into stress and strain on the BBC microcomputer using the equations derived by Bloksma3 (see Appendix 1).
3. RESULTS & DISCUSSION Data obtained from the Alveograph are normally presented as pressure against time as the bubble inflates. Figure 1a shows pressure and bubble height versus time as the bubble inflates and Figure 1b shows the transformation of this data into a true stress-strain curve. (a) W 0: :;) (f) (f) W 0: (1-
////
-
---
-
-
-
(b)
,-- RUPTURE i PO I NT -"
" ....
BUBBLE i PRESSUR�
BUBBLE HE I GHT
(f) (f) W 0: t (f)
-
W I
T I ME
STRA I N
Figure l.(a) Typical pressure and height versus time trace for an inflating dough bubble; (b) true stress-strain curve derived from Figure J (a).
Wheat Structure. Biochemistry and Functionality
318
The stress-strain curve showed two interesting features. Firstly, the stress increased throughout inflation and showed no inflection at the peak: in pressure, showing that this peak: has no significance in terms of stress. Secondly, the stress-strain data exhibited considerable curvature up to failure, indicating that the modulus (stiffness) of the dough increased with inflation. This phenomenon is known as strain hardening, and is typical of materials which need to stretch to large deformations, such as polymers drawn into fibres or inflated into thin films. Strain hardening is essential to maintain stability against failure in any large stretching operation. When stretching occurs, there are bound to be some areas which are thinner than others. While the material is thick this is of little importance, but as it becomes thinner on stretching, the stress in the thinner areas increases in relation to the surrounding material . This would normally cause fracture as the higher stresses tend to favour increased thinning, leading to catastrophic failure. Strain hardening locally increases resistance to stress in these thinner regions, stabilising any regions of incipient localised thinning and allowing much greater deformations before failure. Plotting typical Alveograph stress-strain results on a log-log graph shows the data fit well to a straight line (Figure 2a) , indicating a power-law relationship in the form of: (1)
where u=stress, f = strain, n =strain hardening index and k =constant. 3 . 1 Stability of Deformation During Stretching
During large stretching of materials, the cross-sectional area changes in a non-uniform manner along the length of the sample, and eventually the material thins locally where the stress is highest. The point at which thinning occurs is called yield and is generally defined by a maximum in force on a force-extension plot. Once the material reaches this point, any further extension occurs at a lower force, making it easier for increased thinning to occur, making failure inevitable on further stretching. Hence yield defines a point of tensile instability. For bubble inflation we can calculate the tensile force from the bubble pressure and radius. Experimental data for a CBP dough are shown in Figure 2b, (a)
( bJ dF
<Jl <Jl W 0: IUJ
8-.l
"
SLOPE
=
( n)
LOG . STRA I N
0
W U 0:
0 LL
BUBBLE RUPTURE
EXTENS I ON
Figure 2(a) Power-law fit to stress-strain data; (b) Force-extension plot for the polar region of the Alveograph bubble showing point of tensile instability at dF= O.
319
Rheological Properties and Functionality of Wheat Flour Doughs
where the tensile force is plotted against the extension (LlLo) at the polar region of the Alveograph bubble. The onset of unstable thinning begins at the load maximum in tension (dF =O), or point of load instability: this point is defined in terms of stress (0") and strain (E) in the Considere criterion of instability in tension\ or:
rur =
dE
0" (at dF = O)
(2)
The stress 0" at the point of instability is equal to the slope of the true stress-strain curve at that point. For a material whose stress-strain curve follows a power law, the Considere instability criterion can be substituted into equation (1) to give a simple relationship between the strain hardening index (n) and the critical strain (fcriJ at which instability occurs:
(3) This is an important relationship: it shows that the strain at instability and subsequent failure are defined only by the strain hardening properties of the material. The higher the value of n, the greater the strain hardening and the greater the strain at which instability occurs. In terms of bubble inflation, this means that bubbles will inflate to a larger volume before failure occurs. Thus, the strain hardening properties of the dough will be critical in determining the limit of expansion. This has been verified experimentally for a large number of doughs inflated in the Alveograph under a range of conditions3 (Figure 3), where the strain hardening index (n) showed a good correlation (R2 =O.762) with the bubble failure strain, or the final volume at rupture. 3.2 Rate Dependence of Failure The Considere criterion assumes the material is insensitive to changes in strain rate. Extensive published work has shown that dough is viscoelastic, i.e. its stiffness depends on the rate at which it is tested. Changing inflation rates from 10-2000 cm3/min in the Alveograph showed that dough rheological properties are sensitive to the rate of inflation. 2.5 z
-
<{ ([ f(JJ
W ([ ::J
2
RZ
=
1.5
==
<{
U.
0 . 762
�
•
:
0 00 0 .
0.5
0
. . . .' • .. .. .. . . .. . . 0 o 4 00
0
0.5
1.5
2
STRA I N HARDEN I NG I NDEX en)
2.5
Figure 3 Bubble failure strain versus strain hardening index (n) for a number of CBP and Apollo doughs inflated under a range ofconditions oftemperature, rate and water addition.
Wheat Structure. Biochemistry and Functionality
320
� W 0: fVJ
n OJ a. "u z <>: 0: fUJ
8 f:::
-' z :l
f«
(a)
1.5 1 .4 1.3 1.2 1.1
.
.
1
0 . 9
SLOPE
O . B
0.7 0.6
10
100
= m
1000
I NFLAT I ON RATE ( e m '/ m i n)
z <>: 0: f(/J
W 0: ::;) -" « LL
2.8 2 .6
2 .4
2.2 2
1 .8
1 .6 1 .4
1 .2
(b)
� .
•
.
�
. . .. . t
.
AI'DLLO
10
1 00
I NFLAT I ON RATE
1000
(cm '/ m i n)
Figure 4(a) Log stress at unit strain vs. bubble inflation rate; (b) bubble failure strain vs. inflation rate for CBP and Apollo dough. Stress (taken at unit strain) plotted against inflation rate showed an increase of stress with inflation rate (Figure 4a) . This shows the dough stiffens with increasing rate of expansion (strain rate hardening). The form of the curve could be shown to approximate a power-law relationship in the form of: (4) where f = strain rate, m = strain rate exponent, kl = constant. Fitting a line to the log. stress versus log. inflation rate data gave a slope which is the the strain rate exponent (m). Comparison of this slope (0.286) with stress relaxation data for the same dough showed good agreement. Failure strain also increased with inflation rate (Figure 4b). For a material that exhibits both strain and strain-rate hardening, an extension of the Considere analysis can be used to predict the strain at which instability occurs. Assuming 0'= O'(fm,fD) , then:
Defining a dimensionless strain hardening coefficient q, = l/O'.dO'/df = off, and dividing by AO'df equation (5) becomes: o
= am + q,
-
1
(6)
where a = dlnE/df (the rate of change of strain rate with inflation) . In the inflation of Alveograph bubbles the strain rate E varies with increasing expansion: at low strains near the start of inflation the strain rate is higher than at the higher strains near failure. We have calculated the value of the a term for dough inflation in the Alveograph as approximately -0. 5 . Substituting this into equation (6), the instability strain becomes: fcrlt = 2o/(2 + m)
(7)
321
Rheological Properties and Functionality of Wheat Flour Doughs 2 . 5 r-------�
2
Z W n o C
•
•
CBP
� �1 5
w Z O - z
rf tii
o
••
APOLLO
B
, '"
.",
. •
/
, , ''- n
/
/
=
/
.,
/
/
� ::J ,?
/ .
- t aJ ",
til e:
� '"
2 . 5 r-------� 2
2n/ ( 2 +m)
=
F . STRA I N �'
1.5
FA I LURE STRA I N
, . 5 ,,=--�--,"=----=------=-, 2.5 0.5 1.5 2 STRA I N
FA I LURE
FA I LURE STRA I N
Figure 5(a) Bubble failure strain versus strain hardening index (n) for a number of CBP
and Apollo doughs; (b) failure strain versus critical instability strain
feri•
=
2n/(2+m).
Figure 5 shows the relationship between calculated values for the instability strain and failure strain for a number of CBP and Apollo flour doughs inflated under various conditions of rate, temperature and water addition. The good bread-making variety doughs (CBP) showed greater strain hardening and failure strain than the poor bread-making doughs (Apollo). The importance of both the strain hardening and rate parameters n and m in the stability and failure of dough bubbles is demonstrated in Figure 5. Previously it was established that instability occurred when the bubble strain became numerically equal to the strain hardening index n (equation 3) . For the majority of doughs the failure strain was less than that predicted simply from the strain hardening index (figure 5a). When the strain rate exponent m was taken into account in the instability prediction (equation 7), the predicted instability strain Ecrlt = 2n/(2 + m) approached the measured bubble failure strain (figure 5b) . Hence, the rate exponent m exerts an influence on the stability and failure properties of the doughs.
280 " u u u
W :::;; :::J ---1 0 >
LL
25 ---1
260 240 220
0
200 180
8
•
oil.
•
CBP
OOlXiH
o A PO L LO
0
140 12
0
00
0
160
0
, 5
1
1 ,5
2
2 , 5
FA I LURE STRA I N
Figure 6 Failure strain vs. baked loaf volume for a number of CBP and Apollo flour doughs (based on an inital dough volume of 50 crrf).
Wheat Structure, Biochemistry and Functionality
322
4. CONCLUSIONS The demonstration that the failure of an expanding dough gas cell wall is directly related to its strain and strain-rate hardening properties has considerable implications for baking expansion. Assuming we can extrapolate the results from the expansion of single bubbles to the large numbers of bubbles expanding and interacting during the baking process, then the gas retention performance of bread dough can be related to its extensional rheological properties. It is to be expected that doughs with good strain hardening characteristics will expand to greater volumes than doughs with poor strain hardening. This is confirmed in Figure 6, which shows that the baking volume of a number of Apollo and CBP flour doughs was related directly to their failure strain as measured in the Alveograph.
References
1 . A.H.Bloksma, Cereal Foods World, 1990, 35, 228. 2. A.H.B1oksma, Cereal Chemistry, 1957, 34, 126. 3. B.J. Dobraszczyk and C.A.Roberts, J. Cereal Sci. , 1994, 20, 265 . 4. I.M.Ward, "Mechanical properties of solid polymers" 2nd ed. , John Wiley & Sons, 1983, pp.331-336
Appendix 1: Calculation of stress and strain from Alveograph data.
In the vicinity of the pole, the bubble wall thickness (t) is given by: t
=
2 4(1 + h2/a2r
where t = instantaneous thickness, to = initial dough thickness (2.5mm), h = maximum bubble height, a = initial radius of dough disc (27.4mm). Strain can also be expressed simply in terms of bubble height as: E = 1o(1o/t) = 10[1 + (h2/a2)] The stress (cr) is derived from the measured pressure (P), the instantaneous thickness (t) and bubble radius (r): cr = Pr/2t
STRESS RELAXATION OF WHEAT FLOUR DOUGHS FOLLOWING BUBBLE INFLATION OR LUBRICATED SQUEEZING FLOW AND ITS RELATION TO WHEAT FLOUR QUALITY
1. C. Bartolucci* and B. Launay** *CTUC, I avenue des Olympiades, 9 1 305 Massy Cedex, France. **ENSIA, Departement Science de I'Aliment, I avenue des Olympiades, 9 1 305 Massy Cedex, France.
I INTRODUCTION Many aspects of bread and biscuit processing and of end-products characteristics are closely related to dough rheological behaviour. In particular, biaxial extension properties are most probably involved during dough shaping (moulding, sheeting) and also in bubble growing during proofing and oven rise. There are two rheological methods to study biaxial extension: Bubble Inflation (BI) and Lubricated Squeezing Flow (LSF). Bubble Inflation (BI) is obtained with the Chopin Alveograph. Alveographic testing is based on the evaluation of the rheological behaviour of a dough test piece as it is being blown into a bubble until its breaking. During inflation, the dough test piece is extended in two directions: along a parallel and along a meridian of the bubble1 . Like most other instruments developed to test wheat flour doughs, the Alveograph has been designed as an empirical apparatus that can be used to predict the baking properties of wheat flours. However, several attempts have been made to derive fundamental rheological properties of dough from the use of the Alveograph 1 -9. BLOKSMA4 proposed a theoretical calculation of the bubble wall thickness based on the following assumptions: the dough bubble is spherical, the dough is incompressible and each dough element is shifted normally to itself during inflation. On these grounds, he calculated the wall thickness in function of bubble volume from the pole, where it is minimum, to the basis, where it is constant, and he derived the theoretical expressions giving the values of stress, strain and strain rate (at constant air flow rate) for any location on the bubble. LAUNAY et al.9 verified experimentally the validity of this model, opening the way to a rheological interpretation of the alveograms. Extension is equal biaxial only at the pole and this is still valid even if the bubble is not rigorously sphericallO: for this reason, the rheological parameters are generally calculated at the pole. In this way, LAUNA Y and BURE7 showed that wheat flour dough in equal biaxial extension presents a stress-softening effect described by a power law, at least for strain rates at the pole between . 1 0-2 and I s· l , and a strain-hardening phenomenon. Recently, DOBRASZCZYK and ROBERTS 1 1 , in an attempt to interpret the mechanism of bubble rupture, have relied on these findings. Lubricated Squeezing Flow (LSF) is carried out with a compression testing machine. This technique was developed by CHATRAEI and MACOSK012 to study the biaxial extension behaviour of high viscosity polymers. A disc of material is squeezed, under a constant force, between two circular plates having the same diameter as the undeformed sample. Lubricated conditions are used to minimize frictions on the sample-disc interfaces during compression, thus avoiding shear flow.
3 24
Wheat Structure, Biochemistry and Functionality
BAGLEY and CHRISTIANSON1 3 applied LSF at constant cross-head speed to wheat flour doughs, using compression plates with a larger diameter than the one of the dough disc, and thus with a squeezed area increasing during compression. In this case, stress and strain rate are time-dependent and steady conditions are never achieved. Nevertheless, they have shownl4,15 that the Upper Convected Model (UCM) with two parameters, a relaxation time
(A) and a viscosity (11 ), may apply. Other authors have used the same experimental
condition s I 6 , 1 7, 1 8 : TABOUILLOT et aJ. 1 8 underlined that LSF is well adapted to stiff doughs and applied it to biscuit doughs. VAN VLIET et a1. 1 6, using LSF with different cross-head speeds, demonstrated also the stress-softening effect and the strain-hardening phenomenon previously described with BI by LAUNA Y and BURE7 and they found approximately the same values for the exponent of the power law between stress and strain rate (= 0.3) and for the slope of Ln(stress) versus strain ( 2.6-2.9 1 6 / 2.37). HUANG and
KOKINI 1 9 used biaxial extension creep, following CHATREI and MACOSKOI2, and they showed that a steady extensional flow (constant strain rate) of wheat flour doughs may be reached at constant stress.
Except in this latter case, a steady state is never achieved: strain rate and stress are both time dependent. However, relaxation following this transient flow regime is well defined since it is, by definition, done at a fixed deformation and at zero strain rate. Relaxation times measured after biaxial extension are expected to be related to the processing behaviour of dough s l 5 . LAUNAy8 studied relaxation after BI with a modified Alveograph: when the dough bubble reached a predetermined volume, inflation was stopped and the pressure decrease (proportional to the stress at the pole) was recorded. The half-relaxation time appeared to be a better index than W for predicting the baking value of flour. CULLEN-REFAI �2 0 studied the effects of mixing and of the presence of additives on stress relaxation curves after LSF, but no systematic work was carried out to examine if the relaxation parameters obtained following LSF were related to wheat flour quality.
Then, the first aim of this work was to look at the usefulness of stress relaxation parameters following BI or LSF in terms of flour quality for bread and biscuit production. Its second aim was to test, for both types of biaxial extension, a simple non-linear model describing stress relaxation 1 ,27. 2 EXPERIMENTAL
2 . 1 Materials 2 . 1 . 1 Flours. Flours studied were issued from two harvests ( 1 992, 1 993). For each harvest, wheats were chosen among seven varieties (hard, medium hard and soft), grown in three locations and with several levels of nitrogenous fertilizer. From h arvests 1 and 2, 23 and 3 1 wheat samples, respectively, were selected. They were milled on a Buhler MLU 202
and the flours were stored at _20DC until used. Protein content (Nx5.7, ISO 1 87 1 2 1 ) and damaged starch (amperometry) were determined. The flours of harvest 2 contained significantly less proteins than those of harvest 1 and, due to the milling conditions, damaged starch levels of h arvest 1 were rather high (22.6 % on average) compared to harvest 2 (see table 1 ). 2 . 1 .2 Preparation of Dough Samples. 250 g of flour (moist basis) were mixed during 7 min at 24DC in the Alveograph kneader, with 2.5% NaCI solution at constant total water content (43.2%, dough basis), and rested 20 min at 25DC (standard Alveograph testing conditions22). For each flour sample, two doughs were prepared : one for the Alveograph test, and one for the BI and LSF relaxation tests.
Rheological Properties and Functionality of Wheat Flour Doughs
90
E a
50 40
0..
30 20 10
o
Pressure measured during relaxation
0
-- Fitted relaxation curve
70 60
....
B 0:1 � '-"
Pressure measured during inflation
•
80
325
25 20 35 30 (s) Figure 1 : Typical relaxation curve after Buble Inflation and fitting of equation 4 to experimental data represented only in partfor the sake of clarity. o
5
10
15
Time
2.2 Rheological Measurements 2.2.1 Chopin Alveograph. The ICC method was used22 . The following parameters were determined: W, deformation energy ; P, maximum pressure ; G, swelling index ; P/L, configuration ratio. 2 . 2 .2 Relaxation after Bubble Inflation (B/). Just after mixing, dough was cut into 3 discs (height: 9 mm, diameter: 46 mm). After 20 min rest at 25°C, the discs were inflated with the Chopin Relaxometer at constant air-flow rate (27.78 cm3 .s· l ) unto V=I00 cm3 . The decay of pressure was then followed during 30 s (figure 1 ). For harvest 1 , 35 data points were selected on each curve ( 1 1 points from t=O to 1 . 2 s, 24 points from t=1 .2 s to 30 s). For harvest 2, a constant high frequency data sampling was used ( 1 00 points/s). The following parameters were registered: Pm, maximum pressure (identical to P) ; Po, pressure at the start of the relaxation process (V=I 00 cm3) ; Po/Pm ; tl, experimental half relaxation time (pressure=Po!2 at t=t 1 ). 2.2.3 Relaxation after Lubricated Squeezing Flow (LSF). In this case, the discs of rested dough had 32 mm diameter and were coated with liquid paraffin (viscosity: 30 mPa.s) just before the test. A texture analyser (TA.xT2, Stable Micro Systems) with a 1 00 mm diameter plate was used at constant cross-head speed (0.2 mm.s- l ) to reduce sample thickness from its initial value to 4.5 mm. After stopping the cross-head, the decay of the compression force (figure 2)was followed during 1 50 s (50 data points/s) with F=Fi at the start of relaxation.
2.3 Baking Tests 2 .3.1 French Bread. Dough was prepared with flour, water, salt, yeast, ascorbic acid (20 ppm) and, when necessary, some wheat malt addition to increase a-amylase activity. The hydration level, fixed by the baker, was around 60% (moist flour basis). Dough was mixed 1 9 min, rested 20 min at 27°C, divided into pieces of 350g, shaped manually, rested 20 min, moulded, leavened during 2 hours at 2rC, scarified and baked. Loaf volume (VOB) was determined by grainss displacement. The len�th of moulded dou�h samples (EXT), prepared in the same conditions, was also measured after mechanical mOUlding.
326
Wheat Structure, Biochemistry and Functionality
6 •
5
o
Force measured during compression Force measured during relaxation
-- Filted relaxation curve
g ..,
�
0 u..
4 3 2
o
o
10
20
30
40 50 60 Time (s)
70
80
90
Figure 2: Typical relaxation curve after Lubricated Squeezing Flow andfitting of equation
4 to experimental data represented only in partfor the sake of clarity.
2 .3.2 "European" Baking Test. It follows up the European test used to detect wheats that are unsuitable for bread making23. Flour dough was composed of flour ( 1 00, moist basis), water, yeast, salt ( 1 .6), sugar 0 .6), ascorbic acid (2. 1 S 1 0-3) and, when necessary, malt addition. Hydration was calculated on the basis of Farinograph absorption. Dough was mixed, divided, shaped mechanically, rested 2S min at 30°C, moulded, leavened during 70 min at 30°C and baked 30 min at 220°C. Loaf volume (VOE) was measured by grains displacement.
2 .3.3 Pan Bread. Dough was composed of flour ( 1 00, moist basis), water, lard (6), sugar (S), salt ( 1 .2), yeast (S), malt (O.S), ascorbic acid ( l Oppm). Hydration level was fixed by the baker. Bread dough was mixed 19 min, rested S min, divided into pieces of 2S0g, rested I S min at 3S °C, moulded, leavened 60 min at 3SoC and baked 20 min at 230°C in open pans. Loaf volume (VOM) was determined by grains displacement. 2 .3 .4 Biscuit Baking . This test was developped by CTUC (Technical Center of Cereal Users) to decide if a wheat variety could be registered as suitable for biscuit making24. A high level of flour is used, so the quality of end-products is mainly dependent on flour quality. Dough was prepared with 1 .2 kg of flour ( 100 , moist basis), sugar (30), lard (8), ammonium bicarbonate ( 1 ), NaCI (0.63), sodium bicarbonate (0.5), sodium pyrophosphate (O.S) and water, to get a constant water content (24%, dough basis). Dough was mixed 1 3 min i n a Morton mixer, rested 30 min at 27°C, rolled between three cylinders (gap: 3 mm) and then two cylinders (gap: 2 mm) and stamped with a punch (6x6 cm). After stamping, dough samples were weighted: theoretical dough thickness just before stamping was calculated using the mass found, the punch dimensions and fixed value for dough density ( 1 .29 glcm3). Baking was made at 280°C and stopped when a weight loss of 20 % was reached. The biscuits were measured with a calliper and weighted, their length (LOB), width (LAB), height (EB) and density (DEB)were determined.
2.4 Fitti ng of Relaxation Curves Wheat flour dough behaves in shear8,27 and in biaxial extension 1 ,8 as a viscoelastic liquid. In addition, its behaviour is strongly non-linear: rheological parameters are strain- and strain rate-dependent. For this reason, the use of exponential decay terms (Maxwell elements in series) to describe experimental relaxation curves is no more than a mathematical fitting process25. For describing stress relaxation in many biological materials, PELEG26 proposed an empirical model which relates force to time by an hyperbolic function. This very simple
Rheological Properties and Functionality of Wheat Flour Doughs Harvest 1 (1992): n
Proteins (% dry m.)
1 1 .8
Damaged starch (%)
22.6
/2 G (em3 )
(mm)
19.1
Pm (mm) Po (mm) Po/Pm l k (s· ) n tl �sl
116 78 0.67 1.61
W (10.4 J) P
Relaxation after LSF
Fi
115 1 .9 1
(N)
na
Biscuit
LOB (em)
4.35
Baking
LAB (em)
6.59
E B (em)
0.91
BrcaI Baking
0.61 1 .37 0. 1 8 1 .74 3.7 1.12 0. 19 1.51 4.02 6.39 0.74 0.338 48.8 854 1 100 1375
6.0 1.31
l ka (s· )
0.22 2.45
13 flours)
44
0.20 2.35
tla �sl
(harvest I :
Harvest 2 (1993): n
DEB �&em3l
0.399
EXT (em) VOE (em3)
61.6 1 133
VOM (em3) VOB (em3)
1270 1754
=
3 1 flours
Mean Minimum Maximum
13.1 24.7 370 27.0 154 5.16 163 1 12 0.75 1 .82 0.21 3.20 7.6 2.08 0.24 3.18 5.17 6.74 1 .02 0.447 76.0 1 307 1493 1956
9.5 19.9 159 1 1 .6 62 0.42 69
279
P/L Relaxation afterBI
23 flours
Mean Minimum Maximum
Variable
Standard Alveograph
=
327
10.0 16.8 161 1 8 .8 66 1.05 68 45 0.66 2.08 0.17 2 . 50 4.4 2.05 0.22 1.57 4.97 6 . 54 0.76 0.361 59.3 1243 1267 1706
6.9 1 3.3 61 1 1 .8 36
0.37 38 22 0.57 1 .57 0.16 1 .85 2.7 1 .46 0.20 0.99 4. 1 1 6.26 0.58 0.307 50.3 963 1073 1281
12.6 23.0 285 25.9 90
2.17 94 64 0.82 2.66 0. 19 4.18 6.1 3.52 0.24 2.10 5. 89 6.79 0.97 0.407 66.6 1613 1400 2162
Table 1: Summary of biochemical, rheological and baking tests results./or each JUirvest. (see textfor the meaning of abbreviations). model has been used for fermented dough20 but its meaning has been questioned27 because the rate constant cannot be related to rheological properties and because it leads to a non-zero extrapolated stress at infinite time, which would correspond to a solid viscoelastic behaviour. In addition, even if an asymptotic limit exists, its value would be undoubtedly overestimated by this model25 . An other simple equation has been proposed27 to describe shear stress relaxation in wheat flour doughs at high shear strain (about 102) following steady shear at high strain rates (11 02 s· I ) . I t is based o n a non-linear Maxwell's model where the viscous properties obey a power law (eq. 1) and the shear modulus is assumed to be constant during the course of relaxation. (eq. 1 )
0 = K . yn
where 0 i s the stress (Pa), i' the total shear'strain rate (s·I), and n the flow behaviour index. From this equation,
K the consistency index (Pa.sn)
11 may be also calculated as a function of 0: 1 1 1 -11 = -:-o = Kn . o n Y -
(eq. 2)
where 11 is the viscosity (Pa.s). The equation of relaxation for a Maxwell model is:
.
.
.
a
0
Y = Ycl + Yv = G + ,, = 0
where
i'., is the elastic strain rate, i'.
the viscous strain rate,
(eq.
G the shear modulus.
3)
Wheat Structure. Biochemistry and Functionality
328
Then, by replacing 11 by its value as a function of 0 (eq. 2), the following equation is obtained: 0 = 00
-( {�-1)- )
.
t ;::)
1+k
with 0=00 at t=O
(eq. 4)
This equation contains only 2 parameters, n, the flow behaviour index and k (s-I), the rate of relaxation, given by: k=K
-.!.
.
1
G · 0 /;,-1)
(eq.5) It has been shown that this equation may also be used to fit stress relaxation following biaxial extension by B l l .28 and by LSFI 7. In this work, we have used eq. 4 to fit (software TableCurve 2D, Jandel) stress relaxation curves obtained with both types of methods on the same dough samples. The following parameters were determined: n, k and tl (experimental half-relaxation time) for BI, na, ka and t la (calculated half-relaxation time) for LSF. '
3 RESULTS
3 . 1 Fitti ng of Relaxation Curves
At all events, stress relaxation curves were very well fitted with equation 4 for BI as well as for LSF. Correlation coefficients were always higher than 0.99. Relaxation after B I
Po/Pm
n
k
Biscuit Baking
LOB 1 -0.32 2 -0.50
(I) -0.04 -0.03 -0.41 0 . 5 0
-0.07 -0. 12
LAB 1 0.04 0.36 0.28 -0.2 7 2 0 5 3 0 . 4 6 - 0 . 6 6 1 0. 1 8
1
.
EB
1 2
0.48
DEB
1 2
0.18 0.15
0.09
0.33 0. 1 2 -0. 14 0.35 1 - 0 . 6 6 1 0.2 1
-0.38 0.25
EXT
-0.33
-0.4 7
-0.19 0.13
0 . 44
VOM I
0.04 0.38
0.25 0.28
ka
1
0.78
A l veograph
W
tla -0.26
0.80 -0.84
-0.53
-0.22
0.68 -0.86
0.74
-0.25 0 . 6 7 - 0 . 7 3 0.34 1 0 . 7 0 - 0 . 7 3
0.58
0.54
1
0.70
0.10 0.39 -0. 1 6 - 0 . 4 6
1 2 2
0.26
0 . 73 - 0 .47
0.84 -0.85
-0.01 -0.48 0.36 1 - 0 . 7 7 1 0.10
na
-0.5 7 -0. 1 1
2 0.55
VOE
-
Fi
0.34 -0.09
-0. 1 7 0.01
0.83 -0.59 VOB
Relaxation after LSF
tl
-0. 1 2 -0. 1 3
0.50
0.27 0.04 0.24 - 0 . 4 8
-0. 1 5 0.2 1
-0.40 -0.09
0.26
1 1
-0.55
G
P/L
0.29
0.25
-0.55 ( 1 3 ) 0. 1 7 (31 )
-0.84 -0.69 -0.49
0.43 - 0 . 6 7 0.80
0 .49
0.65
-0.48 0.31
0.73
-0.43 0 . 7 7 0.03 0 . 7 6 -0.42 � 0 . 4 5
1
0.15
0.04 0.39
0.30
1
0 . 8 2 (13)
0.64
-0. 3 7 (3 1 )
0.38
0 . 7 4 (13)
0.22 -0.09
-0.63 ( 1 3 ) 0.39 (31)
0.02 -0. 1 6
0 . 5 4 (3 1 )
[ill - 0 . 4 9 ( 3 1 )
1:L!Q]
-0.49 - 0 . 7 3 -0.29 -0.75 -0.7 1
0.66 -0.62
-0.25 0. 1 7 -0. 1 3 0.03 1 0 . 6 4 - 0 . 6 1 1
0. 1 1 -0.21
0.02
1
(n)
P
0.02 (23)
0 . 58
0 . 5 0 - 0 . 5 9 (23)
0.59
0.71
- 0 . 5 9 (3 1 )
0 .2 7 (23) -0.02 (3 1)
0.Q2 - 0 . 5 6 0.3 1 -0.31
0.35 0. 1 8
0.09 0.28
-0.25 0.16
-0.24
-0.32 0.34
0.32 - 0 . 6 2 -0.01
0.79
- 0 . 7 4 (23)
0. 44
0 .49
- 0 . 4 7 (3 \ )
0.67
0.48 -0.47
Table 2 : Linear Correlation Coefficients between Rheological Parameters and Technological Results. 1 ,2 : harvest number ; in bold: significant at the 1% level; encircled: significant at the 1 %0 level. (1): only 13 wheat samples of harvest 1 were usedfor biscuit baking.
Rheological Properties llIlli Functionality of Wheat Flour Doughs
E
0.34 0.32
.'
0.28
, '. " ..
.!:!.. '" 0.30
� u
� ] al
..c 00 ::s 0
0
'lib
eO .
"o \0tlc'h>:
0.26 0.24 0.22
0
°
C
-- --y
z 0.2 + 0.36 · 01.14 Harvest 1 (n=13) Harvest 2 (0=31)
• o
...
'il
.. ...
1
1 .5
2
0'0
�
Two rollers gap
0.20 0. 1 8
1-
.
�
- �
"I
329
. r = +
r = 0 0.83
o
8. • • . ' . 0' 00
t% �
2.5
.. "CP' .. - ... +I... .. .Jl
ka (s·l)
3
�
3.5
0
0
Two rollers gap 4 50
100
150
. . .' . ' . ..;0
0.74
III B. lI"'"
.
0
o
.... " .... (5:J
0�
0
,. .. 0 0
000
0
0
0
••
0
200
W
250
0.32 0.30 0.28 0.26 0.24
1 - - - - o y - 0.2 + 2.78 1O.. W • Harv... 1 (0-13) Harv... 2 (0-3 1)
I
0.34
300
0.22 0.20 0.18 350
Figure 3: Dough Band Thickness (in biscuit process, just after rolling) versus relaxation rate constant after LSF and versus W. Regressions have been calculated with the results of harvest 1 and 2 . 3 . 2 Correlation w i t h biscuit tests 3.2.1 Biscuit dimensions. The best correlations were obtained with relaxation following LSF, but not BI, and with W from the Alveograph (see table 2). For packaging, constancy of biscuit dimensions is very important. We observed that the lengths and the widths of biscuits were negatively correlated (r=-0.85 and -0.90 for harvest I and 2, respectively). It is an indication that these dimensions are probably mainly dependent on dough viscoelastic properties: following stamping, the sample length will decrease along the rolling direction and its width will increase, as a consequence of strain recovery. 3.2.2 Thickness of the dough after rolling. This parameter seems to be closely related to the relaxation rate constant following LSF and the same exponential relationship appears to hold for the two groups of flours, which are very different (figure 3). For doughs having marked elastic properties (long relaxation times) the effect of ka is strong, but, at high values of ka, dough thickness tends towards a limit. We can explain this result in terms of elastic recovery: dough, compressed during roiling, stores temporarily mechanical energy, inducing partial strain recovery. However, a high value of ka corresponds to a fast relaxation process and, therefore, to a low level of stored energy and then to a vanishing strain recovery phenomenon. Accordingly, the rollers'gap (0.2 cm) may be used for the asymptotic value of dough thickness as shown on figure 3. The same type of result is observed for biscuit thickness (see table 2) but, in addition, this parameter depends on oven rise. However, a highly significant linear correlation (r=+0.74, n=44) is observed between biscuit and dough band thicknesses: this confirms that dough viscoelasticity plays here a major role in biscuit dimensions. A linear correlation was also observed between W and dough thickness, mainly for harvest 2 (see figure 3). It is interesting to note that the extrapolated dough thickness corresponding to W=O is just found equal to the rollers'gap. 3.2.3 Density is an important quality parameter for biscuits, in particular for predicting crispness. It was found positively related to LSF indices (initial compression force Fi and t I a), but also to P from the Alveograph test (see table 2).
3.3 Correlations with bread baking tests 3.3.1 Volumes. In general, bread volumes are not well correlated with rheological parameters (see table 2). For the European test (YOE) there was only a low correlation with LSF (ka and Fi) but it was not observed with both sets of samples. French bread loaf volume (YOB) is correlated with the relaxation rate following BI (k) and with the AlvtDgr.pl parameters (G, and, less, W and P/L). Pan bread loaf volume (YOM) is significantly related.
Wheat Structure, Biochemistry and Functionality
330
80 ,-__,--,__-,__-,__-,__-,__-,__,-__-,__-,____,-__,-__,-__-,__-, 80
�
E
� c
:E Ol
�
75
70 65
� 60 " -5 00
j
•
55
1 .2
---0
0 8
0
-
Harvest 1 (0=23) Harvesl 2 (n=31)
o 0 / 00 � 0 0 0
�oor/' 0� o
50
45
�
..
r = +
0.83
o"",,0
0
o
•
0 .5' ClJ ....... 0 0 o """"o
o
1 .4
1.6
1 .8
k
2 2.2 (5.1 )
2.4
r
2.6
100
o
D
•
75
0.73
70 65
60
0
,,!
0 0
r = .
1 50
=
0.7S
200
55
""-
e c .......
50
0
W
250
300
350
Figure 4: Length of bread dough after moulding (in French bread baking) versus relaxation rate constantfollowing BI (k) and versus W.
to the flow behaviour index na deduced from stress relaxation following LSF. However, a higher correlation coefficient is obtained with G. The better correlation observed in this case may be tentatively attributed to more tightly defined baking conditions, due to sugar addition (fem1entation) and to the presence of tin walls (dough leavening and oven rise). 3 .3 .2 Length of Bread Dough After Stretching (EXT) . A high positive linear correlation is observed between the rate constant of stress relaxation following BI (k) and the length of bread dough samples issuing from the long-roller (see figure 4). However, in contrast to the results shown on figure 3, there is not a unique relationship for both sets of flours. An increase in k corresponds to a faster relaxation phenomenon: as the elastic energy stored into the dough is dissipated more rapidly, the recovery is smaller and, therefore, the final length is larger. In bubble inflation, PoIPmand the half-relaxation times t l give also rather high correlation coefficients. These results show the prevalence of the viscoelastic properties on the extensibility of bread dough during mOUlding. However, while relaxation following BI is well related to bread dough length, this is not the case with LSF: even though these two measurements imply a biaxial deformation, they don't provide the same information. A significant negative correlation coefficient is also observed with W: however, it is lower than with k (figure 4). The length of bread dough after stretching may be used as an unambiguous evaluation of dough extensibility during the process: it is interesting to note that there is no relation with G (IrI<0.2, table 2), the Alveograph parameter generally associated with extensibility.
3 CONCLUSION
In addition to empirical methods regularly used for evaluating the rheological properties of wheat flour doughs, their viscoelastic behaviour in biaxial stretching provides promising results. The length of moulded dough samples seems to be related to the parameters issued from the Bubble Inflation test, in particular the stress relaxation rate constant. For predicting biscuit quality indices, Lubricated Squeezing Flow appears to be more appropriate than Bubble Inflation: however, in this case too, sample dimensions are related to stress relaxation parameters. It is interesting to point out that, for both types of products, it is possible to connect dimensions to stress relaxation phenomenon taking place during dough processing through relations between cause and effect. Finally, it must be realized that all the rheological measurements have been done with doughs having the same water content as it was also the case for biscuit making, but contrary to the bread baking tests. This could explain why figure 3 displays an unique relationship for both sets of flours and not figure 4: in the latter case, water contents used in bread baking tests with harvest 1 have been increased, compared to harvest 2, to take into account the higher level of damaged starch. If
Rheological Properties and Functionality of Wheat Flour Doughs
331
If it is aimed at devising improved rheological methods for routine testing, this point should deserve further attention in view of the pronounced plasticizing effects of water on proteins which may vary from one flour to an other and depend, among others, on protein content and damaged starch level. ACKNOLEDGEMENTS This work was realized in part with the financial help of DGAL (Ministere de I'Agriculture, de la Peche et de I'Alimentation, grant nO R93/04). We thank all the partners who contributed to obtain the technological results. French Bread Baking tests were done by Centre de Recherche sur les Pulverulents de Creteil (Grands Moulins de Paris) and by Gist Brocades. Pan Bread Baking tests by Grands Moulins de Pantin (Soufflet). "European" baking tests, protein content and damaged starch determinations by Institut Technique des Cereales et des Fourrages. We thank Dr J-F Tharrault (CTUC) for providing the results on biscuit tests and for helpful discussion. REFERENCES 1. 2. 3. 4. 5. 6. 7. 8. 9. 1 0. 1 1. 1 2. 1 3. 1 4. 1 5. 16. 1 7. 1 8. 1 9. 20. 21. 22. 23. 24. 25. 26. 27. 28.
B . Launay, 'Alveograph Handbook' , AACC, St-Paul, Minnesota, 1 987, chapter 2, 10. G.W. Scott Blair and P . Potel, Cereal Chern., 1 937, 14, 257. I . Hlynka and F.W. Barth, Cereal Chern., 1 955, 32, 463. AH. Bloksma, Cereal Chern., 1 957, 34, 1 26. AH. Bloksma, Cereal Chern., 1 958, 35, 323. B . Launay and 1 . Bure, Lebensrn.Wiss.Technol., 1 970, 3, 57. B. Launay and 1. Bure, Cereal Chern., 1 977, 54, 1 1 52. B. Launay, Ind. Alirn. Agric., 1 979, 96, 6 1 7 . B. Launay, 1.Bure and J. Praden, Cereal Chern., 1 977, 54, 1 042. R.L.G. Treloar, cited by C.D. Denson and R.J. Gallo, Polyrn. Eng. Sci., 1 97 1 , 11, 1 74. B.J. Dobraszczyk and A Roberts, 1. Cereal Sci., 1 994, 20, 265. S .H. Chatraei and C.W. Macosko, 1. Rheol., 1 98 1 , 25, 433. E.B. Bagley and D.O. Christianson,'Fundamentals of Dough Rheology' , AACC, St Paul, Minnesota, 1 986, 27. E.B. Bagley and D.O. Christianson, 'Food Structure-Its Creation and Evaluation' , Butterworths, London, 1 988, 40 1 . E.B. Bagley, D.O. Christianson and D.L. Trebacz, 1. Text. Stud., 1 990, 21, 339. T. Van Vliet, A.M. Janssen, AH. Bloksma and P. Walstra, 1. Text. Stud., 1 992, 23, 439. S. Berland, Doctorate Dissertation, ENSIA, 1 993. P. Tabouillot, Z. Maache-Rezzoug, C. Foulon and J.M. Bouvier, 'Traitement Industriel des Fluides Alimentaires Non-Newtoniens' , CNRS-INRA, Le Croisic, 1 993, 6, 25. H. Huang and J.L. Kokini, 1. Rheol., 1 993 , 37, 879. A Cullen-Refai, 1.M. Faubion and R.C. Hoseney, Cereal Chern., 1 988, 65, 40 1 . ISO-Standard W 1 87 1 . ICC-Standard N° 1 2 1 . European rule N°2062/8 1 , Eur. Corn. Official 1., 1 98 1 . J.F.T. Tharrault, Ind.Cereales, 1 994, 36. B. Launay and P. Cantoni, ' Physical Properties of Foods', A VI Publishing Company, Connecticut, 1 987, 455. M. Peleg, 1. Rheol., 1 980, 24, 45 1 . B. Launay, Cereal Chern., 1 990, 67, 25. B . Launay, O. Delbeke-Hennequin, P. Cantoni, 'Wheat End-Use Properties' , ICC symposium, Helsinki, 1 989, 279.
GLUTEN MICROSTRUCfURE AND CHANGES IN HARD BISCUIT DOUGHS AS DETERMINED BY LIGHT MICROSCOPY AND RHEOLOGY
A. Jurgens, T. V. P. Maarschalkerweerd, J. F. C. van Maanen and W. J. Rottier TNO Nutrition and Food Research Institute Department of Cereal, Flour and Bakery Technology PO Box 360 3700 AJ Zeist, The Netherlands
1 INTRODUCTION A number of problems in biscuit manufacturing are related to the dough properties prior to baking. In many cases the production processes are developed on an empirical basis. Recent demands for automation and for constant product quality ask for a better understanding of the mechanisms involved. Among the questions to solve are the relation between flour quality and product properties, optimal mixing conditions, rest time and the influence of rest time variations and optimal sheeting conditions. As for many bakery products the properties of hard biscuit doughs depend largely on the gluten structure. This structure, however, is strongly dependent on the mechanical and thermal history. To the authors' opinion these facts are well recognized but much of the published work fails in the sense that the rheological tests presented do not meet the practical conditions which are necessary to provide the essential information. The present work deals with the relationship between processing conditions and dough properties focused on the gluten structure and changes thereof with respect to rest time after mixing and the sheeting process. Extensive overviews of the principles of biscuit manufacturing are given by Wadel and Faridi2• More practical oriented guide is given in the book by Manlel . Details of the process may be found in these references, attention however, should be paid to variations both in the recipes and the process conditions. One of the well known concerns in biscuit manufacturing is dough contraction.
Rheological Properties and Functionality of Wheat Flour Doughs
333
nlttial ....... . ...... After mixing dough it is common to give the dough a rest time in the order of about 30 minutes after which sheeting takes place. During a biscuit process of the Marie type (see figure 1) contractions in the direction of sheeting of about 10 to 12 % are not uncommon. Solutions to this Fi&ure 1 Sche1lUltic presentation ofthe biscuit problem are, amongst others, sought in process line used in this study. The numbers overmixing of the dough, or the indicate the positions where samples were application of either sulphitet·5 , which tlJken for microscopy are mostly no longer allowed, cysteine' or enzymes6•7• In this work however, our main concern is the large variation in dimensions of biscuits prepared from one single batch, which is of the order of 10%. These variations are, in contrast to the contraction, observed both in the direction of-, as well as at right angles to the sheeting direction. As mentioned above the conditions at which the doughs are examined should be related to the practical situations. Only a few older publications in relation to the biscuit dough processing exist by Wade et al1-12• Others have reported related workl3•14 though their compositions contained higher fat levels which gives doughs with different properties. None of these works, however, concerns the relation between rheology and microstructure of the Marie type biscuits which have a relatively low fat content. The rheological behaviour of a complex structure such as a dough is dependent on the microstructure at different levels. The strength of a gluten gel is controlled by the interactions of the gluten molecules at the molecular level. On the other hand the structure at micron size level such as the homogeneity of the gluten distribution determines the overall network strength. Microscopy may provide information on the gluten structure at this level. Flint and MossU.16 have examined the gluten microstructure of biscuit doughs, with different reducing and oxidizing agents, in relation to mixing and· sheeting by light microscopy. They found that the dough consisted of gluten masses which formed strands due to sheeting. They qualified the protein as being undeveloped in association with starch granules or as unchanged endosperm particles. They found that the gluten structures in the final sulphited and unsulphited doughs were very similar. In contrast to our standard process their doughs were repeatedly folded and sheeted. Moreover the rest times of the doughs were rather short (20 minutes) in comparison to our situation.
'l� �I� I i==,p ���L
2 EXPERIMENTAL
2.1 Materials and methods Marie type biscuits doughs, with and without sodium pyrosulphite (N&z�05)' were prepared according to a standard recipe (table I). For each experiment a fresh dough was prepared on lab scale by use of a Morton type mixer and based on 1 kg flour. All materials and equipment were conditioned for at least 24 hours at the experimental temperatures selected (22, 26 and 28 ± 1 °C) and a relative humidity of 60 % . Part of the flour (200 g) was mixed together with the crumbs, shortening, sugar, NaCI and 80 ml water for 10 minutes to form a premix creme. Subsequently the other ingredients were added to the dough. Mixing continued until a final temperature of 44 °C was reached, while the energy input was recorded as a control.
Wheat Structure, Biochemistry and Functionality
334
Table 1 Composition of the Marie type biscuit doughs Composition
Unsulphited
Sulphited
% (w/w)
% (w/w)
55.4
55.4
Biscuit crumb
4.2
4.2
Shortening (Biskien zacht)
9.4
9.4
16.6
16.6
2.2
2.2
0.55
0.55
Soft Flour
Sugar Glucose Syrup (80%) NaCI
0.04
Na:zS2Os (NH3hC03
0.55
0.55
water
11.1
11.1
2.2 Light Microscopy Samples for examination by light microscopy were taken at different points ( 1 ,2,3 and 4 in fig. 1), after mixing and during the sheeting process. Furthermore we took samples after 0, 1 and 4 hours rest time between mixing and sheeting. These samples were taken from the sulphited as well as unsulphited doughs during a process at 22 °C. Attention was given to the orientation of the samples such that images of different orientations could be examined both parallel and at right angles to the sheeting process. After sampling the dough pieces were immediately quenched in liquid nitrogen to preserve the structure of the dough. Sections of about 10 "m thickness were obtained with a cryostat microtome at -30°C (unsulphited case) or 34 °C (sulphited case). The gluten in the thin sections of the unsulphited samples were stained by a saturated solution of Fast Green. The gluten from the sulphited doughs, which were very sensitive to water, were stained with Eosin Y. The selection of Eosin Y is a compromise because it gives images with less contrast compared to Fast green. For both staining agents the specific selectivity to gluten in a dough system was checked. -
2.3 Rheological testing Because of the strong dependency on the mechanical history the doughs were given a constant well timed treatment before carrying out rheological tests. After mixing a piece of dough is folded in plastic foil and kept for 45 min at the measuring temperature of either 22, 26 or 28 (± I)OC. After this period a mechanical treatment was given in which the deformation and deformation rate were comparable to those during practical sheeting conditions. A cylindrical piece of dough of 30 mm diameter and 20 mm height was cut out using a bore. Next the sample was compressed in an Instron 1 122 Universal Testing Machine until 3.5 mm height and a cross head speed of 20 mm/min. Subsequently a
Rheological Properties and Functionality of Wheat Flour Doughs
335
cylindrical piece of 20 mm diameter was bored from the sample and placed in a Carri Med CSL 500 controlled stress rheometer. The samples were measured with a plate-plate configuration with cross hatched surfaces and a gap of 3 mm. The upward movement of the bottom plate was controlled by hand and kept at very low speed. In order to prevent drying out at the edges, the measuring configuration of the rheometer with sample was covered with a perspex cap with only a very narrow space for free movement of the shaft carrying the upper plate. The humidity of the small sample space created in this way was controlled by a saturated solution of KBr which has a water activity of 0.8 at 20DC. Biscuit dough has a water activity of 0.76 at this temperature. Under these conditions it is possible to carry out measurements over time periods of more than 24 hours. This method proved to be far better than covering the edges with paraffin oil because the oil tended to creep in between the dough and the plates. Dynamic oscillatory tests at a frequency of 6.3 radlsec were carried out in order to study the low deformation properties as a function of rest time. Some stress sweep tests with stresses ranging from 100 to 1000 Pa were carried out to study the behaviour of the storage- (G') and loss (G") moduli and tan(6) as a function of strain. These tests were carried out after 45 minutes rest time after the compression in the Instron. The selection of the duration of this dough rest will become clear from the results to be presented in the next section. All other dynamic tests were carried out at a constant preset deformation of 6x lO"" as a function of time after compression at temperatures of 22, 26 and 28DC. 3 RESULTS AND DISCUSSION
3.1 Light Microscopy Figure 2 presents the gluten structure of the unsulphited dough direct after mixing. Protein masses are observed in the order of 30 to 60 I'm in size. Furthermore some orientation is present due to the deformation during mixing. On close examination a vague blue colour, indicating protein, was seen varying in density throughout the sample. This may not be clear from figure 2 but could be clearly observed under the microscope and on the original copies. It is concluded that the protein structure observed is a continuous one. After one hour dough rest the shape of the protein masses has become more or less spherical as can be Figure 1 Section of the unsulphited dough observed in Figure 3. This indicates that sampled direct after mixing, before sheeting, the energy stored in the deformation of stained with Fast Green the protein masses causes an elastic recoil. The results on the sulphited doughs (not shown) exhibit much the same overall features. The amount of protein, however, which is smeared out and forms the continuous network apart from the globular masses is clearly larger as compared to the unsulphited doughs.
Wheat Structure. Biochemistry and Functionality
336
Figure 4 shows the deformation in the protein due to the sheeting process directly after mixing from a sample taken at position 2 on the line, as indicated in figure 1 . This section shows the protein structure seen at right angles to the sheeting direction. The structure observed in the sheeting direction is more or less spherical, i.e. the protein forms long threads during this process. After a rest period between mixing and sheeting of more than one hour it was observed that the long strands only Fagure 3 Section of the unsulphited dough appeared at position 1 directly after the sampled after 1 hour rest after mixing, before Queen press but not at position 2, i.e. sheeting, stained with Fast Green after 2 minutes. This means that the deformation relaxation time after rest has changed considerably within the first hour. In general our observations are in accordance with those of FlintlS and MOSS16 who studied the effect of processing on the structure of Marie type biscuit doughs. In contrast to our findings they found some orientation in the protein at right angles to the sheeting direction. It must be noted, however, that in their case the dough was turned and folded a few times before samples were taken. Furthermore Moss reports no structural differences at different relaxation times prior to sheeting. In his Fagure Section of the unsulphited dough, case the relaxation time was 20 minutes sheeted directly after mixing. This section was at maximum which is shorter than in our taken at position 2 on the processing line (see case Moreover their temperatures figure 1) in a direction at right angles to the varied between 24 and 27°C. As will direction of sheeting also follow from our observations of the rheological behaviour, discussed in the next section, both temperature and time are critical with respect to dough behaviour.
4
.
3.2 Rbeology As generally found for doughs the response in an oscillatory stress sweep mode showed no linearity in the measurable range. Figure 5 shows an example of an unsulphited dough at 22°C and 45 minutes rest time in the rheometer before measurement. Characteristic for these types of doughs was the increase in decrement of both the storage- and loss moduli above a typical deformation amplitude of about 3xlo-3 • Based on these findings a minimum practical amplitude of 6x I Q4 was selected for all other dynamic experiments in order to avoid a possible structural breakdown. Figure 6
Rheological Properties and Functionality of Wheat Flour Doughs
337
presents the typical behaviour of the 1 000000 ,-------, 0.110 storage and loss . moduli as a function of 0 time for an unsulphited dough at 22°C. This graph also gives the curves for a dough which was kept outside the 0.50 .rheometer for one hour in order to check e the effect of the load stress when the plate (, 1 00000 c: ., .. geometries compress the sample. The result G' shows that this mechanical treatment did 0.40 not cause a breakdown of the structure. G" The general characteristics can be thought to be divided in three stages. During the first stage relatively low and weakly 1 0000 '-------' 0.30 0.0001 0.001 0.01 0.1 increasing moduli are observed. At 22°C this stage takes 9 to 12 minutes, deformation C-) independent of the dough being sulphited or 5 Storageloss moduli Figure unsulphited. Next a strong increase in tan(O) o f an UlISul phited dough at 22°C moduli is observed. After about 30 minutes (at 22°C) the modulus levels off but does after 45 min rest in the rheometerfollowing not reach a plateau within 24 hours (results the standard procedure given in the text not shown). It was observed that only the absolute levels of the moduli depended on � r------' Ito," 1 hour the dough being sulphited, the Oll1&l
and
�
••••
and
\ . .. . . . . . ... . . . . ..
• •• • •
- �
_.----
and
I I
Wheat Structure, Biochemistry and Functionality
338
Figure 7 shows the effect of temperature on the time dependency of the storage modulus and loss angle characteristics for the unsulphited doughs. The effect of temperature on the duration of the first stage of the recovery process is very large. At 22 °C it took about 10 minutes before the network recovery initiated, whereas it took about 30 and 150 minutes at respectively 26 and 28°C. Figure 8 presents the effect of pyrosulphite on the storage moduli. Note that the effect of pyrosulphite at a given temperature is only present in the absolute value of the moduli but not in the characteristic timescale at which changes take place. From this we expect that the mechanism of network restoring is not affected by the -SS- bonds, but probably by restoration of hydrogen bonding between the gluten molecules. The shift of the initiation of network build up to longer times at higher temperatures is not understood. It may be that the internal relaxation related to the recoil of the gluten masses is slower at higher temperatures.
soo
0.80
I 28·C
400 ....... .
III �
a.. .. !i: -0 C!) � t-
0.70
300
.
L_ _
.' \\
•
200 22"C
1 00
�.
. .. . . . . . . . . . . .. . . . 28·C 28·C ------
0 0.1
I
i '!
I
/
0.80
1\... ... . I .. ..•;/ .
10
c
!!
O.SO
./
\
e
0.40
--
0.30 1 000
1 00
time (min)
Fagure 7 The storage modulus and loss angle
of unsulphited doughs at different temperatures as a function of lime after a compression treatment 800
r------,
/�
500
.;:":" /' a 220C
400 300
4 CONCLUSIONS
200
(-)
: � . ; : .'
' .. . .
28°C
( +)
! i 28°C
/
: I
Our results show a strong temperature (+) dependency of the structural and 100 r : - . . : .: :;::�> / (,,,// . . . .. mechanical properties of hard biscuit .. :·,,·� . o doughs. This dependency manifests itself 1000 100 10 mechanically through the shift in the initiation of network build up, i.e. the time (min) time at which increase in the storage modulus starts to increase, and through a Fagure 8 Slorage moduli oflhe sulphiled (+) lhe unsulphited (-) doughs 01 22, 26 large variation in the moduli with temperature. The timescales of the 28 ° C as a funclion of lime qfter a processes appeared to be independent on compression treatment the addition of pyrosuphite. From the present investigation it is not clear what the practical implication would be for temperature control in relation to acceptable variations in quality parameters. This could be the subject of further research. In combination with baking results (not presented) it can be advised that the processing is carried out at relative low temperatures.
i
I
and
· · ··
··
"·- , ,
and
339
Rheological Properties and Functionality o/ Wheat Flour Doughs
Acknowledgement To the Commodity Board for Grains, Seeds and Pulses, the Hague for partial funding of the work presented, and to U.A. de Vries and M. van de Vliert (rNO) for valuable discussions and advices.
References 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16.
P . Wade, 'Biscuits Cookies and Crackers, Elsevier Applied Science, New York, 1988, Volumes 1 ,2 and 3. H. Faridi (ed.), 'The Science of Cookie and Cracker Production' , Chapman & Hall, New York, 1994. D. Manley, 'Technology of Biscuits, Crackers and Cookies, Ellis Horwood, New York, 199 1 . P. Wade, J. Sci. Fd Agric. , 1972, 23, 333. B. H. Thewlis, P. Wade, J. Sci. Food Agric. , 1974, 25, 99. C. E. Staufer, 'Redox System in Cookie and Cracker Dough', Chapman & Hall, New York, 1994, Chapter 6, p.227. C. S. Gaines, P. L. Finney, Cereal Chem. , 1989, 66, 73. P. Wade, Biscuit maker Plant Baker. , 1965, 45, 1 85. Plant Baker. , 1966, 46, R .G. Parish, P. Wade, D. A. Watson, Biscuit maker 201 . Plant Baker. , 1976, 47, 171 . P. Wade, D . A. Watkin, Biscuit maker Plant P. Wade, S. J. Cornford, D. A. Warkin, E. J. Coode, Biscuit maker Baker. , 1968, 48, 156. P. Wade, E. J. Coodes" R. M. Gassick, Biscuit maker Plant Baker. , 1969, 49, 34. M. C. Olewnik, K. Kulp, Cereal Chem. , 1984, 61 , 532. S. C. Shekara, P. H. Rao, S. R. Shurpalekar, J. Food Sci. Techn. , 1986, 23, 208. O. Flint, R. Moss, P. Wade, Food Trade Rev. , 1970, 40, 32. R. Moss, Cereal Sci. Today. , 1974, 19, 557.
and
and
and
and
and
Non-Starch Polysaccharides and Enzymic Improvement of Bread Quality
THE EFFECTS OF XYLANASES IN BAKING AND CHARACTERIZATION OF THEIR MODES OF ACTION
T Sejersgard Jakobsen and J Qi Si Novo Nordisk A/S Enzyme Applications & Development Laurentsvej S3 2800 Bagsvrerd DK
I ABSTRACT
Xylanases have been used for some time in the baking industry. However limited information is available on the differences between the xylanases and their modes of action. Two methods determining the enzymatic activity in doughs towards water soluble (WSP) and water-insoluble (WIP) pentosans have been developed. Change of the water content in doughs affected the xylanolytic activity differently. Xylanases used for baking showed a lower or unchanged activity at the highest water level. The molecular weight distribution of purified wheat WSP or WIP after treatment with xylanases indicates that no simple correlation between molecular weight of the degradation fragments and baking performance can be given. Rheological studies on gluten and the content of gluten pentosans after addition of various xylanases to doughs have been determined. Xyl anases change the rheological properties of gluten. Three of four tested xylanases removed some of the gl uten pentosans while one increased the content. This may be due to a complex mechanism involving adherence and reorganization of the smaller degradation fragments. The content of ferulic acid was determined in doughs and in gluten showing that the xylanases significantly decreased the content of monomeric ferulic acid.
2 INTRODUCTION It is well known that pentosanases J -3 or xylanases affect the quality of bread. However, the knowledge concerning the mechanism of the xylanases in doughs and the differences between the xylanases are limited. Until now the work has been focusing on the effects of xylanases in in vitro studies using purified water insoluble pentosans (WIP) and/or soluble pentosans (Wspt Pentosans are a minor component of wheat flour (2-3%) but they play an impor tant role in dough rheology and bread qualitys. Many efforts have been made to
understand the differences in bread making of soluble and insoluble pentosans by
e.g. incorporation of one or both components6-1 in the bread formula, but recent studies indicate that the differences between WIP and WSP are still not known8 • The present study was undertaken to illustrate the differences between xylanases
Wheat Structure, Biochemistry and Functionality
344
with respect to baking performance. In order to understand the differences, the effects on gluten rheologi and on the content of gluten pentosans were studied. Furthermore the content of ferulic acid and the molecular weight distribution of solu bilized WIP and degraded WSP were investigated.
3 MATERIALS AND METHODS Flour. For the testbaking the following flours were used: Manitoba, Reform, Prima and Intermill. All are European type baking flours. For the analysis the Reform flour was used. Enzymes. Enzyme B, a bacterial xylanase. Enzyme D, Enzyme A and Enzyme C, all fungal xylanases. All enzymes are produced by Novo Nordisk A/S and dosed at FXU's which is determined according to method AF-293 . 6 / 1 (available from Novo Nordisk A/S). Baking procedure. The formulation is 1 00 % (w/w) flour, water required for mixing to optimum (58-62 %), 4 % pressed yeast, 1 . 5 % salt and 1 . 5 % sugar. A typical European straight dough procedure is used. Both rolls and breads are made. Specific volume index. The mean value of 20 rolls and 4 breads is measured using the traditional rape seed method. The specific volume index is calculated relatively to the control (defined as index 1 00). Experi mental dough making procedure. A wheat flour dough of 1 0 g flour and 5,8 ml water was made. The dough was packed in polyethylene bags, sealed by a zipper an<' incubated at 3 2°C for 90 min. If necessary the gluten was isolated using a Glu tomatic 2200. The dough and gluten were then lyophilized and ground to a fine powder. Rheological study. The rheological analysis was performed on wet gluten and the rheological properties of the gluten and dough were characterized by oscillatory measurments ( I Hz with amplitude fro m 0. 1 % to 1 00 %). The results are mean values of minimum triple tests on a PP3 0 Bohlin VOR Rheometer. Enzyme treatment of WIP and WSP. Enzyme is added to a I % (w/w) WIPIWSP in 0, 1 M acetate buffer of pH 6,5 and incubated for selected periods at 3 0°C. Enzyme which is added at the same FXU (activity towards WSP) and IPU (activity towards WIP) (based on 1 ,5% WIPIWSP in flour) used in baking, is then inactivated at 95°C for 2 0 min. For WIP the solubili zed fraction is recovered by centrifugation. Monosaccharide analysis.
7
mg lyophili zed gluten or 1 2 mg lyophilized dough is
hydrol yzed by 1 82 JlI 2M TFA at 1 25°C for I h . The composition is determined by HPAEC using a Dionex PA column, elution with a gradient of water, NaAc and NaOH (5 min. 8 5 : 1 5 H20 : O, 1 M NaOH, 45 min H20, 3 0 min 0,3 M NaOH, O , I M NaOH+O , I M NaAc,
13
min 8 5 : 1 5 H20 : O , 1
7
min
M NaOH) at 0,8 mllmin and
pulsed amperometric detection. Gel filtration chromatography. The molecular weight distribution is analyzed on three TSK-gel columns connected in a row (G4000-, G3000- and G2S 00-WXL). Detection is performed by a refractive (Shimadzy RID-6A) and an UV detector (Dionex). 0,4 M acetate buffer pH 3,0 is used as an eluent. The flow rate is 0,8
mllmin and performed at room temperature. Pull ulan standards are used as molecular
weight indicators.
Ferulic acid determ inations. Ferulic acid is determined spectrofotometrically after saponification (2 ml 0,5 M NaOH for 90 min at 60°C) and extraction into ethyl
Non-Starch Polysaccharides and Enzymic Improvement of Bread Quality
345
acetate as described by Ciacca et aJ.9 Activity measurements. Lyophilized doughs containing an azurine conjugated WSP or WIP were made. Xylanases were incorporated. The doughs were extracted with diluted HCI pH 1 ,2 using 0,1 M HCI and the absorbance was read at 590 nm and calculated relatively to the activity of a standard xylanase.
4 RESULTS AND DISCUSSION 4.1 Breadmaking effects The baking performance of the xylanases at relevant dosages based on FXU's e.g. 50-200 FXU/kg flour is shown in figure I for rolls. The results are mean of 4 flours, and the same tendency is seen in all flours. It can be seen that the best volumes are obtained with Enzyme D and the stickiness is reasonable. Enzyme C is also good; the dosages may be increased before the same stickiness as with the high dosage of Enzyme D is obtained, but the performance at the same stickiness is not as good as with Enzyme D. Enzyme B gives good volume, but the doughs are much too sticky and can therefore not be used in baking. Enzyme A has almost no effects on the stickiness, but the volumes are too small. Especially the volume increase at increased dosages is too low. Enzyme A has therefore almost no effect in baking. 4.2 Activity measurements Activity measurements have been performed in in vitro systems typically on azurine conj ugated WIP or WSP. In order to elucidate the activities of the xylanases in doughs and to establish whether a correlation to baking performance could be obtained, 2 different activity measurements were developed. The activity of the xylanases in doughs towards WSP and WIP were measured (figure 2). Very different activities occur especially towards the WIP, and that one xylanase resulting in stickiness (Enzyme B) has a much higher activity than the other xylanases. Enzyme A having almost no effect in baking has no activity towards WIP. Towards WSP the differences are smaller but Enzyme B reveals the highest activity in this case too. It has been proposed I that at the optimal dosage the xylanase should release high molecular weight arabinoxylan from WIP together with a minimal degradation of the WSP. This would give a high activity on the WIP and a low activity on the WSP,
. u. �====�
I �
. . ,
.i ••
I • •,• • "
10'"1 ....... ... .t••..... " J .,
I • •,. . .
Ie ...... .........
Figure 1
,.4 ._,
••
,
S." .,
I ••,• • C
.'41"
1 • •, . _ b
Baking perfonnance of the xylanases
Wheat Structure. Biochemistry and Functionality
346
::;
A c t i v i t y to w a r d s d i ffe r e n t p e n to s a n s
;:
.., c ·
M . .lUr.d
0",
�
I n
t h . dou,h
0 ...
;:
�•
OJ
� �
0.2
2
:..
0.1
·
"
-<
Figure
2 A ctivity
of xylanases tow ards WSP and W IP in doughs
however apparently the tendency may not be true in comparing different xylanases. Doughs were made with different water contents in order to study the activity of xylanases at these conditions. It is seen that the xylanases used in baking reveal a lower or unchanged activity at the highest water content while the opposite is seen
for Enzyme B which is not used in baking due to dough stickiness (figure 3). Rouau ' et al have proposed that at a too excessive degradation of the WIP too much water is liberated which can no longer be incorporated into the dough, and the dough be comes sticky. Therefore the hypothesis can be made that
if the xylanases are
activated at higher water contents, a too extensive degradation may occur. But i f instead the xylanases exhibit a lower or unchanged activity a t a higher water content the hydrolysis of the arabinoxylan may stop or slow down. Th is may result in an adequate hydrolysis of arabinoxylan, and thereby an increase in bread volume with out a too extensive stickiness. 4.3 Molecular weight distJ;bution The effects of the xylanases on the molecular weight distribution of degraded purified WSP and solubilized WIP from a purified substrate were studied. The results are shown in figure 4. It can be seen that very different profiles are obtained. Enzyme
C
and Enzyme A having different effects in baking solubilize carbohydrates
from WIP with almost the same size. The degradation products are at the longest reaction period small size arabinoxylans (Mw < 5000) while Enzyme D and Enzyme B both solubilize high (Mw approx. 1 20000) and medium size (� approx. 40000)
� �
O ol l
•
0,"
A c ti v i t y a t d i ffe r e n t w a te r c o n t e n t s
�==============================�
r-
===.=�iI _:�I �=�=: : :" � t;:�; =�= ..
Figure 3
A ctivity
, •• In r O ll l c n l
... E n z Y nl c A � E. zym c B .... E ll zym c C ... E n zym e D
111
of xylanases in doughs w ith different w ater contents
Non-Starch Polysaccharides and Enzymic Improvement ofBread Quality J " WSP .,aded wi" £.,. 8 ,
� "
1 % wlP "r*d w'lII kJ- A
lui
,.
l�t:! " """ " , , , , ,
"
347
IS
»
U
, , JO
I
% WSP del...d ....i.. '-,_ D
U
I % WlP ...-. wi. r..,.... B I % WIP _•..ted willi ra,... c
--
'i' % WIP "'.-- W;"
i'-
0
\Ii A�
" [:��
'\-�--..."_-' ��J " figure 4
Molecular weight distribution on WSP and W IP
arabinoxylan. Gruppen
et all o
have shown that the xylanases having a good baking
performance solubilized and/or degraded WIP faster into fragments of a lower mole cular weight than a xylanase not suited for baking. Others have reported that preferably a solubilization of high molecular weight components should be seenl. None of these hypoteses can be confirmed. Enzyme
B and Enzyme D degrade WSP into high mol ecular weight fragments
although they are somewhat smaller for Enzyme D. Enzyme
C
and Enzyme A
degrade WSP into smaller fragments. Different effects of WSP on bread volume has been observed6.7.1I.l2, but no correlation between the molecular weight distribution and baking performance is seen in this study. 4.4
Rheological studies The storage modulus G' and the phase angel
using an oscillation method (figure
8
for gluten have been measured
5). Enzyme B and Enzyme C decrease the gluten
elasticity slightly by increasing the phase angel 0 while the other two lowers 0
compared to the control. A more strong gluten is obtained using Enzyme A and
Enzyme D (an increased G') while the gluten strength is unchanged for the other xylanases. As Enzyme
C
and Enzyme D result in increased bread volume an
increased elasticity and strength would have been expected for both, but other factors may affect the baking performance making the correl ations more complex. The hypothesis proposed by Maat
et
al. l3, that the beneficial effects of xylanases
on loaf volume may be due to redistribution of water from the pentosan to the gluten phase is not the only factor explaining the positive effects of xylanases. The effects of gluten pentosans may be important. 4.5
Gluten pentosans We have found that xylanases affect the rheological properties of gluten and it
has been described in the literature7.l4-l7 that pentosans and gluten interact and Udy l6
Wheat Structure. Biochemistry and Functionality
348
t. Alterence: 2. flu", t 100 FXUitI n.... . 3. En" . t 100 FJlJIkg n.... . ... Enzy. c: 200 fWIk, flOII' . �. flu,. � 110 FJIJ/kl n.... . 1.2
U
• u
...... .
Figure 5
t. 2, 3. •• 5. •.,
Atrtrtntr. EnZ,. A: 100 FXUltl En:y_ It 100 FXUlkg EnIY. c: 200 FX1J/kO En". 0: !IO FXU/kl
Wll,. •
II
r low. tIOII" . flO!.l' • flour. ,.
ill
'"
Loss and storage modulus of xylanase treated gluten
has proposed that the nature of these interactions is weak secondary bonds. The structure of the pentosans associated
with
gluten
(gluten
pentosans)
has been
proposed to be similar to WSpIS. However, no reports are made concerning the effects of xyl anases on gl uten pentosans. The content of gluten pentosans determined as the sum of arabinose and xylose following xylanases addition is expressed relatively to an untreated dough. A lower content i s found for Enzyme B and Enzyme D, wh i l e a higher content was found for Enzyme
C.
No changes are seen for Enzyme A. The A ralXyl ratio is for doughs
0,74; for Enzyme A gl uten 0,93 ; for Enzyme C gluten 1 ,00; for Enzyme D gluten 0,96 and for Enzyme B gluten 0,94. The arabinose values represent not only the arabi noxylan
but
also
the
arabinogal actan
since
wheat
arabinogalactan. An explanation may be that Enzyme
C
flour
contains
some
alters the pentosans and
thereby increases their abi l i ty to adhere to gluten. As can be seen no correlation to neither the baking performance nor the rheological data is found. The A ralXyl ratio shows that the unsolubilized arabinoxylan has a higher AralXyl ratio than the parent material which supports the observations made by Rouau
all and Gruppen
el
et allo
4.6 Felulic acid
The reason for the differences in water extractab i l i ty between WIP and WSP has not been determ ined yet, but covalent crossl inking of ferul i c acid and physical
entanglement have been suggestedX, i . e. a higher content of ferulic acid in WIpI 9 •20 The content of ferulic acid in doughs and gl uten was determined (figure C o n l e n l o f fc r u l i c a c i d D • • , 11 •
.
�
,
•••
FigUlll 6
,•
• A
t.,,_ . •
1 • •, • • C
1 . ,, _ . D
Content offemlie acid in xylanase treated doughs
6). A
Non-Starch Polysaccharides and Enzymic Improvement ofBread Quality
349
significant lower (p<0,05 ) content is seen in the xylanase treated doughs compared to the control. It may partly be due to dimerization. No significant differences are seen in the content in gluten (results not shown). However, a lower content is seen in Enzyme D than in the control. As it can be seen no differences explaining the observed differences in baking performance can be found in the ferulic acid content.
5 CONCLUSION The activity of xylanases in doughs have been determined, and the molecular weight distribution on purified substrates has been established. This reveals differences be tween the xylanases, but no direct correlation to the baking performance can be given indicating that this correlation may be more complicated than merely the occurence of fragments of certain molecular weight ranges. However, it was seen that xylanases used in baking exhibit a lower or unchanged activity at a higher water content than the xylanases which can not be used in baking due to dough stick iness. A hypothesis may be that a too extensive degradation is avoided due to the lower activity when water is released. Xylanases affect the gl uten rheology and the content of gluten pentosans, and ferulic acid in gluten and doughs have been determined. Xylanases affect the content of gluten pentosans and of monomeric ferulic acid. No correlation to baking performance or the rheological properties can be given.
A cknowledgements to P. Wagner and H. L. Larsen for assistance with this paper.
6 REFERENCES I . X. Rouau et ai, J Cereal Sci., 1 994, 19, 259. 2. European patent 0 463 706 A 3. European patent 0 507 723 A 4. X. Rouau and D. Moreau, Cereal Chem ., 1 993, 70, 626. 5. M. D. Shogren et aI., Cereal Chem. , 1 987, 64, 3 5 . 6 . L . Krishnarau and C. Hoseney, J Food Sci., 1 994, 59, 1 25 1 7. G.1. McMaster and W. Bushuk, J Cereal Sci., 1 983, I, 1 7 1 . 8 . H. Gruppen et aI. , J Cereal Sci. , 1 993, 16, 5 3 . 9 . C.F. Ciacco and B.L. D'Appolonia, Cereal Chem ., 1 982, 59, 1 63 . 1 0. H . Gruppen e t aI. , J Cereal Sci. , 1 993, 1 8, 1 29. I I . 1. Michniewicz, Food Chem., 1 992, 43, 25 1 . 1 2. S. Vanhamel et aI. , Cereal Chem ., 1 993, 70, 306. 1 3 . 1. Maat, "Progress in Biotechnology", Elsevier, Amsterdam, 1 992, Vol. VII, p. 349. 1 4. S.K. Patil et aI. , Cereal Chem ., 1 975, 52, 57. I S . K Kulp, Cereal Sci. Today , 1 968, 13, 4 1 4. 1 6. D.C. Udy, Cereal Chem. , 1 957, 34, 3 7. 1 7. S.L. lelaca and I. Hlynka, Cereal Chem., 1 972, 49, 489. 1 8. B.L. D'Appolonia and KA. Gilles, Cereal Chem ., 1 9 7 1 , 48, 427. 1 9. C.M.G.C. Renard et aI. , Sciences des A lim ents, 1 990, 10, 283. 20. T. Geissman and H. Neukom, Cereal Chem ., 1 973, 50, 4 1 4.
PEROXIDASFS IN BREADMAKING
Marten
V(I1
Oort, Henk Hennink, Peter Schenkels au} Colja Lane
Quest Intemaiond p. o. Box 2 1400 CA Bussum The Nether/ends
IN1RODUCllON The bread-making industry provides the consumer daily with a wide variety of fresh, high quality products. Industrial bread making is a dynamic, constantly changing process. This will be clear from the following observations: * The main ingredient in bread, i.e. wheat, is highly variable in quality, depending on wheat variety, growing location, fertilizing regime and on c1irnatological-, harvesting-, milling- and storage conditions. * In the bread baking industry there is a large variation in manufacturing processes, varying in process time and different processing steps. In the UK and the USA most bread is made in large plant bakeries, whereas France and Germany would be typical ofthose countries where most bread is still produced by smaller, artisan-type of bakeries. * Automated processing and decreased processing times are becoming 'standard'. * New technologies (e.g. frozen dough, new oven technologies) are gaining popularity. * Consumer demands are changing. Today, consumers want a wide variety of breads, bread has to stay fresh for a longer period of time, it has to be healthy, i.e. low in fat and high in fiber, and a trend can be seen in the direction of 'clean label' products, meaning that the use of certain ingredients, as potassiumbromate, sodium-meta-bisulphite, emulsifiers, etc., is not longer wanted. These changes and demands require more dough tolerance and also tolerance in ingredient variation and processing variation. This tolerance can be obtained by using enzymes as processing aids. ENZYMES IN
BRFADMAKING
Enzymes have been non-intentionally used in bread making already for centuries because enzymes are present in wheat. The deliberate addition of enzymes to bread dough was described for the first time more than 1 00 years ago. In 1 886 malted barley flour was mentioned for use in bread. Due to the amylose degrading action of the enzymes in the malt, sugars were formed from starch which could serve as a yeast substrate during fermentation. Approximately 50 years later the use of Iipoxygenase was described for the first time as a tool for bleaching the bread crumb and to improve machinability. Since then, the use of different enzymes in bread making has increased rapidly and is now well established. Figure 1 depicts schematically a tentative structure of the different components in wheat dough, i.e. the starch kernels, aggregated gluten, carbohydrates and lipids and the sites of attack of the different enzymes. In general, enzymes act on one of the biopolymers present in wheat (e.g. polysaccharides, proteins) or sometimes combinations thereof. Amylases, attacking damaged or gelatinised starch, are used for generating sugars for the yeast fermentation and for slowing down the firming of the bread crumb, i.e. the aging of bread. Proteases are used for shortening mixing times and for obtaining more flexible doughs. Pentosanases (hemicellulases, xyl anases), acting on non-starch polysaccharides, are able to change and control water absorption and improve loaf volume. Oxidases are thought to act predominantly on the disulphide bridges which are essential for the building and the stability of the protein network, i.e. the gluten. In table I an overview is given of currently used enzymes in breadmaking together with the main function of each of those enzymes.
Non-Starch Polysaccharides and Enzymic Improvement ofBread Quality
351
xylanases pe'0
1
�
roteases
peptidases
FIGURE 1 . Schematic presentation of a dough structure and enzymes acting on several dough components.
TABLE I. Application of enzymes in breadmaking.
FUNCTION
KEY ENZYMES
FUNCTION
KEY ENZYMES
352
As
Wheat Structure, Biochemistry and Functionality
can
be seen in this table, most of the important characteristics in breadmaking are dealing with product
quality, i.e. loaf volume, shape, colour and taste. On the other hand, processing parameters, like dough
stability and stickyness are nowadays recognized also as very important due to the increasing production of bread in large industrial bakeries. Most of the processing parameters, and as a consequence also most of the product parameters are dealing with dough development. Optimal dough development is essential for good processing and good product quality.
DOUGH DEVELOPMENf What is happening during dough development? Essentially, the following processes are occurring. When wheat flour is mixed with water, high molecular weight protein complexes are formed. During dough mixing, these complexes are broken down to lower molecular weight components due to disrupture of several disulphide linkages between the gluten proteins. The mechanical deformations during mixing lead to stretched dough and a change in original positions of the sulfhydryl groups relative to each other. Upon dough rest and proofing new disulphide linkages network with better gas retaining properties.
are
formed in three dimensions leading to a gluten
According to this mechanism several requirements for optimal dough development can be formulated:
I)
The protein network should be partially broken down. This can be achieved by inclusion of sufficient mixing energy in the dough, i.e. by sufficient mixing intensity or mixing time.
2)
The rebuilding of the protein network should be optimal. This means that possible steric hindrance by hemicellulose should be minimal and this can be achieved by using hemicellulases. The obtained protein network should be sufficiently stable. The use of oxidases may help in 'fixating' the gluten structure.
3)
OXIDASES IN FOOD APPlCAllONS l Oxidases are currently not large volume products for the enzyme manufacturers. However, they are increasingly being used in interesting specialized applications in the food industry. Because of this, the search for commercial sources of oxidases and the production of microbial oxidase systems is intensified enormously during the last 3-4 years. Examples of current applications in the food industry are: I) deoxygenation of alcoholic beverages by alcohol oxidase, II) preservation of a range of products by catalase and lactoperoxidase, III) dough strengthening by glucose oxidase and other oxidases in breadmaking, IV) desugaring by glucose oxidase and V) removal of off-flavours (Szalkucki, 1 993).
OXIDASES IN BAKING Oxidising agents have a beneficial effect on dough properties. This has a positive result on other quality eters as volume, texture and crumb structure of the baked product. Up till now almost in all cases
Param
chemical oxidisers, like ascorbic acid (where dehydro-ascorbic acid is the actual oxidiser) and, although banned in most countries, potassiumbromate, are used for this purpose. Too high or too low levels of these oxidisers leads to under- or over-oxidised doughs. Under-oxidised doughs tend to be weak, soft, sticky,
extensible and have poor machinability. Over-oxidised doughs are hard, firm, stiff, etc. Also the rate of oxidation is important. Potassiumbromate is a relatively slow oxidiser because it works only at elevated temperatures, whereas the opposite is true for ascorbic acid. Furthermore, chemical oxidising agents are highly unspecific. The use of chemicals like ascorbic acid may lead to unwanted side reactions, i.e. other than exclusively disulphide formation. Replacement of chemical oxidisers by enzymatical ones could have the benefit of more specific and better controled oxidation processes. Several enzymes, like peroxidase, glucose oxidase, lipoxygenase and sulfhydryl-oxidase are reported as enzymatical dough oxidisers. PlROXIDASES Peroxidase (POx, EC 1 . 1 1 . 1 .7) is a general name for a group of highly specific enzymes (such as NAD
Pox, gluthation-POX, cytochrome-POX) and non-specific enzymes. With only a few exceptions, Peroxidases are haeme-proteins and occur in higher plants (horse radish,
Non-Starch Polysaccharides and Enzymic Improvement ofBread Quality
353
pineapples, legumes, cereals, vegetables, tobacco, potatoes, etc.), moulds, bacteria and yeasts. In mammaIians peroxidases occur in leukocytes, milk, liver, spleen, uterus, salivary glands, gut waIl and lungs, but the function of these peroxidases is not clear in all cases (PUtter and Becker, 1991). Also the kinetics of the enzyme from various sources is not uniform. Generally, peroxidases (POX) are defined as enzymes that cataIyse a dehydrogenation reaction. However, the POX reaction depends strongly on the type of substrate. The most simple peroxidase reaction can be defined as: ROOH + � <=>�O + ROH + A' The first step of the initial oxidation of the hydrogen donor substrate (AID produces a free radical (A'). Hydrogen peroxide (�OJ is generally the oxidising substrate (ROOH) (Dunford, 1982). The free radical then reacts non-enzymically with other compounds present. When very high concentrations of the free radicals are present, they will react with each other to from A-A compounds, like in the oxidation of guaiacol. A wide range of products may be formed from the reaction of the free radicals with the natural compounds present in foods (Robinson, 1991).
HYDR<JGEM>IROXIDE
In bread dough peroxidases can act without the addition of hydrogenperoxide. This indicates that ij� is present in the dough at sufficient amounts or that it is generated as a result of the peroxidase reaction, thus giving a continuous cycle of use and generation of this cosubstrate. The generation of hydrogenperoxide is thought to proceed through the following sequence of reactions (see figure 2).
The formation of substrate radicals reaction with oxygen can lead to formation of hydrogenperoxide. When these reactions are occuring, catalytic amounts of Ii� present in the dough are sufficient to get the cycle started and explains why no hydrogenperoxide has to be added together with the peroxidase. However, in a normal dough the amount of free oxygen is limited due to the presence of yeast which consumes most of the oxygen.
WHFAT FLOUR PEROXIDASE
Wheat flour contains peroxidase that can cross-link phenolic constituents like ferulic acid and vanillic acid. However, the pH optimum of the wheat enzyme is reported to be considerably lower than the pH of bread dough. In order to prove this, the pH dependence of several peroxidases was investigated in comparison with that of wheat flour peroxidase. The results are shown in figures 3a and 3b .
•
PEROXIDASE + H202
�
COMPOUND I + AH2
-.
COMPOUND II + AH.
COMPOUND II + AH2
�
PEROXIDASE + AH.
AH. + AH.
COMPOUND I
A + AH2
In presence of 02 : AH. + 02 + H+
---.
AH2 + 02-
02- + 02- + 2H+
--..
H202 + 02
I
Conclusion: only catalytic amounts of peroxide a re required
Figure 2. Sequence of hydrogenperoxide generating reactions.
354
Wheat Structure, Biochemistry and Functionality
(a) Spec.
�l
act. (Ulmg)
Spec. act.
�I
Peroxidase 1
Spec. act. (Ulmg)
Wheat flour peroxidase
pH
pH
(U/mgl
relativ• •ctivity (%) 120
Peroxidase 2
100
80 80
...,
20
03
03
6.'
Normalised activities
POX 1 • wheat tIour POX • POX 2 • PQX 3 • '---
� pH
pH
(b) WHEAT FLOUR PEROXIDASE
PEROXIDASE
Spec. acl. (Ulmgl
spec. act (Ulmgl
3
[I �I �I'� --- . .I �1 � l i�lr pH
.aTS
PEROXIDASE 1
Spec. act. IUlmg)
°3
pH
•
5
pH
NORMALISED ACTIVITIES
•
7
1
4
5
pH
•
7
Figure 3. pH dependence of 4 different peroxidases determined on guaiacol (3a) and ABTS (3b).
As
can
be seen in this figure, the pH optimum of wheat flour peroxidase is clearly lower than that of the
other three enzymes when guaiacol is used as a substrate. This could explain why wheat flour peroxidase is not active in bread dough and why added peroxidases from other sources than wheat flour may have a beneficial effect on dough strengthening. However, when ABTS is used as a substrate, the pH dependence of all four peroxidases is more or less the same. This indicates that the pH dependence of the different
peroxidases is also substrate dependent. When it is not clear on which component peroxidases are acting in a dough, it is difficult to draw the conclusion that wheat flour peroxidase is not active due to its apparent lower pH optimum.
Non-Starch Polysaccharides and Enzymic Improvement of Bread Quality
355
ANALYSIS OF OXIDISING E'iZYMES
The analysis of glucose oxidase, sulfhydryl-oxidase and Iipoxygenase actvities are straight forward and well documented. The reason is that these enzymes catalyse well defined reactions acting on also well defined substrates. For peroxidase the situation is completely different. This enzyme catalyses the oxidation of a wide variety of compounds. This is the reason that many different assay methods have been developed for this enzyme. In table II the activity of a number of different peroxidases on a range of synthetic substrates is shown. Although the table is not completed yet, it will be clear that there are large differences in the specificities of several peroxidases. AAP and ABTS serve as hydrogen donors and this process results in a colour change of these compounds. DMABlMB1H are oxidatively coupled by peroxidase in presence of Ii� to form a deep purple compound. Guaiacol has been used for more than 30 years in the vegetable processing industries in order to determine the peroxidase activity as a measure for the blanching efficiency.
Table II. Enzymatic activities of peroxidases from several sources. Activities in !lmol/minlmg (Schenkels and van Oort, 1 994). ABTS
GUAIACOL
PYROGALLOL *
AAP
DMABI MB1H
Peroxidase I
1 49.3
325.9
1377
39 1 .5
452.5
lPeroxidase II
0.03
0.02
n.d.
0.027
n.d.
Peroxidase III
0.093
0.008
n.d.
0.13
0.2
Peroxidase IV
42 1 1
401.9
1 1 34
1 735.7
134
Iperoxidase V
0.016
0.055
n.d.
n.d.
0.03
1Peroxidase VI
526.4
1 8.5
356.4
13.3
0.46
lPeroxidase VII
6.3
n.d.
n.d
3.69
n.d.
1Peroxidase VIII
130.7
n.d.
972
288.1
n.d.
iENZVME
SUBSlRATE
Arbltrary UnIts, smce specifiC ii6SOfj)flon coettIclent ** In most assays no linear kinetics. ABTS
=
AAP DMABlMB1H
=
=
IS
not known.
2,2'-azino-di-(3-ethyl-benzthiazoline-6-sulphonic acid) 4-aminoantipyrine 3-(dimethylamino)benzoic acid/3-methyl-2-benzothiazolinone hydrazone
Pyrogallol is one of the oldest POX substrates and is hardly used anymore because of the inferior kinetics of the POX reaction. There are more POX substrates available (e.g. o-dianisidine, 3,3-dimethoxybenzidine or o-phenylene-diamine) but many of them are hardly being used because of the harmful (carcinogenic) character of the compounds. However, the use of such enzyme activities upon application of peroxidases in breadmaking is very difficult. The mentioned substrates have no relation with the actual substrates which may be encountered by peroxidase in dough and there is no correlation between these activities and the performances of the enzymes mentioned in dough. Therefore, a relevant assay is required.
RlNcnOOAL PIROXIDASE ASSAY
In order to set up such an assay, use is made of soluble wheat pentosans, since this is one of the structures peroxidase may encounter in a dough. The rate of viscosity increase may be taken as a measure of peroxidase activity. This is shown in figure 4.
356
Wheat Structure. Biochemistry and Functionality
"0 Q)
.!!!
nI
E .... 0 c:
0.�
� III 0 (.)
.!!! >
Peroxidase 1 (ABTS Un its)
1 00
21 U +
80
14
•
1
60
11 U •
9U
40
-+
7 U
20 0
U
•
0
50
1 00
1 50
Time (sec)
200
250
Figure 4. Viscosity increase of pentosan solution due to oxidative gelation catalysed by peroxidases. A relatively high dose level of peroxidase gives an immediate and fast viscosity increase. Upon lowering the peroxidase concentration the rate of increase is going down, just as the final level of viscosity that is reached after a certain time interval. Furthennore, a lag phase is introduced with using lower peroxidase levels. The rate of viscosity increase may be correlated to the effects of peroxidases in dough strengthening. ACllON OF PIROXIDASES IN WHEAT DOUGH
Although the mechanism of the peroxidase reaction in dough is not completely understood yet, there are several theories describing the reactions that may be catalysed by these enzymes leading to the experienced dough strengthening. I n the first model (figure 5a) the gelation of wheat pentosans (arabinoxylans) is thought to proceed through the peroxidase catalysed dimerisation of ferulic acid groups which are esterified to the pentosans (Geissmann and Neukom, 1 973). This gelation is supposed to be responsible for the observed dough strengthening. The second model (figure 5b) is almost comparable and describes the oxidative coupling of pentosans (through ferul ic acid) to cysteine or tyrosine side chains of proteins (Hoseney and Faubion, 1 98 1 ). Although the gelation type of effects of peroxidase are well documented, it is still not clear whether peroxidases act on these carbohydrate structures in the dough, especially since a positive effect of a mixture of xylanases and peroxidases is found. As can be seen in figure 6, peroxidase is not able to gelate pentosans anymore when xylanase has (partly) hydrolysed these carbohydrates. Pentosans without added xylanase immediately gelate in presence of peroxidase and hydrogenperoxide. This can be seen by the prompt and strong viscosity increase. When xylanase can react on the pentosans prior to peroxidase action, the viscosity increase is much lower and after a short period the viscosity even decreases. Upon longer pre-incubation with xylanase there is no viscosity increase anymore. From these experiments it may be concluded that peroxidase is not acting on the soluble pentosans in wheat dough. However, since xylanases are also able to produce more soluble pentosans in a dough by converting insoluble hemicellulose, there may be sufficient pentosans present in a dough for peroxidase to work on. Model studies with peroxidase, glutathion and cysteine have indicated that sulfhydryl groups may be involved (Matheis et aI., 1987) in the peroxidase reaction and that the dough strengthening effects of peroxidases can be explained by an action of this enzyme on proteins. Peroxidase catalysed reaction results in a decreased amount of lysine recovered from proteins after acid hydrolysis. The peroxidases, or the quinones fonned by peroxidase, oxidatively deaminated Iysyl residues to fonn lysyl-aldehydes. This results in the formation of dimers, trimers and higher protein polymers, as was revealed by gel filtration (Stahmann, 1 977). These aggregates were not dissociated by detergents which means that covalent bonds were fonned.
Non-Starch Polysaccharides and Enzymic Improvement of Bread Quality
(a) �,,"
� � -<0t
-- I Q CH,
H � CH
\Rf J-
H,CO
HO
OH
Peroxidase H,O,
H,C
'H�c
�
I
o H = CH-C-O-arablnoxylan
HO
o II
+ 2H,O
arablnoxylan-O-C-CH=CH
(b)
357
,.,--- Protein
H H I HC-H, -S-C I c=o
I
o
_ _ 11111 � (1981)
---- � Arabinoxylan
Figure 5. Model reactions describing the dough strengthening effect of peroxidases. Sa: Pentosan gelation; 5b: pentosan-protein coupling.
Wheat Structure, Biochemistry and Functionality
358
60
0::u
-
>. � CI)
50
0 40 u
CI)
:>
Q)
> +:: .!!!
30
.......\ . .. . . � ...... .. ••
Q)
a:: 2 0
• ••
Xyla nase
••
••
.. .... ... . -··-·---..�·.·"It- W ..
•
POXlXyl 5 min •
POXlXyl 1 min -+
POX -
..
1 0 L-�-J--�--�--�-L__L-�____�
o
60 1 20 1 8 0 240 300 360 420 480 540 600 660
Time (sec)
Figure 6. Effect of peroxidase and xylanase on gelation of soluble wheat pentosans.
EJI/ZYME BAsm BROMAlE REPlACERS Consumers in North America and Western Europe prefer foods with "clean labels", i.e. no chemical reagents added. Also legal pressure against chemical additives is rapidly increasing. The best example of this is the banning of potassium bromate as dough oxidiser in most countries, because very small quantities of residual non reduced potassium bromate were detectable in the final product and feeding trails had implicated potassium bromate as a potential carcinogen (Dirndorfer, 1 99 1 ). As a result the baking industry is looking for alternatives already for some years. Enzymes, in combination with ascorbic acid and emulsifiers, have been suggested as alternative and several types of enzymes have been screened for replacement of chemical oxidisers. Table III. Amount of reactive SH groups ofcontrol and enzyme supplemented flour (Haarasi lta et ai, 1 99 1 ). Reactive SH groups (Ilmo1/g) Control flour
1 .925
Glucose oxidase ( 1000 U/kg) supplemented flour
0.379
Rheological studies have shown that oxidases strengthen dough, increase mixing tolerance and stretching resistance of dough. Dough strengthening is mainly associated with disulphide bond formation between protein molecules in the gluten. This has been confirmed by measuring the amount of free SH groups in gluten before and after enzyme supplementation. The results (Table Ill) show that oxidative enzymes decrease the amount of reactive SH groups.
Non-Starch Polysaccharides and Enzymic Improvement of Bread Quality
359
These experiments, in which only GOX is used confinn the necessity of combinations of oxidising and hydrolysing enzymes. The first category gives sufficient process tolerance, whereas the second category gives good loaf volume, crumb structure, colour, etc. ,
PERFORMANCE OF PEROXJDASES IN BAKING In the baking experiments Gennan "Kaiser" rolls were baked. In these trials, Trichoderma xylanase (300 ppm) was used in order to obtain 'over-relaxation' of the dough. The xylanase was added in combination with 40 ppm ascorbic acid and various peroxidases. Four peroxidases from different sources were investigated in this experiment. TIle dough stability was tested at two different proofing times (55 and 70 minutes) at 32 °C and 80 % RH The doughs were bakes for 19 minutes at 230 °C. The results are shown in table IV.
Table IV. Effects of different peroxidases on dough strengthening, shape and loaf volume.
ENZYME
Blank
DOUGH CONSISTENCY flexible, soft, sticky
+POX I +POX 2 +POX 3 +POX 4
stiff, dry stiff, dry stiff, tough stiff, tough, dry
DOUGH STABILITY
LOAF FORM
LOAF VOLUME
±
6
+
++
7 7 7 7
++
++ + +
++
+ +
The addition of each peroxidase leads to strengthening of wheat doughs as detennined by stability of the dough after 'shaking' the dough for 1 minute in a laboratory shaker. This improving effect is observed at both short and long fennentation times. Also the shape of the dough increased in all cases. Finally, the volume of the dough increased after application of peroxidase 1 and 2. Q)N(LUSI<X�S From the above described experiments and literature information it will be clear that peroxidases are interesting enzymes to improve properties of dough and bread. Certainly in terms of dough strengthening and dough stabilization peroxidases can be very valuable tools. However, the mechanism behind the improving effects in not yet completely clear. The improving effects can be due to pentosan gelation, by protein-pentosans coupling, or by additional formation of disulphide bonds, thus increasing the gluten network strength. Of course it also possible that combinations of these effects occur in bread dough. IlDRA1URE Dirndorfer, M. ( 1 992) 239-244 1 Dunford, HB. ( 1 982) In " Advances in inorganic biochemistry" Eichhorn and Marzilli eds. Elsevier, 2 N.Y.lAmsterdam 3 Geissmann, T. and Neukom, H. ( 1 973) Lebensm. Wiss. Techn. � 59-62 Haarasilta, S., Vaeisaenen, s. and Pullinen, T. ( 1 99 1 ) In " 76th AACC Symposium Proceedings" 4 AACC. St Paul, MN Hoseney, RC. and Faubion. 1.M. ( 1 98 1 ) Cereal Chern. 2R 42 1-424 5 6 Matheis, G. and Whitaker, JR ( 1 987) 1. Food Biochem. 1l 309-327 7 Matheis, G. and Whitaker, lR ( 1 987) J. Protein Chem. 1 35-48 POtter, J. and Becker, R ( 199.) In " Methods of enzymatical analysis" Bergmeier and Grassl eds. 8 Verlag, Berlin p 286-293
360
9 10 11 12
Wheat Structure, Biochemistry and Functionality Robinson, D,S, ( 1 991 ) In " Oxidative enzymes in foods" Robinson and Eskin eds, Elsevier LondonIN.Y. p, 1 -49 Szalkucki, T. ( 1 993) I n " Enzymes in Food Processing" Acad. Press p . 279-291 Schenkels P. and van Oort, M.G. ( 1 994) Unpublished results Stahmann, M.A. ( 1 977) In " Protein Cross-linking: Nutritional and medical consequences" Friedman, ed. Plenum Press, N.V. p 285.
A METHOD FOR TESTING THE STRENGTHENING EFFECT OF OXIDATIVE ENZYMES IN DOUGH.
tDanisco Ingredients, Enzyme development, Edwin Rahrs Vej 38, DK-8220 Brabrand. 2Laboratory of Gene Expression, University of Aarhus, Gustav Wieds Vej 10, DK-8000 Arhus C .
1 . Introduction In recent years a number of chemical additives used for bread improvement have been prohibited, making substitution with oxidative enzymes or other substances desirable. The search for new oxidative enzymes often involves the purification of enzymes from low yield, wild-type sources. Such oxidative enzymes are often only available in small amount, and it is not possible to test their strengthening effect using an extensograph. The purpose of this work is to develop a small-scale method to measure the effect of oxidative enzymes in wheat dough without performing rheological tests. The chemical additives ascorbic acid and bromate promote the oxidation of flour protein sulfhydryl groupst. It is expected that different oxidative enzymes act on either proteins or carbohydrates in the flour. Acting on the proteins, the strengthening effect is caused by an oxidation of the gluten SH groups forming disulphide bridges. Acting on the carbohydrates, one of the possible effects mentioned in literature is the cross-linking of arabinoxylan through the formation of diferulic acid bridges2 .
It was the purpose of this work to construct a model dough system which makes it possible to work in a small scale. Furthermore, to develop a method for measuring the effect of oxidative enzymes (i.e. enzymes which cause the formation of disulphide cross links between thiol groups in gluten fractions) in wheat dough without performing rheological tests. The principle of this method3 is to react the SH groups in a dough sample with a colour reagent: Ellman 's reagent 5,5 ' -dithiobis (2-nitrobenzoic acidt (DTNB) with release of a soluble chromophore the 2-nitro-5-thiobenzoate anion (NTB2.) (scheme 1 ) . The content of SH groups can be calculated using the value of 13,600 M-tcm t for the extinction coefficient of NTB2-. One advantage of the assay is that it detects both soluble and insoluble SH groups. In the assay detecting reactive SS groups the principle is first a reduction of the protein SS groups and the DTNB with sodium sulphite (scheme 2). Second, the total SH group content is measured (scheme 3) , and the SS content is calculated as the difference between the SH group content before and after reduction of SS groups with sodium sulphite. (scheme 1 )
DTNB- + protein-S-
NTB2- + protein-S-S-NB
(scheme 2)
protein-S-S-protein ' + SO?
protein-S-S03- + protein '-S-
Wheat Structure, Biochemistry and Functionality
362
(scheme 3)
2 NTSB - + protein 'S-
-+
The method should be evaluated by testing glucose oxidase (GOX) (scheme 4) and peroxidase (POD) (scheme 5). (scheme 4) (scheme 5)
GOX
-+
POD
Diferulic acid + 2H20
Extensograph and baking tests were made to compare the results to other methods.
2. Materials and methods
2 . 1 . Dough model system The system copies, in a modified form, the dough mIXing procedure used in the farinograph5 . To 2.0 g flour (danish reform 1994) is added 0.04 g NaCl . The mixture is stirred slowly for 4 min . Then 3.0 ml of liquid (water, enzyme) is added, and the suspension is stirred fast for 6 min . The reaction is stopped in liquid N2, and the dough is freeze dried in a Hetosicc freezedrier for about 1 day. The dough is homogenised in a coffee mill (Janke & Kunkel GmbH & Co. KG Type A 1O) . 2.2. Assay for reactive SH groups Reagents: The inorganic chemicals used were of analytical reagent grade. Buffer 1 : 0.2 M Tris, 3 mM EDTA, 1 0 mM DTNB (Sigma D-8 1 30), pH 8. Buffer 2: 0.2 M Tris, 3 mM EDTA , pH 8. To 0.5 g dough sample is added 9.5 ml buffer 1. The suspension is mixed and reacted for 25 min. Then the suspension is centrifuged at 1 3 ,000 g for 1 0 min. The supernatant is diluted twice in buffer 2, and after 10 min . the sample is centrifuged at 1 3 ,000 g for 5 min. The absorbance at 4 1 2 nm is read. The content of SH groups can be calculated 2 using the value of 1 3 ,600 M- 1 cm- 1 for the extinction coefficient of NTB -. 2 . 3 . Assay for reactive SS groups Reagents: 2 . 5 g DTNB is dissolved in 250 ml 1 M Na2S03 . The pH is adjusted to 7 . 5 . The bright red solution is brought to 38 · C , and air is bubbled through it with a gas dispersion tube. The reaction is judged to be complete when the solution turns to a pale yellow ( - 2 days) . Buffer 3 : 0.2 M Tris, 3 mM EDTA , 0. 1 M Na2S03 , 10 mM NTSB3 .6, pH 9.5. Buffer 4: 0.2 M Tris, 3 mM EDTA, 0. 1 M Na2S03 , pH 8. To 0.5 g dough sample is added 9.5 ml buffer 3. The sllspension is mixed and reacted
Non-Starch Polysaccharides and Enzymic Improvement of Bread Quality for
25
min. Then the suspension is centrifuged at
is diluted for
5
10
times in buffer
min. The absorbance
4, and after 10 min. at 412 nm is read.
363
13,000 g for 10
min. The supernatant
the sample is centrifuged at
1 3,000 g
3. Results and discussion Under non-denaturating conditions only a fraction of the total SH will react, and these are called the rheologically active ones7. The SH groups sitting on the protein surface are more accessible for reaction than the SH groups hidden in the protein core. A similar situation exists with SS groupS7. Two types of SS groups can exist, the intra- and the interchain groups. The interchain SS groups react with sulphite in aqueous solution, whereas most of the intrachain groups are not reduced. The following shows the results from the SH/SS assays, the extensograph measurements and the baking trials.
Index 0
=
(B/C)
Optimal range:
(2. 8-3.5)
Figure 1. The extensograph was used to measure the effect of the addition of GOX and POD on the rheology of dough. An extensogram curve shows the commonly measured parameters8•
Table 1. SH/SS determination and extensograph measurements for varying concentrations of GOX in a flour/water dough. BU Cone
Rele-
(U/kl tlour)
(proo1.
OOX
R.ae-
live 5H
live 55
II
II
tlour)
(pmo1.
=
l!rabender lInits. cm
o 4S
0 90
0135
(BU)
min
(BU)
(BU)
(BU)
min
1 83
1 .2
1 .5
1 .4
B 45
B 90
B135
C 45
C 90
min
min
min
min
(BU)
(BU)
min
(BU)
(BU)
min
min
(BU)
flour)
0
0.76
6.63
220
260
260
184
175
1 00
0.73
6.51
260
360
430
191
1 74
141
1 .4
2.1
3.0
1000
0.56
6.85
400
600
600
160
128
127
2.5
4.7
4.7
5000
0.44
7. 1 6
510
770
900
142
132
119
3.6
5.8
7.6
10000
0.45
6.94
420
750
880
145
126
125
2.9
6.0
7.0
50000
0.68
6.67
460
780
780
153
125
138
3.0
6.2
5.7
Wheat Structure, Biochemistry and Functionality
364
Table 2. SH/SS determination and extensograph measurements for varying concentrations of POD in a flour/water dough . Cone. POD
(U(kg t19�r)
Reacti-
Reacti�
(.umolel
(.umolel
ve SH
vo 5S
B 45 min (BU)
B 90 nlin (BU)
B135 min (B\I)
C 45 min (BU)
C 90 min (B\I)
C135 min (BU)
D 45 min (BU)
0 90 min (BU)
0135
240
270
270
169
171
160
1 .4
1 .6
1 .7
min
(BU)
g t1o�r)
g flour)
0
0.84
7.10
1 00
0.84
6.59
250
280
290
1 72
162
169
1 .5
1 .7
1 .7
1000
0.88
6.55
250
280
280
1 75
1 72
169
1 .4
1 .6
1 .7
0.87
5.36
250
280
280
176
176
169
1 .4
1 .6
1.7
1 .4
1 .3
0.7
0.7
5000
1 0000
0.86
4.37
230
240
240
1 84
1 75
181
1 .3
SOOOO
0.9 1
1 .20
140
150
150
203
226
224
0.7
Table 3. SH/SS determination and extensograph measurements for varying concentrations of GOX/POD in a flour/water dough. Cone.
Reac-
POD (U/kg flour)
(pm.,.
GOXI
tive:: SH
le/8 flour)
Renclive S5
(pm.,. I
B 45 min (BU)
B 90
min
(BU)
BI35 min (BU)
C 45 min (BU)
C 90 min (BU)
C I35 min (BU)
0 45 min (BU)
D 90 min (BU)
0135
min
(BU) ... .
flour)
0
0.72
8.17
230
270
260
1 82
183
175
1 .3
1 .5
1 .5
100012500
0.60
6.13
410
600
650
173
136
121
2.4
4.4
5.4
1.50/2500
0.75
5 .87
280
400
530
182
1 70
152
1 .5
2.4
3.5
7.69
280
370
178
164
147
1 .6
2.3
3.4
1501200
0.76
500
Figure 2: Danish rolls tested with GOX. A: Control. B: 50 u/kg flour. C: 1 00 U/kg flour. D: 200 U/kg flour.
Figure 3: Danish rolls tested with POD. A: Control B: 5,000 u/kg flour. C: 10,000 U/kg flour. D : 50,000 u/kg flour.
Non-Starch Polysaccharides and En;:ymic Improvement of Bread Quality
Figure 4_ Effect of GOX on SH/SS
groups.
SH/JLmole /g flour Ix
Figu re 5 _
Effect of GOX on the extensograph .
SSIJLmole Ig flour""
Resistance/extensibility/BU
8
---1 -0.9'+---.7.2
6 0.7t---\-----tL---..:>"..---l 4
0.6t----"*----+-l --�---�-� . 6
��-+-
'r----r:,-- �-�-�--_..16 .4 5 0.1 50 10 kUnits GOX/kg flour
Figure 6 _
Effect of POD on SH/SS groups. SHlJLmole /g flour/X
SS/JLmole /g flour/+
2
k Units GOX/kg flour
Figure 7 _
Effect of POD on the extensograph. ResistAnce/extcnsibility/BU
0 . 6t------"-.,,--l
4 0.4t-------+---l
0.2t-------.\rl
�-��----�---�o 5 1 kUnits PODlkg flour
0.1
10
50
k U nits POD/kg flour
365
366
Wheat Structure, Biochemistry and Functionality
GOX (table 1 and figure 4) causes a fall in the SH concentration and an increase in the SS concentration until a GOX concentration of 5 ,000 U/kg flour. The H202 produced by GOX oxidises the SH groups in gluten, creating SS bonds. The formation of SS bonds improves the network in the gluten fraction , which strengthens the dough. This enables the dough to retain the CO2 gas developed during fermentation . When the GOX concentration is higher than 5 ,000 U/kg flour, the SH concentration increases and the SS concentration decreases as a result of overdosage. This results in the dough relaxing. The protein network is not strong enough to retain the CO2, The absolute values measured in these assays are rather small. This is because the flour used to test the method is a relatively strong flour with a high protein content. The effects are more pronounced if a weak flour with a low protein content is used . The extensograph measurements (table 1 and figure 5) show that GOX causes an increase in resistance and a fall in extensibility until a GOX concentration of 5 ,000 u/kg flour. This is in accordance with the optimal dosage seen in the SH/SS assay. At higher dosages the doughs are relaxed owing to decreasing resistance and increasing extensibility. Baking trials (figure 3) in Danish rolls confirm the effect seen in both the SH/SS assay and in the extensograph measurements. The use of GOX leads to a pronounced strengthening effect in the final roll. As expected, POD (table 2 and figure 6) has only a small effect on the thiol groups only at 50,000 U/kg flour. Surprisingly, the SS concentration decreases as a function of increasing POD dosage. This does not correlate with a higher SH level. We had expected to see a strengthening effect as a result of POD cross-linking ferulic 2 acid on the arabinoxylan fraction or tyrosine9• The extensograph measurements (table 2 and figure 7) show that only the highest dosage of POD at 50,000 U/kg flour seems to influence the dough properties. The decreasing resistance and the increasing extensibility at 50,000 U/kg flour have a negative effect on dough. Extensograph index D is 0.7, which means that the dough is very relaxed. The relaxing effect of POD was confirmed by baking trials (figure 3). The combination tests involving GOX and POD (table 3) were made in the hope of seeing POD utilising the H202 formed by GOX. Almost no effect was seen neither in the SH/SS assay nor in the extensograph measurements. Only when the dosage was (GOX/POD) 1 00012500 U/kg flour a small decrease in thiol group content and a small strengthening effect in index D on the extensograph. This effect can be accounted for by the GOX contribution. This study was primarily done to analyse the effects of oxidative enzymes on the proteins in flour. Naturally, it is also necessary to study the effects on carbohydrates in the flour, to get a total picture of the effect of oxidative enzymes.
4. Conclusion
A dough model system working on a small scale (2 g flour) has been constructed. The method can be used to measure the effect of oxidative enzymes influencing the SH/SS
367
Non-Starch Polysaccharides and Enzymic Improvement of Bread Quality
groups in wheat dough without performing rheological tests. It is very useful because it detects SH groups on both soluble and insoluble proteins . . When assaying without denaturing agents, we get an expression for the rheological active SH groups which
are
of particular interest in a dough system. The method was evaluated by testing GOX and POD. Regarding the enzymes influencing the SH/SS groups there was correlation between this method and both the extensograph measurements and the baking trials. The SH/SS assay gives an indication of the reaction mechanisms of an oxidative enzyme in
a dough system. If one wishes to be able to measure the activity of all kinds of oxidative enzymes, it is necessary to measure the effect on the other components in the dough, carbohydrates etc . For further studies it could be interesting to make a dough model system measuring the cross-linking of arabinoxylan .
References 1) 2) 3) 4) 5)
Grant, D. R. Cereal Chem. , 1974,
5 1 , 684.
Kieffer, R. et al. Z. Lebensm. Unters. Forsch. , 198 1 ,
173, 376. 70 ( 1 ) , 22. Ellman, G.L. Arch. qf Biochem Biophys. , 1958, 74, 443 .
Chan , K. and Wasserman , B.P. Cereal Chem. , 1993
,
Approved Methods of the American Association of Cereal Chemists Vol.
2 Ninth
Edition . Method 54-2 1 1994 .
6) Thannhauser, T. W. et al. Methods Enzymol. , 1987, Vol. 143, 1 15 . 7 ) Tsen, C . C . and Bushuk, W . Cereal Chem . , 1968, 45, 58. 8) Bloksma, A . H . 'Wheat Chemistry and Technology ' , American Association of Cereal Chemists, Incorporated St. Paul , Minnesota, Edited by Y. Pomeranz. Second edition 1978. Vol 3, Chapter 1 1 , p. 532. 9) Aeschbach , R. et al . Biochim. Biophys. Acta. , 1976, 439, 292.
ARABINOXYLAN IN WHEAT FLOUR MILLING FRACTIONS
R. Andersson and P. Arnan Department of Food Science Swedish University of Agricultural Sciences P.O. Box 705 1 S-750 07 Uppsala Sweden I INTRODUCTION A modern industrial scale roller mill, designed to produce white flour, provides several fractions originating from different parts of the wheat kernel. These fractions are blended in varying proportions in order to gain wheat flour of a specified quality. Arabinoxylan is the most abundant non-starch polysaccharide in white flour. It consists of a backbone of ( 1 �)-linked �-D-xylopyranose residues that mainly are substituted with terminal a-L-arabinofuranose residues at position 0-3 or at both 0-2 and 0-3 1 • Characterisation o f arabinoxylans extracted with hot water from several wheat samples have revealed variations in the contents of differently linked xylose residues2. Recently, saturated barium hydroxide have been used as a selective and efficient solvent for water unextractable arabinoxylan of wheat3.
Figure 1 Total content of xylose residues in wheatflour milling fractions (% of dry fraction)
Non-Starch Polysaccharides and Enzymic Improvement ofBread Quality
369
In this study, wheat flour milling fractions were extracted with saturated barium hydroxide in order to try to get a high arabinoxylan yield and reveal variations in arabinoxylan structure within the kernel.
2 EXPERIMENTAL Samples of eleven wheat flour milling streams were collected from the industrial scale roller at Nord Mills AB, Uppsala, Sweden. Four break flours (B2, B3, B4 and B5), six reduction flours (CIA, C9, CW, C l l , C12 and C13) and flour from a bran ftnisher (DivBr3) were selected to represent different parts of the kernel, ranging from inner endosperm to aleurone layer. Total non-starch polysaccharide residue contents were analysed by the Uppsala method4• The flours were extracted with saturated aqueous barium hydroxide followed by neutralisation, treatment of soluble part with amyloglucosidase and precipitation in 70 % ethanol. The arabinoxylan containing precipitates were then analysed by lH-NMR and sugar analysis in order to quantify the contents of differently linked xylose. residues within the 4-linked polysaccharide backbone; un- (uXyl), mono- (mXyl) or di-substituted (dXyl) with arabinose residues as side chains5. mill
3 RESULTS AND DISCUSSION Total content of xylose residues in the milling fractions ranged from 0.6 to 3.5 %. Fractions originating from the inner part of the kernel (CIA and B2-B4) had lower contents of xylose residues than those fractions containing more peripheral parts (Figure 1). Ba(OHh-extractable xylose residues varied between 0.6 and 1.8 %. The recovery of xylose residues in these extracts were high (82-99 %) for inner endosperm flour fractions • uXyl 0 mXyl � dXyl
�
� I/)
�
0.8 0.6
� 0.4 Q)
:g
>. x 0.2
o
Figure 2 Content ofdifferently linked xylose residues. extractable with saturated barium hydroxide (% of dry fraction)
370
Wheat Structure. Biochemistry and Functionality
70 60 uXyI (r = -0.97)
� 50
"'ij)
!;. (J)
40
Q)
30
�
20
Q) ::J "0 'en ....
Q) (J)
X
�� o
10
mXyI (r = 0.98) dX� (r = -o.93)
0 0
2
3
4
Ash (%) Figure 3 Correlations between relative composition ofxylose residues and ash content
and lower (43-68 %) for flour from the outer endosperm. The proportions of un-, mono and di-substituted xylose residues varied between the flours studied (Figure 2). Flours from the inner parts of the endosperm contained more dXyl than rnXyl while the opposite proportions were found in the outer endosperm. Strong correlations were found between ash content and relative amounts of differently linked xylose residues (Figure 3). These relations may be generated by varying proportions of aleurone cell walls in the milling fractions. Results indicate that an arabinoxylan with a relatively high proportion of mono-substituted xylose residues are present in the same botanical tissue as ash. References
1 . A . S. Perlin, Cereal Chern., 195 1, 28, 382. 2. R. Andersson, E. Westerlund and P. Aman, 1. Cereal Sci., 1994, 19, 77. 3. H. Gruppen, R. J. Hamer and A. G. J. Voragen, 1. Cereal Sci. , 199 1 , 13, 275. 4. O. Theander, P. Aman, E. Westerlund, R. Andersson and D. Pettersson, 'AOAC method 994. 1 3., Official Methods of Analysis', 1995, 16th edition 1 st supplement. 5. S. Bengtsson, R. Andersson, E. Westerlund and P. Aman, 1. Sci. Food Agric. , 1992, 58, 33 1 .
WHEAT DOUGH PROPERTIES AFFECTED BY ADDITIVES
E. Torok University of Horticulture and Food Industry Faculty of Food Industry Szeged H-6724 Szeged, Mars ter 7, Hungary 1 . INTRODUCTION Fibre content is a qualifying factor from the point of view of biological value of baked products, but highfibre foods often have disadvantageous properties and appeal. Oilseeds are also very popular in baking industry for improving the sensory properties and the nutritional value of products, and to widen the variety of them. The aim of this work was to investigate the effect of cereal brans and oilseeds blended to wheat flour on the rheological properties of the dough and on the quality of bread. 2. EXPERIMENTAL
The effect of different quantity of wheat bran and oat bran flour (3 %, 5 %, 7 % on flour basis), as well as sunflower seed and linseed (4 %, 6 %, 8 % on flour basis) on the properties of dough and of the products was characterized by the next methods:
2.1 Rheological Investigations The functionality of additives was investigated according to the method ofWutzel and Wutzel 1 988 1 by valorigraph. Doughs containing a given quantity of additives were prepared with different dough moisture: according to the water absorption capacity, than with difference of plus and minus water addition. The angular elevation of the regression line of the relation of dough moisture versus dough stability characterizes the effect of the additives on the strength of the gluten of dough. The water absorption and the dough stability were determined by valorigraph test according to the Hungarian Standard 6369/6-73 2. (Note: the shape and evaluation of the valorigraph curve is similar to that of the farinograph.)
2.2 Baking Test 7 13
Baking tests were made and evaluated according to the Hungarian Standard 6369/8-
Wheat Structure. Biochemistry and Functionality
372
3 . RESULTS AND DISCUSSION The slope of regression line of dough moisture versus dough stability concerning the control flour characterizes the original strength of the wheat gluten. Replacing wheat flour with wheat bran the slope of regression lines were practically unchanged in case of 3 % and 5 % replacement. That means, that the strength of gluten network remains similar to the control dough at this concentration level. The addition of 7 % wheat bran decreases the slope a little, because of weakening the gluten (Figure 1). dough stability
5
Equation of regression lines Y = aX + b
.
L><- ;'
3,5 H----;-----;-."j·r :
2
.l:' � '
: ••:" : .•.)
,
f
:
' }�:�
62
68
,
-
, :... ' -. . f---+--rl
dough moisture
Y
=
Y
=
Y
=
y
=
0.25 X - 1 3 . 65 control
0.25 X - 1 3 . 70 3 % wheat bran 0.25 X - 1 3 .40 5 % wheat bran 0.23 X - 12. 1 1 7 % wheat bran
74
Figure 1 Regression lines of dough moisture versus dough stability affected by
different quantity of wheat bran The replace of wheat flour with oat bran flour decreases the slope of regression lines of dough moisture versus dough stability. As the slope is a function of the properties of the blends depending on the effect on the wheat gluten, the decrease of it indicates a negative influence. Consequently, oat bran as "non wheat dough component" dilute the gluten network, resulting in weaker dough forming properties (Figure 2). The addition of oilseeds to wheat flour decreases the angular coefficient, that means oilseeds, as "non wheat dough components", dilute and brake the gluten network of the dough. The angular coefficient a 0,948 (control) decreases to a 0,286 (6 % linseed) (Figure 3). =
=
The addition of 3 %, 5 % and 7 % wheat bran to the dough decreases the volume of baking tests especially above 5 %. The crumb becomes more and more compact, the porosity is uneven, and at 7 % the lower crust is discontinuous. The addition of 3 %, 5 % and 7 % oat bran flour to the dough decreases gradually and only slightly the volume of baking tests. The porosity of crumb is relatively uniform (Figure 4).
Non-Starch Polysaccharides and Enzymic Improvement of Bread Quality
dou�h stability 5
373
Equation of regression lines Y = aX + b Y = 0.25 X - 1 3 .65 control Y = 0.24 X 1 3 .06 3 % oat bran fl. -
Y = 0.23 X - 1 1 .95 5 % oat bran fl. Y = 0.22 X - 1 1 . 5 1 7 % oat bran fl . 2
74 68 dough moisture
62
Figure 2 Regression lines ofdough moisture versus dough stability affedted by different quantity of oat branflour
dough stability 7,5 : :.m.'. m "
. ..... _..
.....-........_--
. .�.�..� .__
� I
_'
�
-..-..-t.---·)-:.�-�� · ��· � � :>D " l
...
..
Equation of regression lines Y = aX + b Y = 0,948 X 60,78 control -
Y = 0,562 X - 3 1 ,96 4 % linseed
4 :
-
Y = 0,468 X 26,94 4 % sunfl. seed . . . . . '*.. . . . . Y = 0,375 X 2 1 ,7 1 6 % sunfl.seed -
61
67 71 dough moisture
x----
----
Y = 0,286 X - 13,45 6 % linseed
-1-'-'-1-'
-it----9-
Figure 3 Regression lines of dough moisture versus dough stability affected by different quantity of oi/seeds
Wheat Structure. Biochemistry and Functionality
374
"'E
"'E
,£.
,£.
Q)
Q)
E
E
::J
::J
'0
'0
>
>
o
3
0
7
5
wheat bran
(%)
3
7
5
oat bran flour
(%)
Figure 4 The effect of adding wheat bran and oat branflour on the volume of baking tests
"'E
�
,£.
,£.
Q)
Q)
E
E
::J
::J
'0
'0
>
>
o
4
6
sunflower seed
8
(%)
o
4
linseed
(%)
6
Figure 5 The effect ofadding sunflower seed and linseed on the volume of baking tests
Non-Starch Polysaccharides and Enzymic Improvement of Bread Quality The addition of 4
375
%, 6 % and 8 % sunflower seed to the dough decreased gradually
the volume of baking tests. The seeds dilute the gluten and break the structure of it resulting in less gas retention ability and volume comparing to the control. There are big pores around the seeds, the texture of crumb is uneven.
The addition of 4 %, and 6 % linseed to the dough produced more pronounced decrease in the volume of baking tests. Because of the grains of the linseed are smaller
than that of the sunflower seed, in the same weight % there are more seed. Consequently, the gluten structure is more interrupted, the gas retention ability and volume is poorer, the porosity of the crumb is more uneven comparing to the baking tests made with sunflower seed (Figure 5).
4. CONCLUSION
As it was shown, most of the investigated additives have an unfavourable effect on the structure of gluten network, on thc volume and porosity of baking tests, and on the texture of bread crumb. The "non wheat dough components" such as oilseeds and oat bran, dilute the gluten and interrupt the structure of dough resulting in less gas retention ability and poorer volume comparing to the control samples. But by means of the rheological methods which was shown above, we can find optimum concentration ranges or combinations of these additives and dough improvers in the industrial practice. On the other hand, the sensory properties of such baked products containing these additives are well accepted, and their biological value due to the increase of unsaturated fatty acids and dietary fibre content has improved.
References H. 1. G. Wutzel and W. F. Wutzel, "Functional Properties of Food Proteins" Ed.: R. Usztity, METE, Budapest, 1988, p. 1 54. 2. Hungarian Standard 6369/6-73. 3. Hungarian Standard 6369/8-71 .
1.
Subject Index
Arabinoxylan dough properties and baking performance, 37 1 -375 flour milling fractions, 368-370 Bread bread making quality and emulsifiers, DATEM, 279-285 bread making quality of durum wheat, 160-166 effect of bran on bread making quality, 37 1 -375 gliadins and bread making quality, 1 73-179, 1 80- 1 83 glutenin polymer properties and bread making quality, 1 46- 1 52 high Mr glutenin subunits and bread making quality, quality relationships, 1 22- 1 23, 1 25- 1 26, 146- 1 52, 160- 1 66, 173-1 79, 1 801 83 improvement by oxido-reductases, 350-360, 361 -367 improvement by xylanases, 343-349 improver mix, 286-292 lipids and lipid-binding proteins, 245260 low Mr glutenin subunits and bread making quality, 1 25- 1 26 rheological assessment of bread making quality, 309, 3 1 6, 323 use of transgenic wheats to characterise determinants of bread making quality, 1 99, 206 Dough Alveograph measurements, 1 53, 3 1 6 microstructure, 332-334 quality assessment through dough rheology, 309, 3 1 6, 323
rheological characterisation, 295-308, 3 1 6-322 rheology and gas cell stability, 3093 1 5, 3 1 6-322 strain hardening and gas cell wall failure, 3 1 6-322 Durum wheat, 1 53- 1 58 bread making quality and gluten proteins, 1 60- 1 66 translocation lines, l BUIRS, in T. durum, 1 53-158 Emulsifiers bread improver, 286-292 bread making quality, 279-285 DATEM, 279-285 Glutathione effect of dough mixing, 227-230, 235240 flour, 224, 225-227, 235-240 measurement, 22 1 , 235 protein bound, 221 -232, 235-240 rheological effects, 240-24 1 Gluten, 1 06 (see also Proteins) genetic engineering, 1 99 relationships with bread making quality in durum wheat, 1 60- 166 rheology during baking, 1 06- 1 1 1 Grain fracture characteristics, 3 1 -35 macrostructure and properties, 19, 25 image analysis, 1 9-20 mechanical/fracture properties, 25-30 quality relationships, 20-23 sprouted grain/alpha-amylase, 22-23 protein synthesis and deposition, 44-49 quality relationships, 3 1 -35 sample preparation methods, 37-43 Triticum durum, 1 46, 1 53, 1 60
378
Wheat Structure. Biochemistry and Functionality
Grain (continued) Triticum tauschii, 1 39 Tritordeum, 1 67- 1 72 ultrastructure and properties, 3 1 , 37, 44 environmental effects, 44-49
conformational stability, 1 1 9- 1 2 1 , 136 glycosylation, 74-77, 79-83 protein engineering, 2 1 1 , 2 1 6 quality relationships, 1 22- 1 23 , 1 251 26, 1 46- 1 52, 1 60- 1 66, 1 731 79, 1 80- 1 83 transgenic wheats, 1 99, 206 Triticum tauschii, 1 39- 1 45 Tritordeum, 1 67- 1 72 lipid binding, 249 lipid transfer proteins (LTP), 249 low Mr glutenin subunits, 79, 85, 1 1 7 glycosylation, 79-83 mutated gliadins, 1 23- 1 24 protein engineering, 1 99 quality relationships, 1 25- 1 26 Triticum tauschii, 1 39- 1 45 Tritordeum, 1 67 - 1 72 molecular biology, 1 99 pathogenesis-related, 1 84 puroindolines, 250 relationships with bread making quality in durum wheat, 1 60- 1 66 structure, 53, 63, 70, 74, 79, 85, 90, 1 17 cysteine residues, 1 17- 1 22 domain structure, 53-60, 1 1 7- 1 22 primary and secondary, 53-60, 1 1 71 22 �-tums and �-spiral. 55-60 Triticum tauschii, 1 39- 1 45 Tritordeum, 1 67- 1 72
Lipids and lipid-binding proteins, 245260 emulsifiers in bread making, 279-285 foam stability, 245-260 functionality, 245-260 glycolipids, 27 1 -278 monoclonal antibodies, 27 1 -278 starch, 26 1 -270 Mixograph, 1 46 Pasta, 1 46 Proteins anti-fungal, 1 84 capillary electrophoretic analysis, 1 28133 cysteine and glutathione mixed disulphides, 221 -233, 235-24 1 fractionation and analysis, 90, 1 1 2, 1 28 genetic engineering of gluten proteins, 1 99 gliadins, 57-60, 63 capillary electrophoretic analysis, 1 28- 1 3 1 disulphide structure, 63-69 dot-blot assay for in gluten-free dietary products, 1 89 protein engineering and expression in E. coli, 2 1 5 quality relationships, 1 73 - 1 79, 1 801 83 glutenin polymers, 90 composition, 92 dough mixing changes, 96-98 fractionation, 90-92 heat effects, 1 02- 1 04 rheological properties, 95, 99- 1 05 quality relationships, 1 46- 1 52 structure, 93-95 high Mr glutenin subunits, 54-60, 7073, 74, 79� 92, 1 1 7, 146- 1 52 capillary electrophoretic analysis, 1 3 1 - 1 32
Quality, 1 - 1 5 assessment methods, 1 -9 emulsifier effects, 279-285 environmental effects, 1 1 - 1 3 gliadin relationships, 1 73- 1 79, 1 80- 1 83 glutenin polymer property relationships, 1 46- 1 52 high Mr glutenin subunit relationships, 1 22- 1 23, 1 25- 1 26, 1 46- 1 52, 1 601 66, 1 73 - 1 79, 1 80- 1 83 improvement through genetic engineering, 1 99 improver, 286-292 lipids and lipid-binding proteins, 245260, 286-292
Subject Index
Quality (continued) low Mr subunit relationships, 1 17, 1251 26, 146- 1 52 malting and brewing, 192 modelling and prediction, 1 3 rheological assessment, 3 16-322, 32333 1 , 336-338 storage protein alleles, 9- 1 3, 1 17- 1 27 translocation lines, l BUIRS, in T. durum, 1 53-158 Rheology biscuit dough, 336-338 dough rheological characterisation, 295, 309, 3 1 6, 323, 336 dough rheology and gas cell stability, 309-3 1 5
379
enzymes and dough rheology, 361 -367 glutathione and dough rheology, 240241 gluten effect of xylanases, 347 quality assessment through dough rheology, 309, 3 16, 323, 336 rheological properties, 95, 99- 105 rheology during baking, 106- 1 1 1 Starch, 261 -270 isolation, 262 lipids, 26 1 -263 physical properties, 263-265 structure, 265-268 Transgenic wheats, 199, 206