PROTO SOCIOLOGY An International Journal of Interdisciplinary Research VOL. 8/9, 1996 RATIONALITY II & III Content INTERPRETATION, INTENTIONS AND PROPOSITIONAL ATTITUDES David K. Henderson Epistemic Rationality, Epistemic Motivation, and Interpretive Charity
4
Roger F. Gibson Stich on Intentionality and Rationality
31
Alfred Mele Rational Intentions and the Toxin Puzzle
41
John Heil The Propositional Attitudes
56
Volkmar Taube Exemplifikatorische Darstellung: Zu den Grundlagen einer kognitiven Ästhetik
72
NATURALIZED EPISTEMOLOGY, RATIONALITY AND NORMATIVITY Paul K. Moser, David Yandell Against Naturalizing Rationality
86
Harvey Siegel Naturalism, Instrumental Rationality and the Normativity of Epistemology
103
Ralf Naumann Internal Realism, Rationality and Dynamic Semantics
118
Axel Wüstehube Noch einmal: Rationalität und Normativität
158
RATIONAL EXPLANATION, REASONING AND JUSTIFICATION Philip Pettit Three Aspects of Rational Explanation
181
Keith Lehrer Rationality and Trustworthiness
195
Alexander Ulfig Stufen der Rechtfertigung
210
CONCEPTS OF PRACTICAL RATIONALITY Peter A. French Rationality and Ethics
226
Pierre Kerszberg Feeling and Coercion: Kant and the Deduction of Right
240
Raymound Boudon 255 Une éthique est-elle possible en l’absence de croyances dogmatiques? Raimo Tuomela Rational Cooperation and Collective Goals
280
Wolfgang Welsch Vernunft heute
315
REVIEWS Axel Wüstehube (Hrsg.), Pragmatische Rationalitätstheorien. Studies in Pragmatism, Idealism and Philosophy of Mind
357
(Andreas Vieth) Martina Herrmann, Identität und Moral. Zur Zuständigkeit von Personen für ihre Vergangenheit
352
(Michael Quante) Wulf Kellerwessel, Referenztheorien in der analytischen Philosophie (Achim Berndzen)
358
John McDowell, Mind and World (Wolf-Jürgen Cramm)
365
Peter Clark & Bob Hale (eds.), Reading Putnam; Christopher S. Hill (ed.), The Philosophy of Hilary Putnam (Michael Quante)
373
Wolfgang J. Mommsen, Bürgerliche Kultur und künstlerische Avantgarde 1870-1918. Kultur und Politik im Kaiserreich
379
(Peter Hoeres) Wolfgang Ludwig Schneider, Die Beobachtung von Kommunikation. Zur kommunikativen Konstruktion sozialen Handelns (Hubert Knoblauch)
385
Bernhard Waldenfels, Antwortregister (Toni Tholen)
390
STATE OF THE ART Marcus Birke Externalismus in der Philosophie des Geistes
398
SCIENCE AND HISTORY Joseph Agassi Die gegenwärtige Rolle des Technik- und Wissenschaftshistorikers
416
AUTHORS
435
IMPRESSUM
437
BOOKPUBLIKATIONS WITHIN THE PROJECT
438
4
INTERPRETATION, INTENTIONS AND PROPOSITIONAL ATTITUDES
David K. Henderson Epistemic Rationality, Epistemic Motivation, and Interpretive Charity
abstract On what has become the received view of the principle of charity, it is a fundamental methodological constraint on interpretation that we find peoples’ intentional states patterned in ways that are characterized by norms of rationality. This recommended use of normative principles of rationality to inform intentional description is epistemically unmotivated. To say that the received view lacks epistemic motivation is to say that to interpret as it recommends would be epistemically irresponsible ans, in important respects irrational. On the alternative that I recommend, descriptive psychological generalization are what properly inform interpretation. One can readily understand the epistemic motivations for so interpreting, for they are the familiar reasons for informing description with background descriptive information. No parallel motivations for the received view seems possible.
I. Overview In part as the result of Davidson’s influential writings, it is common to read that interpretative understanding is subject to a fundamental methodological constraint, the principle of charity in interpretation, according to which we must so interpret as to find people holding true and rational beliefs, so far as possible. Of course, we will find ourselves attributing isolated false beliefs and sporadic instances of irrationality. But, it is insisted, it is the indispensable mark of good interpretation that it keeps this to a very significant minimum. Accordingly we are supposedly a priori assured that people will turn out to be
5 correct in most of their beliefs about any subject (Davidson 1984b, p. 168) and that their beliefs will be predominantly rational (Davidson, 1984b, p. 159; 1980b, pp. 6-7; 1980a, pp. 236-7). Finally, it is insisted that this robust charitable constraint is a fundamental or “basic methodological constraint” on interpretation (Davidson 1984b, pp. 159, 169; 1980b, pp. 6-7). It does not exaggerate the influence of this Davidsonian view of the (charitable) constraints on interpretation to label it the received view. The central elements of the received view that will concern me here may be summarized in the claim that it is a fundamental methodological constraint on interpretation that we look for, and find peoples’ intentional states (and actions) patterned in ways that are characterized by norms of rationality-ways that are predominantly rational. In what follows I argue that the recommended use of normative principles of rationality to inform intentional description is epistemically unmotivated - no reason has been given for thinking that it furthers our epistemic endeavor. Insofar as epistemic rationality is a matter of employing methods or cognitive practices that are well-designed for pursuit of that classical epistemic value, systematic sets of true beliefs, to say that the received view lacks epistemic motivation is to say that to interpret as it recommends would be epistemically irresponsible and, in important respects, irrational. As an alternative, I advocate what I have called the principle of explicability, according to which we must so interpret as to find people holding explicable beliefs, so far as possible. On this alternative, principles of rationality, qua normative principles, play no proper role
in
informing
interpretation;1
rather,
descriptive
psychological
generalizations are what properly inform interpretation. One can readily understand the epistemic motivations for so interpreting, as they are the familiar reasons for informing description with background descriptive information. Before launching into the arguments of this paper, I want to quickly explain the notion of epistemic rationality that serves as its background. The crux of epistemic rationality is conscientious, responsible, pursuit of our epistemic ends. In particular, it is a matter of employing means (that is methods or cognitive processes) that are conducive to our central epistemic end of arriving at a true and systematic understanding of the world.2 Put simply, it is a matter of using truth-conducive cognitive processes to generate and maintain our set of
6 beliefs. This rudimentary understanding of epistemic responsibility, and thus rationality, can be elaborated into notions of subjective and objective epistemic rationality (Pollack 1987, Henderson 1995). We can say that someone is objectively epistemically rational in holding some belief to the extent that the cognitive processes through which it is generated or sustained are truthconducive. Of course, this is the basic notion of epistemic rationality that has come to be the focus in much naturalized epistemology. We can also say that someone is subjectively rational in holding some belief to the extent that their generating or sustaining cognitive processes are ones that seem truth-conducive, given what the agent believes and given that the agent conscientiously or reflectively seeks to employ truth-conducive processes. Subjective rationality is a matter of the agent doing a conscientious, careful, and reflective job, working with their norms and what they believe - seeking to approximate being objectively rational so far as they can. A subjectively rational person will concern themselves with the epistemic motivations for the articulable procedures that they employ. Since epistemic motivations will have to do with conduciveness to the realization of epistemic values, the subjectively rational person will concern themselves with the truth-conduciveness of their procedures. Thus, to employ a procedure that is not truth-conducive is to be objectively irrational. To employ a procedure without concern for its truthconduciveness is to be subjectively irrational. It is my contention that (even after searching) we have no reason to believe that the received view formulates an objectively rational procedure. Further, there are alternative procedures that we have reason to believe are objectively rational. Accordingly, to translate just as recommended in the received view would be at least subjectively irrational, and it is probably objectively irrational. II. The central problem: epistemic motivation To begin to appreciate what is problematic about the received view of interpretation and the principle of charity, note that, on that view, interpretive practice (and thus intentional description) is sui generus. In other contexts, descriptions are informed by general information regarding how the relevant
7 sorts of events and processes do occur, how the relevant processes do tend to evolve or develop. Thus, for example, everyday and sophisticated treatments of physical processes are informed by general expectations regarding such factual matters as the lawlike relations between force and acceleration. “He didn’t just fall; he was pushed or bumped,” we might justifiably exclaim, provided we observe the one child’s sudden acceleration, even when we were shielded from viewing any physical contact between two children. Such a description is a particularly simple variant on our use of ‘f=ma’ to determine the force acting on an object by examining its acceleration.3 In contrast, on the received view, our intentional descriptions are informed by a different sort of “information” with no parallel in other descriptive contexts: by our understanding of how such psychological phenomena should proceed. Our intentional descriptions must allow us to find conformity with the (or our best) norms of rationality. Root forcefully expresses the received view regarding the special role of normative principles of rationality in interpretation: The norms or principles that guide interpretation are the norms of rationality. The thoughts that the interpreter attributes to the agent to explain her action must rationalize them. ... Minds are for the most part rational because we cannot but understand them as so (1986, p.277). McDowell (1985, p. 389), speaks of the “ideal status of the constitutive concept [of rationality]” for “the concepts of the propositional attitudes.” Interpretive understanding thus comes to seem fundamentally different from other descriptive endeavors. The point can be put in terms of the venerable debate between methodological naturalists and separatists. Methodological naturalists hold that the logic or fundamental epistemology of description and explanation in the human sciences is the same as that of the natural sciences. Methodological separatists hold that the fundamental epistemology of the human sciences is crucially different from that of other sciences. The received view is a separatist doctrine holding that interpretive understanding is constrained by normative principles, qua normative principles, in a way that has no parallel in descriptions within disciplines outside the human sciences. Borrowing Davidson’s terms, the received view holds that normative standards of
8 “coherence, rationality, and consistency” serve as a constraint on interpretation in a fashion that has “no echo in physical theory” (1980a, p. 231). What makes this variant of methodological separatism problematic (indeed what makes methodological separatism generally problematic) is the relative infirmity of its epistemological motivations. To appreciate what is at issue, let us look further at the epistemological motivations for the typical scientific use of general descriptive background knowledge to inform our descriptions. My claim is that no parallel motivation can be provided for the use of normative principles constraining or informing interpretation. Consider a case of theory-informed description which is discussed in Shapere (1982). Suppose that a physicist is looking over a record of events in a certain particle detector and responds with a remark, “There were five highenergy, solar-neutrino events during this last period.” What informs this description? What general and specific descriptive information supports or informs it? In the case Shapere describes, 400,000 liters of dry-cleaning fluid (perchloroethylene) had been placed in a container deep in the earth (about one mile down a mineshaft). After a period, helium is bubbled through the fluid so as to remove any argon that had appeared in the tank in the intervening time. The accumulated gas is placed in a second container which is itself surrounded by a particle detector capable of registering positron emissions from the gas. The number of positron emissions is a function of the number of atoms of radioactive argon in this second container. In effect, the physicist is describing the positron events registered in the particle detector as effects of, and thus records of, high-energy, solar-neutrino events in the larger tank. This description is crucially informed by a very significant conjury of general information. One needs to know that high-energy neutrinos would interact with the chlorine in the large tank to produce the radioactive isotope of argon, while lower-energy neutrinos would not. One needs to have information regarding any other kinds of interactions that would produce radioactive argon in the perchloroethylene. And one must have information regarding the likelihood of those interactions that do not involve solar neutrinos occurring in a tank situated so deep in the earth, given the nature of the surrounding rock. Does the mile of earth shield the large container adequately from events that might produce a spurious neutrino event? One needs information
9 regarding the ways in which one can remove and collect the argon produced in the large tank (their efficiency, for example). One needs information regarding the positron detecting device (its sensitivity, and how easily it is fooled). (Of course, each of these issues could be decomposed further.) Such general (and particular) descriptive information helps us pin down the description of events in the tank by informing us of what could produce what they produced (radioactive argon, and eventually blips in the particle detector), and what couldn’t, or what is very unlikely to have produced what they produced. Such information also allows us to judge how well we are sampling from various processes of interest. (What is the likelihood of an given neutrino interacting with the perchloroethylene? What is the likelihood of neutrino’s at a given energy producing argon when interacting? What is the proportion of argon we can expect to extract from the tank by bubbling helium through it? What is the sensitivity of the detector?) This general background information allows us to guard against certain errors. For example, we can guard against mistaking pseudo-neutrino-events for neutrino-events by attending to whether the mile of earth is sufficient to shield the large tank from certain interactions that might mimic neutrino events and thus render the description ill-supported. The crucial point is that by helping us determine what could have happened, what could not have happened, and what is relatively unlikely, general background descriptive information allows us to appreciate what we might be observing, what we couldn’t be observing, and the relative likelihood of observing certain alternatives. It allows us to settle upon a description when we can determine that alternative descriptions are significantly less likely to be true. It prevents us from settling on a description when alternative descriptions are equally likely to be true. Information about how things always happen, or tend to happen, is thus quite relevant to the epistemic status of descriptions of particular events. That is, from the epistemic point of view, from the point of view of the pursuit of a true system of beliefs, one is well-advised to employ what descriptive information one has in the development of further descriptive information. One is well-advised to do so, because such information allows us to determine that we are employing reliable (or truth-conducive) means of belief-fixation - and that is the central epistemic concern. Thus, informing observation or description by general theory is epistemically well-motivated. In
10 effect, by leading us to truth-conducive methods, the general procedure of informing descriptions with background theory is itself a truth-conducive method. But, what can be the epistemic motivation for using normative standards to inform interpretive descriptions. How things generally do occur is relevant to determining how things have occurred in particular cases. However, what could be the relevance of ought to is - of how things ought to occur to how they have occurred? From the point of view of the pursuit of true systems of belief, why should one seek to find some process developing in normatively appropriate ways? Why should one impose one’s best standards of rationality on one’s description of a given person or people? We have seen that it is truthconducive (and thus epistemically well-motivated) to employ general descriptive information in coming to a description of a given event, process, or state. Now, we must address the question of why we should think that it is truth-conducive to employ one’s normative standards of rationality in coming to a description of a given intentional-psychological event, process, or state. III. Replies in terms of “conceptual truths” Attempting to show epistemic motivation, the proponent of the received view might suggest that it is a matter of “stipulation,” or whatever gives rise to “conceptual truths,” that beliefs and desires are predominantly rational. Were it somehow conceptually guaranteed that beliefs are preponderantly rational, then a fundamental principle of charity would not lead you away from the truth about such beliefs. Informing our interpretative descriptions with normative standards would be truth-conducive. On the face of it, such a response is congenial to Davidson’s formulation of the principle of charity as a matter of “stipulating a structure” to be imposed in interpretation (1980b, p. 6), and with McDowell’s and Root’s developments on Davidson’s (1980a, pp. 236-7) talk of “constitutive criteria.” However, the response is itself in need of interpretation, for there are several ways of understanding “conceptual matters.” Talk of “concepts” and of what is “conceptual” is not just vague, it is ambiguous. If we are to determine what to make of this “its-a-conceptualmatter” response, we must consider the main alternative disambiguations.
11 Classically conceived, concepts were supposed to be rather like defining descriptions that were associated with terms - they were the Fregean meanings. However, as Quine (1953) and Putnam (1975a), among others, taught us, definition (and analyticity) is greatly overworked in traditional epistemology. Principles that once seemed almost definitional commonly come to function as revisable empirical propositions (as reflected in Putnam’s short history [1975a] of the Newtonian principle, ‘e=1/2mv2' ). Conceptual truths should not be understood as analytic truths. Still, much talk of concepts can be reconstrued in a less problematic fashion as having to do with the most central components of our theories. (Several of Davidson’s discussions are naturally taken as pointing in this direction.) Concepts then are understood in terms of those central components of theory that we most resist revising. On this view, concepts are still rather like descriptive formulations associated with a terms. They are those components of descriptive theory that we would resist revising, favoring instead to revise claims that would unsettle less of the relevant theory. Interestingly, this notion of concepts makes conceptual matters into matters of the structure of theory at a time. On this understanding of “concepts,” to say that it is a conceptual truth that beliefs must be predominantly rational is to say that it is central to our best present theories that beliefs are related in certain ways that we also take to be normatively appropriate, and that these expected elements of rationality are enough to lead us to expect predominant rationality. This may well be true. However, it should give no comfort to proponents of the received view. For, if the charitable use of certain normative standards is to be motivated as a “conceptual matter” along these lines, the principle of charity becomes a derivative principle, not a fundamental principle: one is advised to interpret charitably on the basis of those central portions of psychological and sociological theory that describe general tendencies to forms of cognitive processing that (incidentally) conform to our normative standards.4 Further, on this view, the best pattern to impute in interpretation is not really derivable from normative considerations, but is tailored more finely according to background theory (a point developed in section v. below). This is to make charity in interpretation a species of theory-informed description. It can then
12 be epistemologically motivated along the lines sketched above for justifying theory-informed description. However, providing such an epistemological motivation comes at the expense of abandoning central planks of the received view: charitable interpretation is no longer understood as a fundamental methodological matter, nor is it understood as a matter of imposing a pattern derived from normative standards. Over the course of the last twenty years, a very different view of concepts has developed in association with discussions of reference and meaning by Kripke (1972), Putnam (1975b; 1989 ), and Burge (1979), among others. On this view, one is said to “have,” or to “have acquired,” a certain concept (say the concept of an elm) if one has come to be incorporated within a linguistic community to the point that, by a kind of reference borrowing, one can refer to the relevant class or individual (say the class of elm trees) when using the appropriate term (‘elm’, if the relevant community speaks English, ‘ulme’, if it speaks German, and so on). It is typically added that being incorporated within the linguistic community requires learning relatively little descriptive knowledge regarding the relevant class - certainly it does not require descriptions adequate to even roughly identifying members of that class. Just as meanings “are not in the head” on this view, so concepts are apparently not in the head. It is not easy to know what would count as a “conceptual matter” or a “conceptual truth” on this view. One thing does seem clear, if there are to be interesting conceptual truths, these cannot be propositions that one learns when acquiring a concept. For, on this view, one can acquire a concept while acquiring only very sparse descriptive information (and the information can vary radically across people sharing a given concept). For example, I might know only that poplars are trees that produce a wood sometimes sold in my local lumber yard. This hardly seems the basis for a useful notion of conceptual truths. One possibility, although not one salvaging or according at all well with much talk of “conceptual truths,” is to embrace the ontological flavor of much work on the causal theory of reference, with its talk of reference to natural kinds. We might then think of concepts as something that is individuated extensionally (Putnam 1989). and it would then seem natural to think of
13 “conceptual truths” as truths about the natures of the kinds that are the referents of the natural kind terms. I really do not think that this is a helpful account of “concepts” or “conceptual truths.”5 However, I need not pursue my reservations here. Rather, I note that such an approach makes conceptual truths (on the model of Kripke’s necessary truths) matters that we discover at the conclusion of successful scientific investigation, not what we can be guaranteed of a priori. As a result, our best present information about such conceptual truths comes by way of our best present theories. Accordingly, if we are seeking to have our descriptions be informed by conceptual truths, our best bet is to let them be informed by our best evolving theories. Accordingly, we at most suspect that it is a conceptual truth that beliefs are predominantly rational; and we are only entitled to this much if, according to our best present theory, beliefs are so rational. We are thus led to an epistemic motivation for thinking in terms of theory-laden description, not of normatively laden description. It is worth recognizing one final way of understanding talk of conceptual truths, one that does not turn on any implicit or explicit notion of concepts, but rather takes it cue from the idea that charity is a “methodological” matter of “stipulating” a structure to be imposed in interpretation. Talk of conceptual truths might be taken as a way of pointing to a particular understanding of the principle of charity as a brute methodological given: the imposition of normative patterns might be understood as a matter of practice (and not of theoretical claim) that is supposedly an analogue in the realm of practice to the classical notion of analytic truths. Rather than insisting that “this is just how we define the term,” talk of conceptual truth would be a way of saying that “this is just how we do it.” So understood, in talking of conceptual truths, proponents of the received view would be flatly asserting the received view, treating it as a matter of practice and not of theory, and insisting that what practice joins together, let no theory pull apart. There are two problems with this response to the challenge of providing epistemic motivations. First, this response amounts to a refusing to address the question of the epistemic motivations of the received view. It insists that imposing normative patterns is just what we do in interpreting, and does nothing to explain why it would be an epistemically good thing to do.6 But, as a general rule, as
14 responsible agents, we cannot simply engage in cognitive practices without attention to their truth-conducivity. There may be limits to the scope of the reflectiveness to be demanded here. For example, there seem to be limits to how far we can inquire into the epistemic virtuousness of particular rudimentary perceptual practices (Henderson 1994). But surely a general and articulable practice such as that of intentional interpretation is a suitable focus, warranting epistemic attention. Second, as explained below, and as developed elsewhere (Henderson 1987, 1993), there are reasons to believe that a fundamental principle of charity does not provide the best descriptive understanding of “what we do” in sophisticated interpretive practice. I think we should conclude that talk of “conceptual truths” regarding the rationality of beliefs cannot provide epistemic motivation for informing interpretation by normative standards. We will need to look elsewhere. What then can be done here that is parallel to what can be done to motivate theoryinformed descriptions? IV. The “believing is a normative stance” response In this section I continue to search through ways one might seek to motivate the received view without appealing to significant empirical theory. (There is a deep incompatibility in any attempt to provide a theory-based motivation for a basic methodological constraint to impute a pattern stipulated by normative considerations. In section v., I develop the case against such a vindication for the received view.) The most promising theory-independent line remaining open to proponents of the received view seems to begin with the recognition that having beliefs is, at least in paradigmatic cases, a project that is disciplined by norms - all believers have and seek to conform to some set of epistemic norms.7 All believers seek to be rational. This much can be granted, when the “observation” is unpacked as follows. All believers draw some distinction between what is the case and what only seems to be the case, recognizing that some beliefs formulate what is the case, and some formulate only what seems to be the case, and are thus false. Here we have the common basis for the concern for true beliefs. Having such a concern, all believers inherit and adopt
15 standards for stasis and change in belief - standards that are supposed to further the goal of holding systematic sets of true beliefs.8 These standards are their epistemic norms - for they are those norms directing the pursuit of epistemic ends. The claim that believers strive for epistemic rationality is the claim that believers have such norms. However, I question whether these observations provide an epistemic motivation for the received view. If, from the observation that all believers seek to be rational, we could conclude that believers are preponderantly rational, we would then be entitled to conclude that interpreting so as to find rationality is itself truth-conducive, and thus epistemically well-motivated.9 The difficulty of fleshing out the suggested motivation for the received view becomes clearer when we reflect on the distinction between objective and subjective rationality. Someone is subjectively rational if they consistently and conscientiously follow their own norms in revising and adding to their stock of beliefs. On the other hand, someone is objectively rational if they do a good job, given what are correct norms of rationality, and given their stock of beliefs as raw materials from which to begin inquiry. Epistemic norms are correct insofar as the cognitive processes they recommended are well-designed for our achievement of our epistemic goals (Kitcher 1993, Henderson 1994, 1995). Since our central epistemic goal is that of arriving at a true and systematic understanding of the world, epistemic norms are correct insofar as the processes that they mandate are truth-conducive for creatures like us in the world in which we find ourselves. Our best bet for what, in particular, makes for objective rationality is provided by our best epistemic norms. So, we really have three notions to consider here: subjective rationality, rationality by our present best norms, and objective rationality. The suggestion that all believers have norms of rationality which they seek to follow provides some support for the suggestion that people will be predominantly subjectively rational. However, to appreciate the limited nature of this support, distinguish two ways of understanding peoples’ standards. The normative principles that people sincerely espouse, or better, those principles that they would seek to follow in their most conscientious and reflective moments, constitute what we may call their “reflective norms.” Reflective norms may be differ significantly from what serves as the real cognitive
16 tendencies accounting for most of their beliefs, which may be termed their “psychological norms.” First, suppose that what counts as a person’s norms (for purposes of determining subjective rationality) are their reflective norms. This will be a matter of more or less articulate epistemological rules that they seek (or would seek) to implement. However, people may systematically fail to measure up to their own norms for several reasons. The norms may require a vigilance in application that is difficult to sustain in common contexts. For example, there is a good deal of evidence that people tend to readily generalize from salient cases without attention to just how representative the cases are. A person might “know better,” and actively seek to do better when on their best behavior, and yet generally not do better in the everyday contexts where most of their beliefs are generated. Perhaps the person could do somewhat better could apply their norm much more consistently - but simply do not put out anything like the sustained effort that is needed. People also may fail to measure up to their norms because those norms are simply intractable for human beings. For example, if one reflectively adopts a coherentist epistemology of the sort advocated by BonJour, then one will probably never really begin to measure up to one’s norms, as BonJour admits (1985, pp. 102, 151-3; Henderson 1994). Or, as Cherniak (1986) has argued, if one takes certain ideals of logic as your epistemic models, then a general application of one’s norms will be intractable for any physically realizable reasoner. Whether the general pursuit of rationality leads to a preponderance of subjective rationality will be a matter of whether the individual holds norms that are appropriate to human cognizers and on the extent to which the individual (can and does) implement them conscientiously in everyday as well as special contexts. Thus, even too expect general subjective rationality judged in terms of reflective norms, we need more than the recognition that people have and seek to apply epistemic norms; we need to have empirical information regarding these additional matters. Alternatively, we might take a person’s norms to be a matter of the person’s psychological norms. On this understanding, predominant subjective rationality seems assured, as the norms themselves are understood in terms of tendencies to those common practices.
17 However, this flaccid notion of subjective rationality has little relevance for our concerns here. Admittedly, we have here found a notion of rationality that is so deflated that (relying on no descriptive theory) we can know that people are predominantly so rational, given that they have norms of rationality. Accordingly, it would be truth-conducive to so interpret as to find people subjectively rational in this deflated sense - and thus we have epistemic motivation for so doing. However, friends of the received view will not take comfort in this, and should not, for this is not the sense in which they recommend that we find people rational. Crucially, the idea of “psychological norms” seems not to be a normative notion at all, and it is central to the received view that we are to impose normative standards in interpretation. Further, regardless of which notion of “norm” is employed, we can safely say that the received view employs some notions of rationality other than subjective rationality. Its proponents write of rationality (simpliciter), of rationality as common coin, of “the norms of rationality” guiding interpretation, and thus as something that we bring to the interpretation of others; thus they write of a single notion of rationality (not an indexed one) applying to us and to those who we interpret. We are enjoined to find either rationality-by-our-lights or objective rationality. However, since our standards are our best present understanding of what makes for objective rationality, it is difficult to discern just which of these remaining alternatives is central to the received view. Perhaps it is somewhat equivocal regarding these distinct recommendations: (1) we are to seek to find people conforming to our standards, in which case we would coincidentally view them as objectively rational (as best we can determine); or instead (2) we are to seek to find them objectively rational, in which case we are imposing our best norms on our interpretation because those norms are our best understanding of what that would make for objective rationality. We can consider each alternative in turn. Neither is satisfactorily motivated. For each alternative, Davidson has articulated the beginnings of an epistemic motivation. Developing on Quine’s work, he has emphasized the respects in which interpretation is holistic: it involves concurrently sorting out how to treat significant sets of sentences, their systematic components, the beliefs expressed, the desires expressed, and actions to which the beliefs and
18 desires give rise (Davidson 1980b, 1984a, and 1984b , for particularly striking presentations). To manage this, we must look for certain patterns in the relations between items of these sort. Finding these patterns instantiated is key to knowing that we have “gotten these things right,” and thus it constrains interpretation. The bottom line, then, is that we must impose some pattern on the beliefs, desires, and actions of our subjects as we interpret them. This gets us half of an account of the epistemic motivation for the received view. The crucial remainder of the story would explain why the pattern we impose should be that which the received view envisions. Now consider the suggestion that it is a fundamental element of our interpretive methodology to impose our standards on those we interpret. Suppose that the reason for doing so has little to do with those standards providing our best understanding of objective rationality, but instead has to do with those standards being ours. What is then necessary for motivating such a procedure is an explanation of why the pattern to be imposed in interpretation should be that stipulated by our best standards of rationality, qua our standards. To provide the needed epistemic motivation, proponents of the received view must provide reasons to believe that such a procedure is truthconducive. So far as I can see, there is no explanation to be given. The problem can be decomposed. To be sure, we have an epistemological need - to find some characteristic pattern in interpretation. But, to get to the conclusion that the friends of the received view need, they must make two further, problematic, claims: first, they must insist that the structure to be imputed in intentional interpretation “must derive ... from normative considerations” (Davidson, 1980b, p. 6); second they must insist that the normative considerations involved must be ours. Both claims are unmotivated. Consider the generic claim that the pattern to be imposed must derive from normative considerations. As should be clear from section II, this claim gives rise to the central puzzle of this paper. Now, one might attempt to found its epistemic motivation on the claim that the notion of rationality and the notion of believing are intimately related insofar as believing and acting are always informed by norms. But, as we saw in the preceding section, this is not enough to lead us to expect even subjective rationality - much less rationality by our standards or by the correct standards. In sum, then, there is yet no explanation
19 for why we might expect that imposing any one set of normative standards would be truth-conducive.10 For now, I simply want to note that this generic claim remains problematic, and that the present line of thought does not help to make it less so. I will refocus on this central generic claim in the next section. Before doing so, however, I want to consider a few points having to do with the more specific claims regarding the standards to be imposed. When we turn to the claim that the pattern to be imposed in interpretation is not just to be derived from some “normative considerations” or other, but must also be derived from our best standards - qua our standards, rather than qua our best bet regarding the correct standards - we find further reasons to despair of epistemic motivations. Why should we seek to find others reasoning according to our best epistemic norms? Why not some other set of norms? Why should the recognition that all believers have some epistemic norms that they seek to follow lead us to impose our norms in our interpretation of them? The proposed policy seems particularly unlikely to be truth-conducive when we recognize that epistemic norms have shown significant variation even within the western scientific tradition. The friend of the received view seems to have two lines of response available. One possible response is to say that we should use our best epistemic norms because they are the only norms we know. This would make some epistemic sense, for we can only work from what we know. But, the claim that our best epistemic standards are “the only norms we know,” or the only norms that we readily have access to, is false. The history of science reveals significant changes in epistemic norms. Scientific knowledge is no longer understood and lauded as deductively derivable consequences of putatively certain first principles, although this was central to the norms reflectively espoused by at least one great philosopher-scientist. We know of this norm even though it is not ours. Further, we can understand such alternative standards well enough to impose them in interpretation - should we want to.11
Indeed, historical and
anthropological study has led us to find norms significantly at odds with our best epistemological norms.12 So, we now have on hand a rich supply of pattern-stipulating normative considerations. Wouldn’t imposing a pattern stipulated by norms characteristic of analogous historical, technological, and cultural contexts be more truth-conducive?
20 It is worth emphasizing that, bracketing the objections just given, this “the only norms we know” response would still only have a force when supposing that interpretation involves the imposition of norms. In that that supposition remains unmotivated, the “only norms we know” observation would, at best, only show that imposing our norms provides the sole readily employable implementation of an, as yet, unmotivated general strategy. The second possible response open to proponents of the received view would be to insist that we should impose our best normative standards - qua our standards - because we can know a priori that others’ standards will be in significant agreement. Unfortunately, this seems to suppose just the interpretive policy whose epistemic motivation is at stake.13 Their reason for supposing that others’ standards and practices accord with our own is presumably grounded on the principle of charity - understood in terms of the received view. Lastly, we should consider the suggestion that interpretive methodology requires us to find others objectively rational (so far as we can judge, of course). This suggestion is reflected in Davidson’s remark that we get clearer on the proper constraints on interpretation as we refine and improve our epistemic standards (1980b, p. 7). Again, half of the epistemic motivation for this methodology derives from the need to impose a pattern in interpretation. But, why should the pattern be that stipulated by correct norms of rationality (which we then approximate, as best we can, by using our best norms of rationality)? I believe this policy is attractive for many because they see it as the most “natural” implementation of the insistence that the constraints on interpretation must derive from “normative considerations.” In effect, we have noted that the imposition of some particular set of norms held by some people (other than our subjects, who’s standards we do not yet know) seems arbitrary.14 The present suggestion might claim the virtue of minimizing arbitrariness. Imposing (so far as we can) those norms that all the particular peoples’ norms seek to approximate and model, seems to provide a relatively nonarbitrary way of imposing fundamental normatively informed patterns. Unfortunately, this amounts to a reasonable suggestion regarding how we might implement the as yet unmotivated general policy of imposing a pattern stipulated by normative considerations. Further, we must be careful of granting
21 to much at this point. While there may be a respect in which the advice to attribute the correct standards to others may seem relatively nonarbitrary relative to the advice to attribute just some folks’ standards (say ours) to others - the sense in which such a policy would be nonarbitrary has little to do with epistemic motivations.15 Our concern here should be with epistemic motivations and whether the policy under consideration is nonarbitrary from an epistemic point of view. To be epistemically nonarbitrary the policy must be, or must be believed to be, truth-conducive. A procedure is objectively nonarbitrary to the extent that it is more truth-conducive than rival procedures; and it is subjectively nonarbitrary to the extent that we have (on balance) reason to believe that it is so truth-conducive. The procedure of attributing conformity with the correct standards (so far as we know them) seems not to be nonarbitrary in either respect. Even while staying within the limits of imposing normatively derived patterns, we readily recognize alternatives that seem more truth-conducive. For example, we could impose a pattern stipulated by normative considerations that are characteristic of cultures that are similar to our subjects’ in historical, technological, and cultural respects. The discussion in this section has focused on variants of the general procedure of imposing a pattern derived from normative considerations. I have argued that the epistemic motivations for imposing either subjective rationality, rationality-by-our-best-standards, or rationality-by-the-correctstandards are each epistemically infirm. At least this is so, provided that those motivations would need to be independent of empirical theory of any significant sort, and would depend only on the simple “observation” that believing is a normative endeavor. (The significance of this proviso becomes clear in the following section.) The problems discussed here are two-fold: the rudimentary observation that believing is a normatively disciplined endeavor, and the recognition that interpretation is holistically constrained by the need to impute a patterned set of states, simply do not jointly yield reasons to think that any one of these particular variants are truth-conducive; and the general procedure that they instance remains problematic in its motivations. None of the particular policies seem to make such epistemic sense on their own that they can serve to motivate in turn the generic policy. If anything, the generic
22 policy would need to support them, as is entertained when it is suggested that a particular procedure is the only epistemically feasible implementation, or the least arbitrary implementation, of the generic policy. But, little has been found to provide epistemic motivation for the generic procedure itself. V. Why the generic received-view policy cannot be motivated It is now time to give a more sustained criticism of the generic procedure of imposing normatively derived patterns. To this point, I have argued (in section iii.) that the policy is not to be motivated by a “conceptual truth.” Further, I have argued (in section iv.) that no particular implementation of the generic procedure is epistemically motivated in its own right. Now, I want to go somewhat farther, and distill out of the above discussion a two-fold criticism of the generic procedure. First, we should recognize that there is an alternative to the general procedure that is both more truth-conducive and also more in keeping with actual interpretive practice. This alone should be decisive. Second, I want to develop and support an aspect of the discussion in the previous section: the suggestion that the generic policy would need to be motivated without the help of significant theory, if it is to be motivated at all. It is important to note that there are alternatives to the reliance on “normative considerations.” In particular, we might have expectations from descriptive psychology - expectations regarding forms of cognitive dynamics characteristic of humans. Some of these forms of cognition may happen to be more or less in accord with our epistemic standards, others may happen to be more or less out of step with those standards. This set of psychological expectations characterizes a pattern that we could look to find in interpretation. Indeed, it is the pattern that I believe we ought to impose in interpretation. Doing so would make interpretation a matter of revisable theory-laden description. As noted above, there is a familiar epistemic motivation for informing descriptions with background theoretical knowledge - there is reason to believe that such a policy is truth-conducive.16 So, my suggestion hooks up with the half-motivation provided by friends of the received view; it allows us to meet the epistemic need for imposing a pattern, and allows us to do so in an epistemically motivated manner. In contrast, the
23 general strategy of imposing a pattern that is derived from normative considerations seems to suffer from an infirmity of epistemic motivation. To insist on imposing a pattern derived from normative considerations when there is an epistemically motivated alternative on hand, would further deepen the epistemic irresponsibility of interpreting as the received view demands. This alternative to the received view does not entail a radically noncharitable interpretive procedure. Rather, it leads us to more or less charitable interpretation, depending on the substantive claims made in our best psychological theory. Thus, in conjunction with extant theory, it can provide an epistemologically superior understanding of charity in interpretation. Although Quine’s seminal discussions of the principle of charity are commonly cited by proponents of the received view, Quine actually advances something very close to this alternative understanding. Quine has repeatedly insisted that charity in translation is itself informed by, even derivative on, psychology (Quine 1970, 1986 for example; see also, Henderson 1988). He remarks: “The translator will depend early and late on psychological conjectures as to what the native is likely to believe” (Quine 1987, p. 7). Thinking along these lines, I have argued that, while the principle of charity has its place as a general rule of thumb that is particularly important in the early stages of interpretation; so understood, it is itself derivative from empirical psychology and a deeper principle that represents the fundamental constraint on interpretation (Henderson 1987; 1993, chpt. 3). The deeper principle is called the principle of explicability; it holds that we are so to interpret as to find people explicable in beliefs, desires, and actions. Because our psychological and social scientific theories do lead us to expect much cognitive processing that we would recognize as normatively appropriate, we can subsume what is right in the principle of charity under the principle of explicability. Further, this principle allows us to account for the commonly recognized refinements in the principle of charity. For example, it is commonly recognized that attributions of different sorts of errors vary in just how seriously they undermine interpretive understanding. Commonly, the explicability of the various types of error seems to determine the weighting, and thinking in terms of deriving the principle of charity and tailoring it to the principle of explicability allows us to understand why this should be so. Thus,
24 the principle of explicability allows us to accommodate the virtues of a sophisticated principle of charity by deriving that principle as a rule of thumb, and it does so without giving rise to the special epistemic mystery or lack of motivation that arises on the received view. I have so far focused on ways of epistemically motivating the imposition of normative standards without appealing to significant theory, and have given substantial reason for doubting that this can be done. But, it is important to see just what hangs on this. Proponents of the received view must provide a motivation without appealing to theory. According to the received view, the central constraint on interpretation is that we must impose a pattern derived from normative principles of rationality rather than from descriptive theory. Maintaining this tenant requires us to see the general policy of a charitable constraint on interpretation as methodologically basic in the sense that it is not in turn to be motivated by appealing to background theoretical expectations. For as soon as we recognize that the choice of the pattern to be found is informed by descriptive theory, normatively derived patterns seem at best approximations to what we should seek to find. After all, both folk theory and more sophisticated theory regarding the processes to which humans are inclined leads us to expect systematic deviations from what would be rational. That is, we expect certain forms of systematic irrationality. Noting our systematic foibles as well as our better tendencies, psychological theory leads us to expect a mixture of epistemic rationality and irrationality. Accordingly, were our choice of pattern to inform interpretation itself informed by descriptive theory regarding cognitive tendencies, were we to look for what is likely rather than what is unlikely to be observed, we would not look to impose a normatively characterized pattern in interpretation. We might look to find what amounts to significant and even preponderant rationality under interpretation, but this would be a by-product of our looking to find a descriptively-derived pattern; the pattern we employ would not be derived from normative consideration, and would differ from the pattern that would be derived from normative considerations. This transforms what we are doing into something quite foreign to the received view, and the pattern we employ is only approximated by that stipulated by normative considerations.
25 Having seen this, we can also see why any attempt to provide a theoreticaldescriptive epistemic motivation for the received view will be self-defeating. After all, as we have just noted, to impose a normatively derived pattern is to insist on finding our subjects evincing a pattern that we really do not expect. We expect a pattern that approximates rationality in certain respects, and systematically deviates from it in certain other respects; for such is the pattern of human tendencies. For reasons that should be clear from my discussion of the motivation for theory-ladening of description, it is most truth-conducive is to impose such a pattern in interpretation. Now, suppose that we to have theory-informed reasons for thinking that it is somewhat truth-conducive to impose a pattern that is characterized by normative principles. We have such reasons only if our theories lead us to expect a preponderance of rationality arising from the mix of human tendencies to rationality and irrationality. On the present supposition, we have what seems to be the basis for an epistemic motivation for the received view. However, this would prove a false hope. The envisioned epistemic motivation turns on our background theory telling us that human cognitive tendencies approximate our normative principles. However, the same theory would also gives us reasons for employing another, more truth-conducive procedure - namely that of seeking to find the pattern characterized by our descriptive theory. Foregoing this more truth-conducive procedure in favor of applying the normatively informed procedure is epistemically irresponsible. Once we have understood these arguments regarding why the proponent of the received view should not look for a theory informed vindication for the truth-conduciveness of imposing a normatively derived pattern in interpretation, and once we have recognized that there is an epistemically motivated alternative to the received view, we can also appreciate that the task of providing epistemic motivation for received-view interpretation is actually more difficult than has been supposed in much of my earlier discussion. Through much of the foregoing, I have supposed that it would be sufficient to provide reasons for believing that that policy was truth-conducive, considered by itself. It has proven difficult enough to provide such a motivation that does not appeal to significant theory. And we also find that allowing appeal to significant theory would not help. Rather, it would make matters worse, as any
26 such motivation we provide would be trumped by the same information sponsoring an alternative, theory-laden, form of interpretation as yet more truth-conducive. However, once we have seen this, we cannot simply retreat to the (not all too promising) project of providing theory-minimal reasons for thinking that the imposition of normatively derived patterns are truthconducive. We cannot simply do so, because now we appreciate that there is an alternative procedure which we have theory-informed reason to believe to be not just truth-conducive, but also more truth-conducive than the received view procedure. To provide a proper epistemic motivation for imposing a normatively-derived pattern, we must now clear a new hurdle: we must show that this received-view procedure is at least as truth-conducive as its alternatives. We really have no clue how, or what kind of, a prioristic reasons can overcome the theory-informed reasons for employing the alternative to the received view. VI. Taking stock A procedure is subjectively unmotivated when it has not been provided an epistemic justification, and particularly so when we have searched for a motivation and have found none. A procedure is objectively unmotivated when there is no correct motivation to be given - when the procedure is a relatively bad one from the point of view of our pursuit of systematic true beliefs. When a procedure is subjectively unmotivated even after a good faith effort to find a motivation, there is some reason to believe it is objectively motivated. This presumption can be reinforced by more positive arguments against the relative truth-conducivity of a given procedure. In section (ii), I set out those elements of the received view that give rise to a special need for epistemic motivation: it is a separatist doctrine insisting that we should inform interpretation by drawing on normative principles - qua normative principles imposing them in interpretation, and that we should do this in preference to informing interpretation by drawing on descriptive theory. In foregoing a familiar procedure for which we have motivation, and insisting on imposing “information” of questionable relevance to what actually occurs, the received view is left begging for epistemic motivation. In sections (iii) and (iv), I consider
27 the two most promising lines of response to the demand for epistemic motivation. This search produces no accounts of the truth-conduciveness of interpreting as the received view recommends. I think that this result gives rise to a strong presumption against the received view characterizing an epistemically virtuous procedure. It then is at least subjectively unmotivated to so interpret - and it will remain so until some better motivation is found. To so interpret in the face of this lack of motivation is epistemically irresponsible or irrational. Further, in section (v), I present a more direct argument to show that so interpreting is objectively unmotivatable. The earlier search had focused on accounts of the truth-conduciveness in terms of “conceptual truths” and in terms of the theory-minimal observation that all believers seek to be epistemically rational. However, this search was constrained by the insistence that the demonstration of epistemic rationality not rely on significant theory. However, when we drop this constraint, and envision using theory to show that the imposition of normative principles is truth-conducive, we get the opposite result. We find that, even if the procedure of imposing normatively derived patterns can be found truth-conducive to some minimal extent, the same information that gives us this result will also show that the procedure is less truth-conducive than the alternative of theory-informed interpretation. From all this I conclude that it is very likely objectively unmotivated to interpret as the received view recommends In any case, to so interpret, we now must not only proceed in the face of our lack of motivating account, but must do so in the face of an argument showing that, even were that procedure truthconducive in some minimal respect, there is a more truth-conducive alternative to be had. We would then be all the more deeply subjectively irrational. It would be subjectively irresponsible and irrational to so interpret, and it may well be objectively irrational as well.
Notes: 1 Obviously I want to admit that the principles of epistemic rationality inform interpretation in whatever sense they inform our descriptive endeavors generally - they inform our practice. The issue here is whether they inform interpretation in some way that is parallel to the fashion in which background theoretical information informs description. 2 For one particularly careful attempt to unpack this central epistemic value, and to trace some of the relations between it and other values, see Kitcher (1993).
28 3 I do not mean to suggest that we need articulately employ such a principle in such cases. We might just see the accelerated child as having been subject to some sort of push. What I am supposing is that such perceptions are informed by being trained up in a theoretical view of the world. Here I think Churchland’s (1989a, 1989b) views on explanation contain important truths. 4 For an extended development of this understanding of the “conceptual truth” that beliefs are significantly rational, see Henderson (1993, chpt. 4). 5 I think that is particularly unhelpful in the present context, for it is clearly not what the proponents of the received view would have had in mind with their talk of “constitutive criteria.” 6 One might attempt to build from this an epistemological motivation. So far as I can see, what is suggested would involve thinking of established practice as truth-conducive. The central question is why think that it is so. One response would be to say that it embeds a set of “unthematized” principles that function in some respects like definatory claims. To the extent that I can make sense out of this, I see little reason to think that definition is a significant aspect of practice any more than of theory. Alternatively, one might see the practice as embedding “unthematized” principles that function analogously to central elements of theory. However, to the extent that such principles are subject to change as science develops, even as central elements of theory are, it seems best to view the impact of such principles as being analogous to the general descriptive elements central to theory - as perhaps being a part of a descriptive world view. Indeed, one recent connectionist treatment of theory (Churchland 1989x) moves us away from the traditional set-of-sentences view of theory towards a view of theory that would treat much unthematized information as integral to theory. My point is that by thinking in terms of principles of practice we seem to replay the range of positions just surveyed in terms of conceptual truths and descriptive theory. 7 For purposes of argument I am supposing that motivating the received view on the basis of this rudimentary “observation” draws on sufficiently little theory that it would not fall victim to the criticisms of theory-laden motivations of the received view offered in section v. 8 What such “adoption” of “standards” amounts to can be variously understood. This is reflected in the discussion below. 9 It is more accurate to say that the method would be prima facia epistemically motivated - provided there were not yet more truth-conducive methods - say ones attuned more finely to the respects in which subjects can be expected to be preponderantly rational. This point becomes important in section v. 10 Actually, there may be theory-based reasons for thinking that it is truth-conducive to so translate, at least to a non-negligible degree. However, as I explain below, there are also theory-based reasons for thinking that there are more truth-conducive practices readily available. 11 I am not advocating imposing Aristotle’s epistemic norms in interpreting others, the point is rather that there is no epistemic motivation for imposing any one set of epistemic norms (qua norms) in interpretation generally. 12 Of course, one might argue that there is a core of agreement between various norms of epistemic rationality. I am inclined to agree. But, saying that we must impose our norms is not to say that we must impose norms that we have found all to share (so far). I deny the first and embrace (with qualifications) the second principle. Further, I believe that what is a part of the core in question is an empirical issue (Lukes 1982, Henderson 1993, pp. 42-9). To employ it is to engage in descriptively informed interpretation. 13 Alternatively, if the basis for this supposition is empirical psychology, this suggests an empirical basis for the principle of charity that is inconsistent with the received view, and this would be more congenial to my approach in terms of the principle of explicability. 14 At least it seems arbitrary if the choice of the norms to be imposed is not informed by empirical information regarding cultural factors that would make the norms of one people likely similar to the norms of those we seek to understand. However, to use such information in choosing a set of norms
29 to be imposed is to transforms what is done into something much closer to what I would recommend. 15 This claim that the present procedure is relatively nonarbitrary is intended to echo Aristotle’s insistence that the earth must be at the center of the universe because all the earthly matter seeks to proceed directly to some point, and any point but the center of the universe would be arbitrary. This was a natural move, within the Aristotelian understanding of dynamics. Similarly, the present suggestion appropriately reduces the arbitrariness threatened within the view that the constraints on interpretation must come from imposing norms. However, just as Aristotle’s dynamics was wrong, so also is the suggestion that norms must provide the pattern to be imposed in interpretation. 16 Of course, there is the familiar worry that informing description with theory makes theory itself immune from real empirical challenge, to the detriment of our pursuit of truth. Some of these worries are usefully addressed in general terms in Kitcher (1993). For discussions of some of the particulars regarding the case of psychology, see Henderson (1993, chpts. 7).
REFERENCES BonJour, L (1985): The Structure of Empirical Knowledge. Cambridge: Harvard University Press. Burge, T (1979): “Individualism and the Mental.” Midwest Studies in Philosophy 4: 73-121. Churchland, P. (1989a): “On the Nature of Theories: A Neurocomputational Perspective.” In P. Churchland, A Neurocomputational Perspective. Cambridge, MA: M.I.T. Press. ____. (1989b): “On the Nature of Explanation: A PDP Approach.” In P. Churchland, A Neurocomputational Perspective. Cambridge, MA: M.I.T. Press. Cherniak, C. (1986): Minimal Rationality. Cambridge: M.I.T. Press. Davidson, D. (1980a) “Psychology as Philosophy.” In Davidson, Essays on Actions and Events. Oxford: Clarandon Press, 229-44. ____. (1980b): .”Towards a Unified Theory of Meaning and Action.” Grazer Philosophische Studien 11: 1-12. ____. (1984a): “Belief and the Basis of Meaning.” In Davidson, Inquiries into Truth and Interpretation. Oxford: Clarendon Press, pp. 141-54. ____. (1984b): “Thought and Talk.” In Davidson, Inquiries into Truth and Interpretation. Oxford: Clarendon Press, pp. 155-70. Henderson, D. (1987): “The Principle of Charity and the Problem of Irrationality.” Synthese 73: 22552. Henderson, (1988): “The Importance of Explanation in Quine’s Principle of Charity.” Philosophy of the Social Sciences 18: 355-69. ____.(1993): Interpretation and Explanation in the Human Sciences. Albany, NY: SUNY Press. ____. (1994b): “Epistemic Competence and Contextualist Epistemology: Why Contextualism is Not Just the Poor Person’s Coherentism,” Journal of Philosophy . ____. (1995): “Epistemic Competence,” forthcoming in Philosophical Papers. Kitcher, P. (1993): The Advancement of Science. Oxford: Oxford University Press. Kripke, S. (1972): Naming and Necessity. Cambridge, MA: Harvard University Press. Lukes, S. (1982), “Relativism in its Place.” In M. Hollis and S. Lukes, eds., Rationality and Relativism. Cambridge, MA: MIT Press, pp. 261-305. McDowell, J. (1985): “Functionalism and Anomalous Monism.” In E. LaPore and B. McLaughlin, eds. Actions and Events: Perspectives on the Philosophy of Donald Davidson. Worchester: Blackwell, pp. 389-98. Pollock, J. (1987): “Epistemic Norms,” Synthese 71: 61-95. Putnam, H. (1975a), “The Analytic and the Synthetic.” In Putnam, Mind, Language and Reality. Cambridge: Cambridge University Press.
30 ____. (1975b): “The Meaning of Meaning.” In Putnam, Mind, Language and Reality. Cambridge: Cambridge University Press. ____. (1989): Representation and Reality. Cambridge: MIT Press. Quine, W. (1953): “Two Dogmas of Empiricism.” In Quine, From a Logical Point of View. Cambridge, MA: Harvard University Press. ____. (1970): “Philosophical Progress in Language Theory.” Metaphilosophy 1: 2-19. ____. (1986): Philosophy of Logic. Englewood Cliffs, NJ: Prentice-Hall. ____. (1987): “The Indeterminacy of Translation Again.” Journal of Philosophy 84: 5-10. Root, M. (1986): “Davidson and Social Science.” In LaPore, ed. Truth and Interpretation: Perspectives on the Philosophy of Donald Davidson. Worchester: Blackwell, pp. 272-304. Shapere, D. (1982): “The Concept of Observation in Science and Philosophy.” Philosophy of Science 49: 485-525.
31 Roger F. Gibson Stich on Intentionality and Rationality
abstract In chapter 2 of The Fragmentation of Reason, Stephen Stich argues that certain passages of Quine’s Word and Object are the source of what he calls the conceptual argument. That argument claims there is a conceptual connection between intentionality and rationality: intentionality requires rationality. Stich rejects the idea that intentionality requires either perfect or fixed bridgehead rationality, but he concedes that it requires minimal rationality. After explaining Stich’s position and a criticism of it offered by John Biro and Kirk Ludwig, I sketch an alternative to the conceptual argument. This alternative claims that rationality requires psychological plausibility and/or smoothness of communication, not rationality. I. Introduction In chapter 2 of The Fragmentation of Reason, Stephen Stich construes certain passages of Quine’s Word and Object as establishing “that the intentional description of a person’s mental states requires some degree of rationality.”1 The question that interests Stich is “how much rationality is required for intentional description.”2 He surveys three potential answers: (1) perfect rationality is required, (2) fixed bridgehead rationality is required, and (3) minimal rationality is required. Stich rejects 1 and 2, but accepts 3. However, he goes on to argue that 3 is both “Pickwickean and profoundly uninteresting.”3 He concludes that “neither the conceptual argument [that intentional description presupposes rationality] nor the ‘limits’ it imposes need be taken seriously by either empirical psychologists or epistemic reformers.”4 In section II, I explain Stich’s textual generation of the conceptual argument. In section III, I explain his arguments against (1) perfect rationality and (2) fixed bridgehead rationality, and his argument for (3) minimal rationality. In section IV, I outline an alternative to the conceptual argument.
32 II. The Conceptual Argument The conceptual argument maintains that there is a conceptual connection between intentional description and rationality:
intentional description
presupposes rationality. If so, then there is an a priori limit as to how irrational a being can be and still be described as an intentional being. Stich maintains that the origin of the conceptual argument is to be found in Word and Object where Quine wrote: Wanton translation can make natives sound as queer as one pleases. Better translation imposes our logic upon them, and would beg the question of prelogicality if there were a question to beg.5 The maxim of translation underlying all this is that assertions startingly false on the face of them are likely to turn on hidden differences of language.6 The common sense behind the maxim is that one’s interlocutor’s silliness, beyond a certain point, is less likely than bad translation - or, in the domestic case, linguistic divergence.7 Adjusting for “Quine’s quaint behaviorist scruples,”8 which he does not share with Quine, Stich argues that Quine’s maxim of translation applies to translations of sincere assertions of single beliefs, sets of beliefs, and inferences. Now, violations of Quine’s maxim can occur. Thus, for example, it would be a violation of the maxim if various, sincere, native assertions were translated, respectively, as the belief that elephants lay eggs, as the set of beliefs that hens lay eggs and that hens do not lay eggs, and as the inference that if hens lay eggs, then elephants don’t; hens do; so, elephants do too - all of these sincere assertions being startingly false on the face of them. When such violations of the maxim occur, according to Stich, they “impugn our scheme of translation.”9 What is the force of Stich’s remark that violations of Quine’s maxim impugn our scheme of translation? According to what I’ll call the strong constural, Stich’s remark has the force of denying that any such translation has intentional content. On this construal, it is a conceptual truth that any putative translation which violates Quine’s maxim lacks intentional content. This is the way Stich construes the matter. According to what I’ll call the weak
33 construal, Stich’s remark has the force of allowing such a translation to retain its intentional content, but marking it as a prima facie bad translation. On this construal, it is not true (and, therefore, not a conceptual truth) that any translation which violates the maxim is devoid of intentional content. This is the way, I believe, Quine would construe the matter. However, this is not intended as a criticism of Stich, for his aim “is to draw from Quine’s words an argument that is both plausible and reasonably clear . . . happily leav[ing] to others”10 the question of whether his reconstruction is faithful to Quine’s intentions. III. Rationality Requirements Having argued à la Quine that intentional description presupposes rationality, Stich wants to know how much rationality is required for intentional description. One suggestion is that intentional description requires perfect rationality. So, any deviation from perfect rationality violates Quine’s maxim and strongly impugns (i.e., renders devoid of intentional content) the translation. Perfect Rationality. What is perfect rationality? As Stich points out, “in the literature in this area detailed accounts of rationality are conspicuously lacking.”11 However, Stich provides two (nearly) necessary conditions for perfect rationality: consistency and deductive closure. Deductive closure requires that a person believe all of the logical consequences of what he believes. Stich argues against the requirement of perfect rationality in the following manner: P1:
Intentional description requires rationality.
P2:
Intentional description requires perfect rationality.
P3:
Perfect rationality requires closure.
P4:
Closure is impossible.
ˆCl: ˆC2:
P5:
Perfect rationality is impossible. Intentional description is impossible. Intentional description is possible.
34 ˆC3:
Intentional description does not require perfect rationality.
Stich justifies the premises of the above argument as follows: P1 is justified by the conceptual argument; P2 is a hypothesis; P3 is definitional; P4 is justified by appeal to very plausible considerations advanced by Christopher Cherniak12; P5 is justified by the fact that intentional description is actual. None of these premises is, it seems to me, contentious. Thus, the conclusion, C3, stands: intentional description does not require perfect rationality. Fixed Bridgehead Rationality. Another, more promising, suggestion is that intentional description requires a fixed bridgehead of true and rational beliefs. Stich argues against the requirement of fixed bridgehead rationality in the following manner: P1:
Intentional description requires rationality.
P2:
Intentional description requires a fixed bridgehead of true and rational beliefs.
P3:
A fixed bridgehead of true and rational beliefs requires a fixed, finite set of specific inference principles and stimulus-belief links that are universal among mankind.
P4:
There is no fixed, finite set of specific inference principles and stimulus-belief links that are universal among mankind.
ˆCl: ˆC2:
P5: ˆC3:
There is no fixed bridgehead of truth and rational beliefs. Intentional description is impossible. Intentional description is possible. Intentional description does not require a fixed bridgehead of true and rational beliefs.
Stich justifies the premises of this argument as follows: P1 is justified by the conceptual argument; P2 is a hypothesis; P3 is definitional; P4 is justified by appeal to further considerations advanced by Cherniak13; P5 is justified by the fact that intentional description is actual. However, Stich’s justification of P4 is contentious. In a recent joint paper, John Biro and Kirk Ludwig question Stich’s purported justification of P4. Indeed, they not only argue that Stich’s case against the fixed bridgehead view fails, they also argue that Stich’s argument in favor of minimal rationality inadvertently establishes the fixed bridgehead view itself. After explaining
35 Stich’s use of one of Cherniak’s arguments in his attempt to justify P4, I will briefly examine these criticisms. Biro and Ludwig accurately explain Stich’s defense of P4 as follows: Stich’s argument against the fixed bridgehead view is based on a thought experiment borrowed from Christopher Cherniak. We are asked to imagine a ‘hypothetical people’ whose ‘feasibility ordering’ for inferences is inverted with respect to ours. The feasibility ordering of a person’s inferences is the ordering of the possible inferences he can make in terms of the difficulty he experiences in making them. If we grant the possibility of a people whose feasibility ordering is so inverted, that is, who find the inferences we find hard, easy, and the inferences we find easy, hard, then, Stich, argues, we must give up the fixed bridgehead view of rationality.14 In short, if we accept the Stich/Cherniak thought experiment, we must accept P4. However, Biro and Ludwig are unconvinced by the Stich/Cherniak thought experiment and, as a result, they deny that P4 has been justified. They maintain that Stich’s use of the thought experiment overlooks the fact that inference is not merely a logical concept, it is also an epistemic concept. And, while the Stich/Cherniak thought experiment may make sense for the logical concept of inference, it makes no sense for the epistemic concept. As a logical concept, rational inference can be associated with valid inference; as an epistemic concept, rational inference can be associated with justified inference. According to Biro and Ludwig, justified inference, unlike valid inference, involves “seeing that an inference is a reasonable or valid one, seeing that the conclusion follows form the premises.”15 But if this internalist conception of justified inference is taken to be the kind of inference required by the fixed bridgehead view, then the Stich/Cherniak thought experiment is no longer a threat to that view because it is incoherent; Biro and Ludwig explain: The difficulty lies in the supposition that our hypothetical people are unable to recognize as valid those inferences which are most transparent to us; these are the inferences which are conceptually simple, those into which more complex ones are decomposable. This requirement is in conflict with Stich’s assumption that they are in fact making rational inferences, that is, that the
36 transitions they make between beliefs are justified inferences in addition to being logically valid inferences. Since the hypothesis that their ability to recognize inferences as valid is inverted with respect [to] ours presupposes that they are making rational inferences, it follows that the thought experiment is incoherent.16 However, the weakness of this criticism of the Stich/Cherniak thought experiment resides in the fact that the criticism presupposes an internalist theory of justification, and internalism is, itself, a matter of great controversy. Minimal Rationality. As we have seen, Stich rejects both perfect rationality and fixed bridgehead rationality as answers to the question of how much rationality is required by intentional description.
However, he accepts
minimal rationality as a correct answer to that question. What is minimal rationality? On this view, there is no one inference nor any specific set of inferences that a person’s mental states must manifest in order to qualify for an intentional description. Rather, what is required is that the mental states manifest some reasonably substantial subset of the inferences that would be required of a perfectly rational cognitive agent.17 Stich’s argument for the conclusion that intentional description requires such minimal rationality is complex. He reasons that in giving an intentional description of another person’s thought, one usually asks oneself, “What would I think were I in the other person’s shoes?”. In order to answer that question, one must rely on similarities between the dynamics of one’s own mental states and those of the other person as guiding the construction of any intentional description of the other person’s mental states.
And, because one’s own
mental states manifest minimal rationality, any emerging intentional description will therefore characterize the other person as being minimally rational also - at least to the extent that one is successful in constructing an intentional description. Of course, there is no guarantee that the similarities that play a role in the construction of an intentional description of one person are the same similarities that play a role in the construction of an intentional description of some other person. In short, on the minimal rationality view, there is no bias in favor of fixed bridgehead rationality. (Biro and Ludwig argue, on the contrary, that Stich’s endorsement of minimal rationality commits him to fixed bridgehead rationality, but since their argument, again,
37 turns on the controversial notion of internalist justification, I am going to ignore it.) Even though Stich endorses minimal rationality as an answer to the question of how much rationality is required for intentional description, he complains that the argument supporting it is objectionable because the ‘limit’ it imposes on how bad reasoning can be, or how much it can improve, is both Pickwickean and profoundly uninteresting. It is an observer-relative, situation-sensitive constraint that marks no natural or theoretically significant boundary. Rather, it follows the contours of a commonsense concept. And the utility of that concept in day-to-day affairs is not at all dependent on the vague boundaries it generates in regions far from those in which the concept is usually invoked.18 Consequently, the argument that intentional description requires minimal rationality, the argument establishing “the limits on how badly people can reason, and on how much they can improve”19 is inconsequential: it holds no theoretical promise for empirical psychology. IV. An Alternative to the Conceptual Argument The conceptual argument maintains that intentional description requires some degree or other of rationality. Stich traces the source of the argument back to Quine’s maxim of translation: sincere assertions which are startingly false on the face of them are likely to turn on hidden differences in language. Translations that violate this maxim are irrational because they impugn our scheme of translation. In section II, I suggested two construals of the force of Stich’s remark that violations of Quine’s maxim impugn our scheme of translation. On the strong construal, the force of the remark is to deny that such translations have intentional content. On the weak construal, its force is to allow that such translations may have intentional content, but marks them as prima facie bad translations. As we have seen, Stich (somewhat reluctantly, perhaps) champions the strong construal, and, as I previously suggested, Quine can be read as someone who adopts the weak construal. In the remainder of this essay, I will develop the weak construal, show that it is consistent with Quine’s latest thoughts, and sketch its implications for Stich’s quest for an answer to how much rationality is required for intentional description.
38 Suppose we translate a native’s sincere assertion as the belief that elephants lay eggs (E, for short). Being startingly false on the face of it, this translation violates Quine’s maxim. In short, E is prima facie a bad translation, though it (contra Stich) may have intentional content. How are we to determine whether E is actually a bad translation? There are two key parameters involved in answering this question:
psychological
plausibility and smoothness of communication. Given these, we can respond to the question of whether E (and the like) is actually a bad translation as follows:
First, if the attribution of E to the native is found to be
psychologically plausible (all else being equal), E is not actually a bad translation. If the attribution of E is not found to be psychologically plausible, then we must take the second step of determining whether E contributes to the smoothness of our communication with the native. If it does, then E is not actually a bad translation; if it does not, then E is actually a bad translation. I believe this elaboration of what I have called the weak construal of the force of Stich’s remark that violations of Quine’s maxim impugn our scheme of translation is consistent with the position Quine outlines in the following remarks regarding a difference he has with Donald Davidson regarding the principle of charity: In Davidson’s actual methodology . . . there is one point on which I have misgivings: his maxim of maximizing truth on the part of the native informant’s utterance. I would maximize the psychological plausibility of my attributions of belief to the native rather than the truth of the beliefs attributed. In light of some of the natives’ outlandish rites and taboos, glaring falsity of some of their utterances is apt to be a psychologically more plausible interpretation than truth. In the absence of such exotic behavior, however, and apart from domains where the natives are presumably uninformed, and apart from illusions such as caused by the toy rabbit, the practical working assumption is indeed that they think as we do and hence that most of their utterances should be interpreted as true by our lights.20 Clearly, the notions of psychological plausibility and smoothness of communication need elaboration, but it is equally clear that they are not coextensive with rationality. Whatever the correct interpretation of Quine’s view may be, the weak construal (as sketched previously) undercuts the conceptual argument, the
39 argument that says intentional content requires rationality. It is closer to the mark to say that intentional content requires psychological plausibility and/or smoothness of communication. This way of looking at the matter goes beyond Stich’s “chauvinistic principle of humanity”21 which “asserts ... that in characterizing a cognitive state intentionally, we are saying it is similar to some actual or possible state of our own.”22 However, given the context dependency of these two parameters as well an our incomplete knowledge of psychology, one might still agree with the moral which Stich draws from the conceptual argument, suitably paraphrased: neither the psychological plausibility argument, nor the smoothness of communication argument, nor the ‘limits’ they impose need be taken seriously by either empirical psychologists or epistemic reformers. Notes 1 Stich, S. The Fragmentation of Reason, p. 39, M.I.T. Press, Cambridge, MA, 1990. 2 Ibid., p. 30. 3 Ibid., p. 51. 4 Ibid., p. 54. 5 Quine, W. V. Word and Object, p. 58, M.I.T. Press, Cambridge, MA, 1960. 6 Ibid., p. 59. 7 Ibid. 8 Stich The Fragmentation of Reason, p. 31. 9 Ibid., p. 35. 10 Ibid., p. 31. 11 Ibid., p. 29. 12 See Stich The Fragmentation of Reason, pp. 40-1. Stich cites several works by Christopher Cherniak, chief among them is Minimal Rationality, M.I.T. Press, Cambridge, MA, 1986. 13 Ibid. 14 Biro, J. and K. Ludwig “Are There More Than Minimal A Priori Limits on Irrationality?”, Australasian Journal of Philosophy, Vol. 72, No. 1, pp. 90-91, March, 1994. 15 Ibid., p. 91. 16 Ibid., p. 92. On p. 96 of their paper, Biro and Ludwig report that when confronted with this agument against P4, Stich responded by saying that their epistemic concept of rationality was not the concept of rationality that he was addressing in The Fragmentation of Reason. Stich’s concept appears to be an externalist one. 17 Stich The Fragmentation of Reason, p. 40. 18 Ibid., pp. 51-2. 19 Ibid., p. 53.
40 20 Quine “Where Do We Differ?”, in L. Hahn (ed.), The Philosophy of Donald Davidson, typescript, Open Court, LaSalle, IL, in press. See also Quine Theories and Things, p. 41, Harvard University Press, Cambridge, MA, for Quine’s ruminations regarding the possibility of untranslatable languages. 21 Stich The Fragmentation of Reason, p. 52. 22 Ibid.
Rational Intentions and the Toxin Puzzle
41
Alfred R. Mele Rational Intentions and the Toxin Puzzle
abstract Gregory Kavka’s toxin puzzle has spawned a lively literature about the nature of intention and of rational intention in particular. This paper is largely a critique of a pair of recent responses to the puzzle that focus on the connection between rationally forming an intention to A and rationally A-ing, one by David Gauthier and the other by Edward McClennen. It also critically assesses the two main morals Kavka takes reflection on the puzzle to support, morals about the nature of intention and the consequences of a divergence between “reasons for intending and reasons for acting.”
Gregory Kavka’s toxin puzzle (1983) has spawned a lively literature. Although the primary thesis that Kavka motivates with the puzzle concerns the nature of intention in general, much subsequent discussion of his puzzle has focused on rational intentions in particular. Here I will follow suit.1 I will evaluate a pair of recent proposals about the connection between rationally forming an intention to A and rationally A-ing, one by Edward McClennen and the other by David Gauthier. The bulk of Kavka’s puzzle is as follows: You have just been approached by an eccentric billionaire who has offered you the following deal. He places before you a vial of toxin that, if you drink it, will make you painfully ill for a day, but will not threaten your life or have any lasting effects. . . . The billionaire will pay you one million dollars tomorrow morning if, at midnight tonight, you intend to drink the toxin tomorrow afternoon. He emphasizes that you need not drink the toxin to receive the money; in fact, the money will already be in your bank account hours before the time for drinking it arrives, if you succeed. . . . All you have to do is . . . intend at midnight tonight to drink the stuff tomorrow afternoon. You are perfectly free to change your mind after receiving the money and not drink the toxin. (The presence or
42 absence of the intention is to be determined by the latest ‘mind-reading’ brain scanner. . . .) (1983, p. 33-34) The billionaire has placed certain restrictions on the avenues by which you may form or acquire the intention. You are not allowed to arrange “external incentives” to drink the toxin: Kavka mentions promising someone that you will drink it, signing a contract that commits you to giving all your money (including the million dollars) “to your least favourite political party, if you do not drink it,” and hiring a hitman to kill you if you refrain from drinking it (p. 34). Also excluded “are such alternative gimmicks as hiring a hypnotist to implant the intention, forgetting the main relevant facts of the situation, and so forth” (p. 34). Kavka adds: “Promising yourself that you will drink the toxin could help if you were one of those strange people who take pride in never releasing oneself from a promise to oneself, no matter what the circumstances. Alas, you are not” (pp. 34-35). Assume that a relatively normal person who is offered the deal thinks ahead to tomorrow. Seemingly, the person will become convinced that tomorrow (like today) he will have no reason to drink the toxin and a good reason not to drink it. (Since the toxin deal has not been offered to anyone else, there is no data on whether winners tend to be toxin drinkers [Kavka, p. 35].)
A
predictable consequence of this conviction is the further conviction that he will not drink the toxin and will make no effort whatever to drink it: Given that he will have no reason to drink the toxin and a good reason not to drink it, why on earth would he endeavor to drink it? And it seems that, having this further conviction, the person is in no position to intend tonight to drink the toxin tomorrow.2 Surely, whatever an intention is, it involves a psychological commitment of some kind at least to trying to do what is intended; and barring a bizarre species of mental partitioning, someone who is convinced now that he will not even make an effort to drink the toxin tomorrow seemingly falls short now of being psychologically committed to making such an effort tomorrow. To be sure, he may fervently want to have the money-winning intention now. But that is another matter. Kavka sums up his estimation of your situation as a hopeful winner as follows: “intentions are . . . dispositions to act that are based on reasons to act -
Rational Intentions and the Toxin Puzzle
43
features of the act itself or its (possible) consequences that are valued by the agent. . . . Thus, we can explain your difficulty in earning a fortune: you cannot intend to act as you have no reason to act, at least when you have substantial reasons not [so] to act. And you have (or will have when the time comes) no reason to drink the toxin, and a very good reason not to. . .” (p. 35). If this is right, the puzzle teaches us something about the nature of intention.3 1. Approaches to the Puzzle: Twisted and Straight Michael Bratman invites his readers to imagine (1) that an agent who is offered the deal somehow manages to cause himself to intend on Tuesday to drink the toxin on Wednesday - perhaps “by using a form of self-hypnosis” - and (2) that “it is rational of [the agent] to acquire and to have” this intention (1987, pp. 103-6).
Presumably, self-hypnosis is meant to be on the original list of
proscribed “alternative gimmicks [such] as hiring a hypnotist to implant the intention, forgetting the main relevant facts of the situation, and so forth” (Kavka, p. 34). But we can imagine that the rules have been changed to allow this. Bratman argues that from (2) and the assumption that on Wednesday things are just as the agent envisaged them, it does not follow that it is rational of the agent to drink the toxin (p. 106). David Gauthier has denied that “it can be rational to adopt an intention and then rational to abandon it should the very conditions envisaged in adopting it come to pass” (1984, p. 159; cf. McClennen 1990, p. 228). However, if Bratman is right, perhaps this is rational in some unusual cases. Edward McClennen implicitly takes the position that without bending the rules in Kavka’s scenario, an agent can rationally form an intention today to drink the toxin tomorrow (1990, pp. 229-31). He describes a “modified version of Kavka’s problem” in which you have two options: You can fulfill the terms of the contract by employing a precommitment device that ensures that you will drink the toxin the next afternoon, but such precommitment will cost you $500,000. Alternatively, you can forego the precommitment device, settle on the plan of drinking the toxin, and stand to be tested by the brain-mind machine to see if you have the capacity to act on such a plan. Thus, if you do not believe that you
44 have [this] capacity . . ., you can sacrifice half your winnings and tie your hands in advance. (p. 229) McClennen explains that “the agent’s capacity today to carry out a plan tomorrow is dependent on his being able to ratify the plan tomorrow” and he suggests that Kavka and Bratman would deny that a rational agent has the capacity to act on a plan to drink the toxin in this case (pp. 229-30). But, he asks (p. 230; cf. Gauthier 1994, pp. 708-9), “How can it be rational to settle for $500,000, when all that stands between you and [an additional] $500,000 is your own inability to decide on a plan and then follow through on it? If you are really prepared to precommit, for example, to have someone else constrain you to drink the toxin, why not ‘mentally’ constrain yourself and save the precommitment costs?” Kavka’s answer might be that, knowing that you will have no reason to drink the toxin tomorrow, you are in no position to decide tonight to drink it tomorrow: you cannot decide to do what you are convinced you will not even try to do. But McClennen can reply that if you were to decide tonight to drink the toxin tomorrow and if you value being the sort of person who executes his decisions provided that, at the relevant time, things are as he envisaged they would be when he made the decision, then you would know that you will have a reason to drink the toxin tomorrow - a reason constituted by the value you place on being a resolute person of this kind and your recognition that a resolute person would execute his intention to drink the toxin. In effect, McClennen can appeal to an analogue of the self-promiser that Kavka excludes from consideration. As “those strange people who take pride in” honoring their promises to themselves even at considerable personal cost may create a reason for drinking the toxin by promising themselves that they will drink it, a person who values being resolute may create a reason for drinking the toxin tomorrow by deciding today to drink it tomorrow.4 But McClennen need not accept the intimation of irrationality for his analogue. He can suppose that you value being a resolute person because you reasonably deem resoluteness rational and value being rational. Would a person who wins the million dollars in the way McClennen imagines rationally drink the toxin? The money is already his and he knows
Rational Intentions and the Toxin Puzzle
45
that. Given that he cares about being resolute, he has a reason to drink it. But he also has a reason not to drink it, since, as he knows, drinking it will make him “painfully ill” for a day. Which is the better reason? In a world much like ours, the winner can reasonably anticipate not receiving a similarly bizarre offer again, and he need not seriously worry that his abandoning his decision now would significantly weaken his character. In the past, when he abided by his decisions at some immediate cost to himself, he did so partly because others cared about his doing what he decided to do (e.g., when he helped neighbors repair their tornado-damaged homes after they helped him repair his). But he knows that the billionaire in no way wishes him to drink the toxin. He has grounds for treating the present case as an exceptional one, and for regarding his abandoning his decision as best, all things considered. To be sure, if the agent were thinking along these lines the preceding night, he might thereby cut himself off from the prospect of winning the million dollars. He might convince himself that he would not abide by a decision to drink the toxin, in which case he faces the problem that Kavka highlights. But some relevant agent may simply be the sort of person who does not give the future much thought or who lacks the intellectual capacity to think through the matter of what he would do tomorrow if matters were as he expected them to be. It may be replied, of course, that even an agent who has already won the money may care so much about being a resolute intender that he would deem it better to drink the toxin and be painfully ill than to abandon his decision. But one is entitled to wonder whether it is rational to care that much about personal resoluteness. One worries that such a person might suffer from obsessive-compulsive disorder. Or perhaps he is unbalanced in another way: the thought of being painfully ill for a day might not bother him much; he might even find himself oddly attracted to the self-induced illness. Consider the following variant of Kavka’s case. Again, “gimmicks” (e.g., hypnosis, forgetting relevant details) and arranging “external incentives” are excluded, and a large prize will be in the winner’s bank account tomorrow morning if she intends by midnight tonight to drink the toxin tomorrow afternoon. But, as in McClennen’s scenario, there are two money-winning
46 possibilities. To qualify for the prize - ten million dollars this time - one must sign a contract stipulating (1) that if one intends at midnight to drink the toxin tomorrow afternoon and then does not in fact drink it, one is allowed to keep the entire ten million and (2) that if one intends at midnight to drink the toxin tomorrow and then does drink it tomorrow, one must return all but ten dollars. The deal is offered to a woman, Ann, who cares very much about being resolute. Ann believes that her resoluteness makes it possible for her to win, but that it also makes it likely that she would gain only ten dollars. If given the opportunity, Ann certainly would drink the toxin for ten million dollars, but she would not drink it for ten dollars. Even so, she realizes that the prize is for intending, not for drinking; and, thinking that there is some chance that the toxin will not be available for drinking tomorrow or that the billionaire will allow her to keep the entire ten million even if she drinks the toxin, she decides to give the offer serious consideration. Ann judges that there is some chance that she will get to keep the entire ten million if she decides tonight to drink the toxin tomorrow and that, given the stakes, it would be best to make that decision. Accordingly, she decides tonight to drink the toxin tomorrow. Tomorrow, matters are just as Ann believed they probably would be. The ten million is in her bank account, the toxin is in her kitchen, and the billionaire has not expressed a change of heart. Her drinking the toxin would cost her $9,999,990 and twenty-four hours of painful illness. Other things being equal (e.g., there is no serious penalty for abandoning her decision), her caring so much about resoluteness that she drinks the toxin anyway would give us grounds for deeming her insane. If this is right, it might sometimes “be rational to adopt an intention and then rational to abandon it [even though] the very conditions envisaged in adopting it come to pass.” This suggests that rational resolute agents will fare no better than ordinary folks in Kavka’s scenario, provided that they are required to think ahead to tomorrow and to assess the situation carefully. Tomorrow, a resolute agent would have some reason to drink the toxin, if he were to manage to form the intention tonight; for he cares about being resolute and recognizes that resoluteness requires drinking the toxin.
However, for reasons already
47
Rational Intentions and the Toxin Puzzle
identified, he will have a significantly better reason not to drink it. And, being rational, he will act on the basis of his better reasons. Further, given that today he thinks ahead to tomorrow and rationally assesses matters, he will conclude today that he will not drink the toxin tomorrow. And as long as he is convinced of the truth of that conclusion, he is in no position to form the intention to drink the toxin tomorrow. Or so it seems. Have I been unfair, however, in being prepared to level the lunacy charge against Ann should she drink the toxin?
It may be suggested that the
rationality at issue here is instrumental rationality and that purely intrinsic desires (desires for things strictly as ends) cannot properly be evaluated from this perspective (provided that they do not compete with other intrinsic desires of the agent). A proponent of a view like McClennen’s might seek to dodge the bullet by appealing to a purely intrinsic desire for personal resoluteness, but this would be a major departure for McClennen himself, who has emphasized that a resolute chooser’s “policy of nonreconsideration can be rationalized by reference to the gains to be had from being able to coordinate the decisions of different time slices of oneself” (1990, p. 231).5
2. Another Toxin with a Twist One might resist the thrust of the preceding section and urge that we should expect a rational agent to have resources for becoming a millionaire in Kavka’s scenario. Rationality might seem to be less than it is cracked up to be if rational agents cannot gain the money. David Gauthier has advanced a principle that may seem to hold some promise for a rational agent who hopes to win the money in Kavka’s case. He writes: Sometimes my life will go better if I am able to commit myself to an action even though, when or if I perform it, I expect that my life will not thenceforth go as well as it would were I to perform some alternative action. Nevertheless, it is rational to make such a commitment, and to restrict my subsequent deliberations to actions intentionally compatible with it, provided that in so doing I act in a way that I expect will lead to
48 my life going better than I reasonably believe that it would have gone had I not made any commitment. (1994, p. 707; cf. Gauthier, forthcoming a and b) Consider an agent, Tex, who is offered Kavka’s toxin deal and is impressed by the support Gauthier offers for the principle expressed in the second sentence of this passage. Tex views intentions as psychological commitments and he believes that if he were to form the intention tonight to drink the toxin tomorrow and were to execute that intention, his life would go better than if he were not to form the intention tonight. Believing this, and believing that Gauthier’s principle is correct, Tex believes that he is in a position rationally to form the intention to drink the toxin. He believes that tomorrow it would be rational to restrict his deliberation to actions “intentionally compatible” with his forming the intention to drink the toxin and therefore rational not to refrain from drinking the toxin. (“An action x is intentionally compatible with the prior actions of an agent, if each of those actions could have been performed intentionally had the agent consciously intended to perform x” [Gauthier 1994, p. 702]. Thus, Tex’s refraining from drinking the toxin tomorrow is not intentionally compatible with his forming the intention tonight to drink the toxin tomorrow, since he cannot form at t the intention to drink the toxin tomorrow if at t he consciously intends to refrain from drinking the toxin tomorrow.)6 Tex concludes that if he forms the intention tonight to drink the toxin tomorrow, it will be rational to drink it. Believing this, and believing himself to be rational, he sees no grounds for believing that he will not drink the toxin tomorrow. Indeed, he believes that he will have an excellent reason to drink it - namely, that this will be the rational thing to do, provided only that he forms the intention tonight to drink it tomorrow. So Tex is convinced that nothing stands in the way of his forming the intention tonight. He would certainly be willing to drink the toxin for a million dollars, and, as he sees it, he is in a position to intend to do what he would be willing to do. Even if Tex can win the money, has he been misled by Gauthier? The sun dawns on a new day. Tex checks his bank account and finds that he is a millionaire. Does he have a reason to drink the toxin? Well, if he still believes
Rational Intentions and the Toxin Puzzle
49
that it is rational to drink it and if he values doing what is rational, he does. But, today, is it reasonable for Tex to view his drinking the toxin as rational? It may be claimed that since, last night, he believed that his drinking the toxin today would be rational and since circumstances today are just as he envisaged them, consistency requires that he believe this today. However, even if consistency does require this, it certainly seems reasonable for Tex, given the suffering that drinking the toxin would cause, to wonder whether he was mistaken last night about the rationality of drinking it. He might even decide that he was misled by Gauthier and (grateful to Gauthier for putting him in a position to become a millionaire) he may judge that it would be pointless to drink the toxin and utterly rational to refrain from drinking it. This is a natural judgment for Tex to make. (Put yourself in his shoes!) As Gauthier says, his opponents think “it mad to drink the toxin” (1994, p. 709). Of course, if Tex had been thinking this last night, he would not be a millionaire today. But this is a new day; and, as we all know, arguments that struck us as compelling yesterday sometimes look considerably weaker when viewed in a fresh light. If I were to find myself in Tex’s shoes, the million dollars in hand, I would not go near the toxin. I have no doubt about that. Is the suggestion that this would make me irrational much easier to swallow than the toxin is? Consider a modified version of my earlier variant of Kavka’s case. This time, to qualify for the ten million dollar prize, one must sign a contract stipulating (1) that if one intends at midnight to drink the toxin tomorrow afternoon and then does not in fact drink it, one is allowed to keep the entire ten million and (2) that if one intends at midnight to drink the toxin tomorrow and then does drink it tomorrow, one must return all but $100,000. Suppose that Tex had been offered this deal rather than the one Kavka describes. Tex, it so happens, would drink the toxin for $100,000, and he believes that if he were to form the intention tonight to drink the toxin tomorrow and then were to execute that intention tomorrow, his life would go better than if he were not to form the intention tonight. But if, as in the earlier case, he were to form the intention to drink the toxin, convinced that it is entirely rational for him to form it, would it be rational for him to drink the toxin once the ten million is
50 in his bank account? This time, his drinking the toxin would cost him not only a day of suffering but also $9,900,000. A person who would drink the toxin at this price seems far from sane. Acceptance of Gauthier’s principle would enable one to become richer, but subsequent rejection of it has marked advantages too. To be sure, one cannot simultaneously accept and reject it.
But one who benefits from sincere
acceptance of the principle should not have a difficult time, subsequently, finding grounds for sincerely rejecting it. Gauthier writes: “The objector thinks it mad to drink the toxin. I, on the other hand, think it mad not to be the sort of person who would drink the toxin” (1994, p. 709). For my own part, I find it mad to pay the considerable and unnecessary cost involved in drinking the toxin after having benefitted enormously from being, temporarily, the sort of person who would drink it.7 If an agent were able to will irreversibly tonight to drink the toxin tomorrow (cf. Sobel 1994, pp. 347-51), matters would be different. As J. H. Sobel has observed (ibid), an agent who knowingly possesses this imagined ability might reasonably think that he will win the money only if he so wills tonight; and tomorrow, given his inability to refrain from drinking the toxin, he cannot plausibly be charged with irrationality for drinking it.8 I have been imagining that Tex is a relatively normal agent who lacks the capacity to render himself unable to refrain from A-ing tomorrow simply by willing (as firmly as he can) tonight to A tomorrow. 3. Intentions and Rationality Kavka takes reflection on his puzzle to support two points. The first is a thesis about the nature of intention: that all intentions to A are dispositions to A that are based on reasons to A, “features of the act itself [i.e., A-ing] or its (possible) consequences that are valued by the agent” (p. 35). If an agent of the sort Sobel imagines is possible, then this thesis is false.9 Presumably, in (irreversibly) willing tonight to drink the toxin tomorrow, the agent forms an intention to drink it. But although she has a reason to form the intention, she need have no reason to drink the toxin. She might not be fond of drinking toxins, not value
Rational Intentions and the Toxin Puzzle
51
being a resolute chooser, not accept the principle of Gauthier’s discussed earlier, and so on. Further, as I have argued elsewhere, nonintrinsic intentions to A-intentions that do not represent A-ing as an end - are not themselves reasons for A-ing (Mele 1992b, p. 181), and Sobel’s intender does not regard her drinking the toxin as an end. Rather, she should regard it as an unfortunate consequence of doing what she deems necessary to gain the million dollars namely, willing irreversibly to drink the toxin. Kavka’s “second point” is about rationality: when reasons for intending and reasons for acting diverge, as they do here, confusion often reigns. For we are inclined to evaluate the rationality of the intention both in terms of its consequences and in terms of the rationality of the intended action. As a result, when we have good reasons to intend but not to act, conflicting standards of evaluation come into play and something has to give way: either rational action, rational intention, or aspects of the agent’s own rationality (e.g., his correct belief that drinking the toxin is not necessary for winning the million). (pp. 3536) This is misleading. If, as Kavka himself argues, the money-winning intention cannot be formed or acquired by any eligible agent, including (apparently) perfectly rational agents,10 the issue about rationality does not properly arise. Surely, it is not irrational not to do something that even rational agents cannot do. And what normative force would ‘rational’ have in the following sentence: “Bringing it about that you intend to A is the rational thing for you to do now; but, even though you are completely free of any relevant irrationality, you cannot bring it about now that you intend to A”? Suppose that, without breaking the billionaire’s rules, an agent can bring it about that he intends to drink the toxin at a cost that the agent rationally deems acceptable given the anticipated winning of the million dollar prize. Must this hinge on its being rational for the agent to drink the toxin? If the answer is “no,” then it is rational for some agent to bring it about that he so intends quite independently of the rationality or irrationality of the drinking, and we can “evaluate the rationality of the intention” independently of an evaluation of “the rationality of the intended action.” The basic issue then
52 would be about the nature of intention, not about the connection between rational intentions and rational actions. The problem for normal, reasonably reflective agents who are convinced that they will have “no reason to drink the toxin” tomorrow and “a very good reason” not to drink it (Kavka, p. 35) is that they are convinced, accordingly, that they will not drink the toxin tomorrow and will make no effort to do so. And, again, having the latter conviction apparently is inconsistent with intending to drink the toxin. Gauthier and McClennen seek to remove this obstacle to intention by arguing that a rational agent, or a rational agent of a certain kind, does have a good reason to drink the toxin tomorrow, provided that he intends tonight to drink it tomorrow. And I have argued against their proposals. There is another way to remove the obstacle, the conviction that one will eschew drinking the toxin. An agent who has no reason to drink the toxin might, on grounds of another sort, be convinced that he will drink it. This is the line Sobel pursues. Indeed, his agent can rationally form the intention to drink the toxin and proceed to drink it tomorrow without rationally drinking it (thus, supporting the “no” answer mentioned in the preceding paragraph), if Sobel is wrong in thinking that her drinking the toxin is a rational action in virtue of being “the only thing she could do” after irreversibly willing to drink it (1994, p. 248). I explored a similar idea in an earlier paper (Mele 1992b) in connection with a strengthened version of Kavka’s scenario, and I concluded, among other things, that rationally forming an intention to A is not essentially dependent upon its being rational to A (in the circumstances anticipated at the time of intention-formation). In the strengthened version, to win the money an agent must, while being utterly convinced that he will have no reason to drink the toxin tomorrow, form the intention tonight to drink it tomorrow. Here is a short version of a long example. Ted knows that he is plagued by a mindreading demon who consistently tricks him into drinking non-lethal toxins (within twenty-four hours) when they are nearby, unless Ted intends to drink them and executes his intention (within twenty-four hours). Aware that the billionaire has placed the toxin in his kitchen, Ted is convinced that he will
Rational Intentions and the Toxin Puzzle
53
drink it sooner or later. Ted sees himself as being able to choose tonight between two options: (1) drink the toxin unintentionally within twenty-four hours, get sick, and get no richer; (2) drink the toxin intentionally tomorrow afternoon, get sick, and receive a million dollars. Knowing that he has a psychological feature called “intention perseverance,” Ted is convinced that if he intends tonight to drink the toxin tomorrow, the intention will persist unless he has a reason to abandon it. And since Ted has long been indifferent between drinking toxins unintentionally and drinking toxins intentionally, he is confident that he will have no reason to abandon the intention tomorrow. He has a good reason to select option 2, and he selects it for that reason: Ted forms the intention to drink the toxin tomorrow afternoon. As in Sobel’s case, Ted manages to form the intention to drink the toxin tomorrow afternoon while having no reason to drink it. Unlike Sobel’s agent, Ted does not have an irreversible intention: if someone were unexpectedly to offer him at 10:00 tomorrow morning a million dollars to drink the toxin before noon, he would abandon his intention for afternoon toxin drinking and form an intention to drink the toxin earlier. So even if, in virtue of being “the only thing” she can do, drinking the toxin at the appointed time is to be counted as rational in the case of Sobel’s agent, this consideration does not apply to Ted. I have drawn some general morals from the toxin puzzle elsewhere (Mele 1992b). My aim here has been to reveal the shortcomings of some interesting proposals - Gauthier’s and McClennen’s - featuring the idea that, in Kavka’s scenario, some money-winners will rationally drink the toxin even though, at the time, they are able to refrain from drinking it. If my arguments are on the money, good reasons for action are not as easy for an agent to generate as some have thought.11
Notes 1 In Mele 1992b, I address the puzzle with the aim of clarifying the nature of intention and the connections between intentions and the following items: beliefs about what one will do, reasons for action, reasons for forming an intention, and intentional actions. See Mele 1995 on the connection between the second and third items.
54 2 Bratman (forthcoming) defends a related proposition: the agent cannot rationally deliberatively form the intention today, knowing that it would be better not to drink the toxin tomorrow. 3 I argue that this is not quite right in Mele 1992b: some possible intentions to A are not based on reasons to A. 4 Kavka describes these “strange people” as taking “pride in never releasing oneself from a promise to oneself, no matter what the circumstances” (pp. 34-35, my italics). But a resolute intender might specifically value acting later on intentions formed earlier when the circumstances that obtain at the time of action are the circumstances envisaged at the time of intention-formation. 5 Gilbert Harman (n.d.) suggests that an agent might win the money in Kavka’s scenario by forming (tonight) an intrinsic desire to drink the toxin tomorrow. Intrinsically desiring to drink the toxin, one might form an intrinsic intention to drink it and then drink it tomorrow simply for the sake of drinking it - unless the desire happens to fade away before noon. This proposal merits consideration, but I lack the space to pursue it here. 6 Notice that the applicability of Gauthier’s notion of intentional compatibility to the toxin puzzle depends on its being true that forming an intention (sometimes) is an action. If Tex’s forming the intention to drink the toxin is not an action, with what prior action of Tex’s is his drinking the toxin intentionally incompatible? (I regard forming an intention, as opposed to merely acquiring one, as an action. One forms an intention to A in deciding to A, and deciding to A may be construed as a mental action. See Mele 1992a, pp. 141, 158-60, 231.) 7 It might be thought (as Michael Bratman suggested to me) that the present case is equivalent to a standard toxin case in which the prize for intending is reduced to $100,000 and that it therefore poses no more gripping a problem for Gauthier’s view than Kavka’s puzzle does. However, a significant difference between the two cases is highlighted by your own reaction to the following question. Which of the following deals would you prefer to be offered? (A) Kavka’s standard toxin deal, except that the prize is reduced from a million dollars to $100,000; (B) the modified deal offered to Tex in the present case. 8 Sobel goes further, claiming that, by exercising the imagined capacity, the agent would have made it the case that drinking the toxin is “the best thing she could do by being the only thing she could do. She would have made it best and rational by default” (1994, p. 248). 9 I argue that this thesis of Kavka’s is false in Mele 1992b. 10 Kavka writes: “you cannot intend to act as you have no reason to act, at least when you have substantial reasons not [so] to act. And you have (or will have when the time comes) no reason to drink the toxin, and a very good reason not to” (p. 35). 11 For comments on a draft of this paper, I am grateful to Michael Bratman, John Heil, and Howard Sobel. REFERENCES Bratman, M. 1987. Intention, Plans, and Practical Reason. Cambridge: Harvard University Press. Bratman, M. (forthcoming). “Following Through with one’s Plans: Reply to David Gauthier.” In P. Danielson, ed. Modeling Rational and Moral Agents. Oxford: Oxford University Press. Gauthier, D. 1984. “Afterthoughts.” In D. MacLean, ed. The Security Gamble. Totowa: Rowman & Allanheld. Gauthier, D. 1994. “Assure and Threaten.” Ethics 104: 690-721. Gauthier, D. (forthcoming a). “Commitment and Choice.” In F. Farina, S. Vanucci, and F. Hahn, eds. Ethics, Rationality, and Economic Behaviour. Oxford: Oxford University Press. Gauthier, D. (forthcoming b). “Intention and Deliberation.” In P. Danielson, ed. Modeling Rational and Moral Agents. Oxford: Oxford University Press.
Rational Intentions and the Toxin Puzzle
55
Harman, G. (n.d.). “The Toxin Puzzle.” Written for a commemorative volume for Gregory Kavka to be edited by C. Morris and J. Coleman. Kavka, G. 1983. “The Toxin Puzzle.” Analysis 43: 33-36. McClennen, E. 1990. Rationality and Dynamic Choice. Cambridge: Cambridge University Press. Mele, A. 1992a. Springs of Action. New York: Oxford University Press. Mele, A. 1992b. “Intentions, Reasons, and Beliefs: Morals of the Toxin Puzzle.” Philosophical Studies 68: 171-94. Mele, A. 1995. “Effective Deliberation About What to Intend: Or Striking it Rich in a Toxin-Free Environment.” Philosophical Studies 79: 85-93. Sobel, J. H. 1994. Taking Chances: Essays on Rational Choice. Cambridge: Cambridge University Press.
56 John Heil The Propositional Attitudes
abstract Traditionally conceived, rational action is action founded on reasons. Reasons involve the propositional attitudes — beliefs, desires, intentions, and the like. What are we to make of the propositional attitudes? One possibility, a possibility endorsed by Donald Davidson, is that an agent’s possession of propositional attitudes is a matter of that agent’s being interpretable in a particular way. Such a view accounts for the propositional content of the attitudes, but threatens to undercut their causal and explanatory roles. I examine Davidson’s view and the suggestion that the explanatory value of appeals to propositional attitudes is best understood on analogy with measurement systems, and argue that, appearances to the contrary, this conception of the propositional attitudes can be reconciled with the idea that reasons are causes. Recent philosophy of mind has been preoccupied with the propositional attitudes: beliefs, desires, hopes, fears, intentions, and the like, insofar as these are taken to have ‘propositional content’. My having a belief is a matter of my taking up a particular sort of attitude toward a particular proposition.1 I might harbor the same attitude toward different propositions, in which case I have different beliefs; or I might have different attidudes toward the same proposition: I might believe, desire, hope, fear, or, if I am a rainmaker, intend that it will rain. One notable feature of the propositional attitudes is their fine-grainedness or definiteness. My believing that Socrates is wise differs from my believing that the husband of Xantippi is wise, even though Socrates is the husband of Xantippi. My beliefs inherit this feature — ‘intensionality’ — from the propositions: the proposition that Socrates is wise differs from the proposition that the husband of Xantippi is wise. How might we comprehend a connection between the propositional attitudes traditionally described, and our physical endowment? How might we do so in a way that enables us to see the capacity to take up attitudes toward
The Propositional Attitudes
57
propositions as an outgrowth of more primitive capacities? One possibility is that we cannot. It is a mistake to imagine that, in ascribing beliefs, desires, and intentions to one another, we are picking out, or purporting to pick out, items that have a kind of independent nonmental, physiological standing. I propose to make a start on locating views of this sort within our broader conception of the world and our place in it by considering Donald Davidson’s account of the propositional attitudes and the conditions under which they are correctly and reasonably ascribed.2 Davidson on the Propositional Attitudes According to Davidson, an understanding of beliefs, desires, intentions, or any other propositional attitude, must include a grasp of what is involved in the interpretation of speech. My ability to interpret your utterances is constituted by my possession of a theory of truth — a T-theory — for those utterances. A T-theory assigns truth conditions or meanings to sentences you utter or might utter.3 T-theories are modeled on theories of truth devised by Tarski for formal languages.4 Such theories generate, by means of finite sets of rules, a ‘Tsentence’ for every sentence in the language. T-sentences have the form (T)
S is true if and only if p,
where S is a description of a sentence uttered (or possible utterance), and p expresses that sentence’s truth conditions. If the language in which the theory is expressed includes the language to which the theory applies, the truth conditions of a sentence can be specified via the sentence itself. If, for instance, I advance a T-theory in English for utterances produced by an English speaker, Van, I might express the truth conditions for an utterance, by Van, of ‘Tigers are striped’ by using that very sentence: (T1)
‘Tigers are striped’ (uttered by Van) is true if and only if tigers are striped.
In this case, T-sentences will consist of a sentence inside quotation marks, followed by ‘is true if and only if’ followed by the sentence itself, ‘disquoted’.
58 Do not be put off by the apparent triviality of (T1). A T-theory must include resources for generating every sentence of the language to which it applies. My knowing the truth conditions of some sentence involves my having mastered a theory that implies a theorem of the form (T1), a T-sentence, for that sentence. Such a theory implies indefinitely many T-sentences, however. Thus, I understand your utterance of a particular sentence only if I am in a position to understand your utterance of indefinitely many sentences. On this view, my appreciating the meaning of a sentence requires not only that I appreciate the meanings of many sentences, but also that I grasp systematic relations among sentences of the sort represented by rules used to generate T-sentences. Davidson contends that to interpret your speech I must be in a position to associate meanings or truth conditions with your actual and possible utterances, and to do so systematically. But this is possible, he thinks, only if I am simultaneously in a position to decipher your propositional attitudes, your beliefs, desires, and intentions. You utter a sentence with a particular intention — to inform, to deceive, to amuse, to threaten — because of what you believe, what you take the sentence to mean, and what you hope to accomplish in uttering it. A theory of interpretation, an I-theory, provides an accounting of all these attitudes at once. To understand your speech I must understand what you believe and desire; and a grasp of your beliefs and desires requires that I understand your utterances.5 How might it be possible to break into this circle? Davidson’s suggestion is that interpretation depends on the attitude of ‘holding true’ applied to sentences.6 Without prior knowledge of your language or your beliefs and desires, I might ascertain that you hold a particular sentence true. This does not tell me what you mean in uttering this sentence, but it does constitute evidence for any hypothesis I might venture as to what you mean and what you believe. You will hold true the sentence ‘Tigers are striped’ just in case you believe that tigers are striped and you take the sentence to mean (or to be true if and only if) tigers are striped. In interpreting your speech, then, I begin with guesses about what you believe and what your utterances mean, and check these guesses against sentences I take you to hold true.7 The envisaged technique is based on an insight afforded by decision theory. Decision theory provides a formal account of choice or preference in terms of
The Propositional Attitudes
59
probabilities and utilities. The idea is that an agent’s preference for one course of action over one or more competitors is a function of the relative desirability of the actions’ outcomes and the probabilities associated by the agent with these outcomes. I must choose between going to the movies or going on a hike. The outcomes of these choices could have different utilities for me, and these utilities may be affected by a variety of possible circumstances. I enjoy hiking more than the movies, for instance, but not if it rains. My overall preference is determined by the relative utility or desirability of outcomes weighted by their probability. If the chance of rain is small, I opt for the hike; otherwise I choose the movies. Probabilities and utilities can be expressed numerically and decision theory can be given a precise formal expression. One consequence of the theory is that, given an agent’s preferences for various courses of action, it is possible to derive a unique assignment of probabilities and utilities for that agent. This makes it appear that decision theory is a straightforward empirical theory: we hypothesize probabilities and utilities — beliefs and desires — and test our hypothesis by noting agents’ preferences. The appearance is misleading. Decision theory at most provides a framework within which we can depict important structural features of human decision-making. In this respect it resembles coordinate systems or familiar systems of measurement — about which I shall have more to say presently. For the moment, I shall note only that, on Davidson’s view, an I-theory includes two components: (1) a Tarski-style theory of truth, a T-theory, and (2) a decision theory. Evidence for a theory of interpretation consists of agents’ attitudes toward sentences uttered, most particularly the attitude of holding true. Just as in the case of orthodox decision theory, agents’ beliefs and desires (construed as probabilities and utilities) are regarded as a function of their preferences, on a theory of interpretation, agents’ beliefs, desires, and meanings (truth conditions associated with sentences) are taken to be a function of what those agents hold true. In interpreting you, I advance a theory that ascribes to you a universe of beliefs, desires, and meanings, and is constrained by sentences I take you to hold true.
60 The I-theory I develop assigns ‘contents’ simultaneously to your utterances and to your propositional attitudes. I can adjust for apparently anomalous utterances by supposing that I am wrong about what you mean, or that you have a desire to deceive me, for instance, or that you are being ironic, or by supposing that you harbor a false belief. This might suggest that I-theories need answer only to a requirement of consistency. According to Davidson, however, propositional attitude ascriptions are governed by a Principle of Charity: I must count you right in most things. If I am attempting to discover what you believe and what your utterances mean, I cannot but suppose that your beliefs are largely true. Without this assumption, any consistent theory might be as good as any other. An I-theory must optimize the truth of your beliefs, then, while simultaneously making sense of your utterances. Astute readers will have guessed that, even given Charity, there is no guarantee that there must be a unique theory of interpretation for any speaker. Davidson regards ‘indeterminacies’ of this sort as enevitable, but benign. Two theories of interpretation that are equally charitable and that are consistent with all an agent’s preferences are merely ‘notational variants’ of one another. The situation resembles that in which temperature is assessed in Fahrenheit or Celsius. I say that water freezes at 32° F, you contend that it freezes at 0° C. Which assessment is correct? The question assumes what is false, namely that there is some definite feature of the world concerning which the two assessments might differ. Rather they are simply two ways of describing the same thing. In this respect, Davidson’s conception of interpretation is to be distinguished from those advanced by other theorists. Thus Quine’s account of radical translation leaves open the prospect of more far-reaching indeterminacies. As a result, Quine argues that, where meanings and propositional attitudes are concerned, there are no ‘facts of the matter’.8 I have described Charity as mandating that we ascribe beliefs to agents in such a way as to optimize the truth of those beliefs. In practice, this means that I ascribe beliefs to you in such a way that they come out mostly true by my lights: I make your beliefs consistent with my beliefs as nearly as possible. But now we confront an apparent difficulty. There is an obvious difference between what is true and what I believe to be true. Suppose that many — or
The Propositional Attitudes
61
most — of my beliefs were false. Then, my Charitable interpretation of many of your beliefs would make your beliefs false as well. Davidson argues, however, that this way of thinking about the matter misses an important feature of Charity. Consider my beliefs. The beliefs I actually have are those that would be ascribed to me by an interpreter who knew all there was to know about me and my circumstances, an interpreter in possession of all the evidence, an ‘omniscient interpreter’.9 This is just to say that my beliefs must in fact be optimally true. And if my beliefs are of necessity optimally true, then there is no deep difference between my ascribing beliefs to you in such a way that they are consistent with mine and my ascribing beliefs to you in such a way that they optimize truth. Could this be right? Perhaps; so long as we take seriously Davidson’s perspective on belief ascription. The objects of particular beliefs are, Davidson supposes, fixed in part by their causes. My belief about a tree concerns a particular tree because it is caused by that tree. In ascribing beliefs, then, we identify their causes. We can of course be wrong about these, we can misascribe beliefs. But it cannot be the case that an ascriber’s beliefs are mostly false. They concern their causes, quite independently of what anyone, including the believer, takes these causes to be.10 This is just a more prosaic way of saying that the beliefs I, as ascriber, possess are those that would be ascribed to me by an omniscient interpreter. How plausible is it to imagine that beliefs concern their causes? It is surely possible for a bump on the head to cause me to believe that Napoleon died in battle. The cause of this belief is a bump on the head, yet my belief concerns, not the bump, but Napoleon. It is central to Davidson’s view, however, that beliefs cannot be ascribed singly. In ascribing a particular belief to me, you implicitly ascribe ‘endless’ other beliefs, those beliefs, namely, implied by the I-theory you invoke. It is this holistic edifice that must satisfy Charity and the demand that the objects of beliefs are fixed by their causes. A correct theory of interpretation can accommodate anomalous belief against a background of nonanomalous belief. All things considered, then, an I-theory that depicts me as having acquired a belief about Napoleon as a result of a bump on the head could easily be more
62 parsimonious than a theory that ascribes to me a belief about a bump on the head. Propositional Attitude Ascription on the Model of Measurement11 Consider what is involved in the explanation of a phenomenon or domain of phenomena. Explanation takes many forms. An explanation purports to make clear, or make sense of, or facilitate our grasp of something we want to understand. One familiar sort of explanation is decompositional: we come to understand wholes by seeing how their parts fit together and interact. I come to understand heat by recognizing that heating an object agitates its constituent molecules, and this agitation is transmitted to adjacent molecules — from the hot sand on the beach to the soles of my feet. We grasp the operation of a clock, or a machine that wraps candy bars, or a cold front, or liquidity by discovering the mechanism responsible for the behavior of clocks, candy wrapping machines, cold fronts, and liquid substances. In these cases we come to understand the mechanism by seeing how it works, how its parts interact with one another and and with their surroundings to produce a particular kind of outcome. Mechanistic explanation of this sort is common in the sciences, and in engineering, medicine, and everyday life. Another sort of explanation, a sort much beloved in psychology and the philosophy of mind, is functional explanation. In giving a functional explanation, I abstract from physical details of a mechanism and consider it exclusively in terms of the causal roles of its constituents. We can describe the operation of a steam engine, or a computing machine, or the digestive tract of a human being without concern for the ‘physical implementation’ or ‘realization’ of these things. Consider another way of understanding a domain of objects, one that can be gained by providing a perspicuous description of the domain’s structure. This can be accomplished by overlaying the domain with another domain whose structure is antecedently well understood. We employ calibrated yardsticks, balances, and meters in describing the lengths, weights, and temperatures of objects. Similarly, we comprehend features of the surface of our planet by imposing a coordinate structure on it. Once in place, this system
The Propositional Attitudes
63
of coordinates enables us to specify areas, distances, and relative locations of objects and occurrences on the planet’s surface. It enables us, as well, to offer certain sorts of prediction. If I know the velocity of an object moving across the surface of the planet and I know its location at a time, I can predict its location at some future time. If I know the location of an object and its distance and direction from another object, I can fix the location of the second object. Coordinate systems represent a special case of measurement, the application of the domain of numbers to a domain of objects or properties. When we describe an object as twelve feet long or as weighing 110 pounds, what features of the object correspond to these numbers? The question is misleading. Ordinary physical objects in ordinary settings exhibit a relatively enduring structure that lends itself to description via axiomatizable systems of numbers. The structure of these descriptive systems, the relations among their elements, is crucial; the particular elements that make them up are in one respect arbitrary. We can express weights in pounds or kilograms, length in feet or meters. What is important is that the numbers we choose, and the axioms governing their combinations, exhibit an appropriate structure. Consider the use of a coordinate system in mapping the surface of the Earth. My choice of a system is, in part, arbitrary. I might use a Mercator projection or a spherical projection, for instance. Notice that a geographical region appearing in a Mercator projection may look very different from the same region represented in a spherical projection. I can recall being baffled as a child by the apparent difference in the relative size of Greenland on the globe in the front of my fourth grade classroom and on the large map on the wall above the blackboard. On the one, Greenland seemed to be only a little larger than Texas; on the other it appeared nearly as big as the whole of North America. I wondered how large Greenland was really; both maps could not be right.12 But of course both maps were right. My mistake was to compare objects on one map with objects on another without taking into account that the mapping systems, though structurally isomorphic, were different. The example provides a nice illustration of what, according to Davidson, indeterminacy of interpretation amounts to. Distinct I-theories might appear to
64 ascribe different beliefs or meanings to an agent, yet each theory could be correct. It need not follow that there is no ‘fact of the matter’ as to what the agent believes, however, any more than it follows from differences in maps of the sort mentioned above that there is no fact to the matter as to the relative size of Greenland. The appearance of mystery comes from comparing items across systems without taking into account the systems to which those items belong. Let us say, then, that the structure and point of I-theories is analogous to that of coordinate systems. We know in advance that anything describable via such a system must have certain properties. In the case of a coordinate system, if one object, A, is to the northwest of B, and B is to the northwest of C, then A is to the northwest of C. Objects that fail to satisfy such conditions cannot usefully be represented in such systems and could not be said to have straightforward locations. In the case of an I-theory, if an agent prefers A to B and B to C, then the agent prefers A to C. Creatures who failed to satisfy this condition — not in the sense that they exhibit intransitive preferences, but in the sense that they fail to exhibit anything identifiable as an appropriately transitive repertoire of choices — would not satisfy an I-theory and could not be said to have straightforward preferences.13 If we are to avoid confusion, we must distinguish internal constraints on an I-theory (or a coordinate system) and descriptions of agents (or geographical regions) in terms of the theory (or coordinate system). In deploying a coordinate system, I make use of a well-behaved geometrical structure the features of which can be described quite independently of features of the world on which it is imposed. Similarly, in deploying an I-theory, I make use of a framework that can be characterized abstractly and independently of its applications. In applying coordinate systems or I-theories, we overlay one domain of objects with a structure that reveals structure in the target domain. The target domain itself exists independently as do the objects and properties that make it up. Nevertheless our description of this domain reflects both those independent features and features of the coordinate system or I-theory in terms of which those features are described. And we must not mistake features of the one for features of the other. To do so would be like mistaking latitude and
The Propositional Attitudes
65
longitude lines on a map for physical features of the terrain. If Davidson is right, then imagining that talk of the propositional content of beliefs, desires, and intentions is talk about mechanistic components of agents is to make a mistake of this sort. Consider a simple geographical truth, Milwaukee’s being north of Chicago. The truth depends on the application and orientation of a coordinate system and on system-independent features of a particular region of our planet. Imagine now that you correctly ascribe the belief that tigers are striped to me. The truth of this ascription turns on the application of an I-theory and on theory-independent features of me, ultimately my dispositional makeup. On Davidson’s view, I possess beliefs with settled propositional contents in something like the way cities possess locations. We do not imagine that locations have distinctive physical ‘realizations’ (or that they are ‘multiply realizable’), nor are we tempted to suppose that if locations are not physical, they must be nonphysical. The same holds for the propositional contents of beliefs, desires, and intentions. We ascribe propositional attitudes to agents whose behavior (actual and potential) accords with those ascriptions. One possibility is that it so accords because the ascriptions, if correct, pick out components of a mechanism responsible for the behavior. But there may be no need to suppose this. Propositional attitude ascriptions and the I-theories that license such ascriptions, need not provide quasi-mechanistic explanations of behavior any more than talk of the location of a city or the direction in which it lies from some other city provides a geologically illuminating assessment of the terrain. If this is so, then the kind of explanation of agents’ intelligent behavior we obtain in reckoning their beliefs, desires, and intentions is not functional, mechanical, or decompositional explanation, but one the success of which stems from its exposing and describing in a systematic way the structure of a complex phenomenon. Such explanations have predictive force, not because they reveal hidden mechanisms, but because they apply to potential utterances and deeds, as well as to actual utterances and deeds. More accurately: propositional attitude explanations illuminate, and thus partly explain, the structure of certain sorts of dispositional system. These explanations work, not
66 because they pinpoint the gears and levers in the underlying mechanism or because they uncover an isomorphism between interpretive elements and components of the mechanism; they work because they reveal a structured system of dispositions describable by means of a relatively well understood domain, a domain plotted in theories of truth and decision theories. Putting all of this together, we can say that, to the extent that we can be subjects of propositional attitude ascriptions, our behavior, or rather the dispositional basis of our behavior, accords with a particular sort of theory. Its so according yields a kind of explanation of it. The explanation is not mechanical or decompositional, or functional, however, it differs in kind from such explanations. A mistake made by philosophers of mind and by some psychologists is to imagine that an I-theory describes a mechanism, perhaps at a functional ‘level’, components of which correspond to elements of the theory. Mental Causation and the Propositional Attitudes A difficulty remains. I have suggested that explanations that appeal to the propositional attitudes are nonmechanistic. Such explanations illuminate human behavior by invoking a structure defined by an appropriate I-theory. But if this, or something like it, is Davidson’s view, it would seem to be at odds with another idea of Davidson’s, the idea that reasons are causes: beliefs, desires, and intentions explain actions only insofar as they are causes of those actions. Suppose I (successfully) explain your flipping the switch by ascribing to you a desire to illuminate the room and a belief that by flipping the switch you will illuminate the room. Suppose, as well, that the success of an explanation of this sort does not depend on my having identified constituents of an internal mechanism responsible for your flipping the switch. Although the success of my explanation undoubtedly depends on your neurological condition (and on much else besides), its success need not depend on there being a correspondence between components of my explanation, particular propositional attitudes, and particular kinds of neural state or event. Even if my explanation is correct, then, this implies nothing about the character of the mechanisms responsible
The Propositional Attitudes
67
for your behavior — other than that they must be such that they are capable of producing behavior of this sort. Still, there is an important causal ingredient in my explanation. It is part of the explanatory framework invoked when we appeal to beliefs, desires, and intentions that an agent can have a reason, R, to perform a particular action (where a reason consists of a belief–desire pair), and perform the action for a reason, but not perform the action for reason R. In this case, R does not account for the agent’s behavior because it is not part of the agent’s reason for doing what he does. Imagine that you want to illuminate the room, and believe that you can illuminate the room by flipping the wall switch in front of you. Suppose, in addition, that you want to exercise your finger and believe that you can exercise it by flipping the switch. In this case you might act in order to exercise your finger: you flip the switch because you want to exercise your finger, and not because you want to illuminate the room. And it is hard to understand the ‘because’ here noncausally. Indeed the role of propositional attitudes in explanations of behavior appears to be through and through causal: propositional attitude explanations of actions are explanations in terms of reasons, and reasons are causes. I think this is largely right, although its being right need not be due to belief and desire ascriptions — ascriptions of reasons — picking out pieces of the causal mechanism responsible for our doing what we do. What we do depends on the dispositional character of our bodies. This dispositional character is what ultimately licenses ascriptions of beliefs and desires. Remember: we are supposing that the ascription of propositional attitudes involves the application of something like a theory of interpretation, an I-theory. This theory provides a perspicuous description of a complex dispositional system. Reflect for a moment on the implications of a view of this sort. Dispositions can exist, can come and go, without being manifested. An object can possess distinct dispositions the manifestation of which in the object’s behavior would be indistinguishable. One of these dispositions could be manifested without the others being manifested. An object might possess two distinct kinds of property, P1 and P2, each of which, in concert with the object’s
68 other properties (and properties of objects nearby) disposes the object to turn green when heated. When the object is heated and, as a result, turns green, this might be due to P1, or to P2, or to both. We may have trouble discovering whether P1 or P2 or both P1 and P2 are responsible for the change of color, but that is another matter. Now, what of action? I explain an action, your flipping the switch, by citing your desire to exercise your finger. In so doing (as we are supposing), I explain your behavior by reference to an elaborate framework provided by a theory of interpretation, an I-theory. Your behavior satisfies this theory. But note: an I-theory according to which you act on your desire to exercise your finger differs from an I-theory according to which you act on your desire to illuminate the room. True, your behavior here and now, your flipping the switch, accords with either theory. But this is only part of what the theories address. I-theories range over dispositional systems. And the dispositional makeup of an agent whose behavior accords with the first theory differs from the dispositional makeup of an agent whose behavior accords with the second theory. There is an epistemological hurdle to be negotiated in discovering which theory is correct, but, as in the case of ordinary, nonmental dispositional systems, that is another matter. Explanations that appeal to propositional attutudes are sensitive to dispositional, hence causal, differences in agents whose behavior they endeavor to explain. This need not, however, depend on the presence of a one–one correspondence between propositional attitudes and bodily components. In the ordinary case, your desire, D, explains your behavior only if you would not have behaved as you did had you lacked D. This is because, were you such that you lacked D, were you such that an I-theory ascribing D to you would not be correct, your dispositional condition would have been such that you would not have behaved as you in fact behaved. What of a case like that of your flipping the switch in which you have two desires, D1 and D2, either of which would account for your behavior, but in which you act on one of these desires, D1, and not the other? In such cases, it might well be false that had you not possessed D1, you would not have behaved as you in fact behaved. Had you lacked D1, you might still have had D2, and D2
The Propositional Attitudes
69
might have accounted for your behavior. The example provides a reminder that the use of counterfactual and subjunctive conditionals to capture dispositional characteristics of objects yields unsatisfying results.14 We must appeal to actual dispositional differences between the two cases. Consider two agents, A1 and A2, both of whom harbor D1 and D2. Suppose that both behave in a particular way (both move their fingers, for instance), yet A1 acts on D1 and A2 acts on D2. A1 and A2 differ dispositionally, and it is in virtue of these differences that A1 and A2 satisfy distinct I-theories. Conclusion I have been examining the idea that ascriptions of propositional attitudes and the explanation of behavior by reference to propositional attitudes is a matter of superimposing a structure on a complex domain in a way that makes salient a structural component of that domain. In this respect, the ascription of beliefs and desires resembles my ascription of temperature, or length, or location. In each case, I invoke a descriptive framework whose structure is fine-grained, orderly, and well understood. In the case of temperature and length, I exploit the properties of numbers axiomatized in simple systems. In the case of the propositional attitudes, I exploit semantic features of the sentential structure of my language in concert with a theory of rational choice. Like explanations generally, explanations that appeal to the propositional attitudes are projective, hence predictive. This is due not to their encompassing a mechanism responsible for behavior, however, but to their applying to agents in virtue of those agents’ overall dispositional structure. We are apt to be mislead by our everyday practice of explaining the behavior of an agent on a particular occasion by ascribing to that agent individual beliefs, desires, and intentions. This makes it appear as though components of the agent correspond to each of these. If Davidson is right, however, individual propositional attitude ascriptions are grounded in an implicit theory of interpretation. An ascription of a belief, desire, or intention is correct just in case it is implied by an I-theory satisfied by the agent. This suggests a parallel with measurement and our use of coordinate systems. In measuring the lengths of particular
70 objects, we import an axiomatized system of numbers; in locating objects in space, we impose a system of coordinates. We can make nothing of lengths or locations independently of such systems. It is fashionable nowadays to call the practice of ascribing propositional attitudes ‘folk psychology’. Folk psychology, like folk medicine, is useful, even indispensable. Neither folk practice, however, reveals details of the underlying mechanism. Nor does the apparent success of either practice depend on its revealing such details. This does not mean that folk psychology is ripe for replacement (or elimination) by neuroscience. Folk psychology and neuroscience are not competitors, any more than cartography and geology are competitors. Notes 1 I know of no simple way to characterize propositions. Propositions might be abstract entities, sets of possible worlds, states of affairs, or something else altogether. Some philosophers who speak of the propositional attitudes contend that talk about propositions can be rephrased and replaced by talk about something else. For purposes of discussion here, the notion of a proposition can be left at an intuitive level. (Just for the record: anyone who takes propositions to be abstract entities owes us an account of how human beings could interact with such things. 2 My discussion of Davidson’s views draws on papers reprinted in his Inquiries into Truth and Interpretation (Oxford: Clarendon Press, 1984), especially ‘Radical Interpretation’, ‘Belief and the Basis of Meaning’, and ‘Reality without Reference’; see also ‘Psychology and Philosophy’, reprinted in Essays on Actions and Events (Oxford: Clarendon Press, 1980). 3 The gap between intuitions concerning a sentence’s meaning and the conditions under which it is true is narrowed when we consider that theories of truth yield truth conditions systematically for every sentence in a language. (For convenience, I shall speak of languages here, although Davidson mentions only actual and possible utterances.) Natural languages include an infinite number of sentences, and theories of truth are finite. As a result, a theory of truth must make use of the compositional structure of language. Sentences are made up of elements that appear in other sentences. The truth conditions (or meanings) of sentences depend on these elements and their arrangement. If it is possible to give a Tarski-style truth theory for a natural language (a big if), Tsentences implied by that theory should mirror native speakers’ judgments about meaning. 4 See Alfred Tarski, ‘The Concept of Truth in Formalized Languages’, in Logic, Semantics, and Metamathematics, (Oxford: Clarendon Press, 1956). 5 One consequence of such a view is that only creatures capable of linguistic utterances could be subjects of propositional attitudes. See ‘Thought and Talk’ in Inquiries into Truth and Interpretation. 6 Here, and in what follows, sentences are taken to be sentences uttered on particular occasions, utterances. 7 Pace some theorists, this does not imply that you must be truthful. I might discover that, for any sentence, p, in general you hold true not-p when you utter p. In this respect, it is useful to distinguish Quine’s notion of ‘assent’ to sentences from the attitude of holding true; I can and do assent to what I do not hold true.
The Propositional Attitudes
71
8 It is not that Davidson is just more optimistic than Quine. Davidson-style theories of interpretation leave less latitude in the assignment of meanings than theories of translation of the sort promoted by Quine. Whereas Quine supposes that translation obliges us to read the apparatus of truth functional sentential logic into the target language, Davidson’s appeal to Tarski-style theories of truth brings with it the whole of first-order logic with identity. Quine’s account of radical translation appears in the first two chapters of Word and Object, (Cambridge: MIT Press, 1961). 9 The omniscient interpreter is introduced in ‘A Coherence Theory of Truth and Knowledge’ in Ernest LePore, ed., Truth and Interpretation: Perspectives on the Philosophy of Donald Davidson (Oxford: Blackwell, 1986). 10 This way of putting it is slightly misleading. Every belief has endless causes. The cause of a belief, the cause that fixes its content, depends on which cause is salient to an interpreter. The interpreter is thus ineliminable in Davidson’s theory. 11 Many of the ideas in this sesction surfaced as part of an earlier attempt to explicate Davidson in Perception and Cognition (Berkeley: University of California Press, 1983), chap. 7. 12 My teacher’s explanation: the wall map was larger than the globe. 13 Preferences can change, of course, and so can the locations of objects. The assumption here is that we are considering only time-slices of domains. 14 See C. B. Martin, ‘Dispositions and Conditionals, The Philosophical Quarterly 44 (1994): 1–8.
72 Volkmar Taube Exemplifikatorische Darstellung: Zu den Grundlagen einer kognitiven Ästhetik
abstract After having introduced Goodman’s concept of exemplification I discuss his general argument that exemplification would be the best for comprehensible the expressive phenomena of art. But there will arise problems when making differences between features of works of art which are exemplified and which are not, and when reconstructing the variable forms of autoreflexive expressions. I try to demonstrate that Goodman’s concept of exemplification therefore ist too limited: 1. Goodman doesn’t take into account that the caracteristics of works such as colours, form etc. also can be interpreted as materials of artistic expressions. 2. He doesn’t give any idea to solve the question what would make an exemplification work effectively. Therefore I suggest to reformulate the concept of exemplification. Die Exemplifikation ist eine uns vertraute Form der Darstellung. Fragt uns ein ausländischer Besucher, welche Farbe eine deutsche Telefonzelle hat, können wir ihm eine sprachliche Beschreibung geben - oder ihm eine Telefonzelle zeigen. Wenn ich mich für die letztere Form der Mitteilung entscheide, weise ich einem Alltagsgegenstand eine Symbolfunktion zu: Die Telefonzelle wird zum Beispiel für die Farbe einer Klasse von Gegenständen und auf diese Weise zu einem Mittel einer Darstellung. Nelson Goodman hat bekanntlich die These vertreten1, daß die “Exemplifikation” genannte symbolische Beziehung eine zentrale Bedeutung für die Theorie der Künste hat. Er konnte dabei an den etablierten Sprachgebrauch anknüpfen, demzufolge auch Kunstwerke, die weder etwas beschreiben noch etwas abbilden, eine darstellende Funktion haben, nämlich etwas ausdrücken können. Goodmans Ausdruckstheorie, so fruchtbar sie im Ansatz ist, leistet aber bei der Rekonstruktion des künstlerischen Ausdrucks nicht das, was sie verspricht. Im folgenden soll gezeigt werden, warum das so ist. Doch betrachten wir zuerst den alltäglichen Fall der Exemplifikation etwas näher.
Exemplifikatorische Darstellung
73 1.
Die Exemplifikation ist eine symbolische Beziehung. So könnte die Telefonzelle aus unserem Beispiel alle möglichen ihrer Eigenschaften exemplifizieren: ihre Materialeigenschaften, ihr Design, ihre Größe. Tatsächlich exemplifiziert wird aber nur ihre Farbe. Oder stellen wir uns einen Stein in der Vitrine eines Geologiemuseums vor. Er exemplifiziert (je nach Kontext) gewisse oder auch alle seine geologisch relevanten Merkmale, nicht jedoch irgendwelche anderen z.B. wie zufällig der Kopf eines Lebewesens auszusehen. Wie die beiden Beispiele zeigen, findet bei der Exemplifikation eine Auswahl statt: Aus der Menge der vom Symbol besessenen Eigenschaften wird eine Teilmenge von Eigenschaften ausgewählt und zum Gegenstand der Darstellung gemacht. Da die Exemplifikation ersichtlicherweise keine natürliche Beziehung ist, sondern von der Intention des Symbolverwenders abhängt, wie im Falle der Ostension, oder von Konventionen, wie im Falle eines institutionalisierten Kontextes, scheint es angemessen, Goodmans Vorschlag zu folgen und die Exemplifikation als eine Spielart der Bezugnahme aufzufassen. Gegen die Auffassung, ein roter Gegenstand könne auf ähnliche Weise die Eigenschaft Rot bezeichnen wie das Wort “Rot”, scheint erst einmal nichts einzuwenden zu sein. Zwischen beiden Formen der Symbolisierung können wir ja leicht an Hand der verwendeten Symboltypen unterscheiden. Anderseits: Wie können wir Exemplifikation von Abbildung unterscheiden? Denn wie Goodman zeigen konnte, können wir Abbildung, bzw. Repräsentation im allgemeinen, ebenfalls als Bezugnahme verstehen. Sollen wir also sagen, Exemplifikation sei eine Unterart der Abbildung? Das widerspricht aber unserem üblichen Gebrauch von “Abbildung”: Von einem Farbmuster zu sagen, es sei eine Abbildung der betreffenden Farbe, klingt unpassend. Goodman hat den plausiblen Vorschlag gemacht, die Rede von exemplifizierten Eigenschaften oder Merkmalen durch die Rede von exemplifizierten Worten zu ersetzen. Demnach exemplifiziert das rote Farbmuster nicht die Eigenschaft der Röte, sondern das Wort “rot”. Exemplifikation ist damit Bezugnahme auf ein denotierendes Symbol. Während
74 in der Repräsentation und der Beschreibung die Bezugnahme vom Symbol zum Objekt verläuft, läuft Sie in der Exemplifikation in die andere Richtung - vom Objekt hin zum denotierenden Symbol. Nicht nur wegen der Möglichkeit, die Exemplifikation von der Denotation abzugrenzen, ist Goodmans Vorschlag fruchtbar. Betrachten wir den Fall eines obduzierten Hundes, der seine Eigenschaft, ein Lebewesen mit Nieren zu sein exemplifiziert. Wir erwarten zurecht, daß er, wenn er als Beispiel für ein Lebewesen mit Nieren vorgestellt wird, nicht gleichzeitig als ein Beispiel für ein Lebewesen mit Herz vorgestellt werden muß. Andererseits wissen wir, daß die Klasse der Lebewesen mit Nieren identisch ist mit der Klasse der Lebewesen mit Herz. Was also tun, ohne neben Klassen noch Eigenschaften in unser Universum aufnehmen zu müssen? Die Vorstellung, Gegenstände der Exemplifikation seien Wörter, bietet uns eine Lösung. Denn es ist klar, daß sich die Ausdrücke, die wir zur Bestimmung des vermeintlichen Eigenschaftsunterschiedes heranziehen, als Beschreibungen voneinander unterscheiden und daher in der Exemplifikation einen Unterschied ergeben. Der Einwand gegen die Auffassung, Gegenstände der Exemplifikation seien Wörter, liegt auf der Hand: Die Sprache ist nicht ausdrucksstark genug, um alle möglichen sichtbaren Eigenschaften eines Gegenstandes zu bezeichnen. Goodman hat deshalb vorgeschlagen, auch nichtsprachliche Symbole als Objekte der Exemplifikation zuzulassen. Das erhöht offensichtlich den Ausdrucksreichtum, garantiert aber immer noch nicht, daß alle sichtbaren Merkmale eines Gegenstandes bezeichnet werden können - schließlich kann man nicht erwarten, daß für alle wahrnehmbaren Eigenschaften geeignete Repräsentationen verfügbar sind. Goodman macht deshalb einen weiteren Vorschlag: Repräsentationen können auch in den exemplifizierenden Symbolen selbst gefunden werden. Im Falle eines nichtverbalisierbaren Farbtons könnte der rote Gegenstand sich selbst als Repräsentation des besagten Rottons exemplifizieren. Wäre das exemplifizierende Symbol ein farbiges Rechteck auf einer Farbmusterkarte, würde sich dieses Rechteck als Repräsentation des Rottons exemplifizieren. Objekte der Exemplifikation können auch Eigenschaften sein, die dem Exempel nur metaphorisch zugesprochen werden können. Wie Goodman
Exemplifikatorische Darstellung
75
überzeugend zeigen konnte: Wenn wir einen mathematischen Beweis elegant, eine verblühende Blume traurig oder eine Maske im Völkerkundemuseum dämonisch nennen, beanspruchen wir, eine wenn auch nicht wörtlich, so doch metaphorisch wahre Aussage zu treffen. Wenn es aber nicht nur Eigenschaften gibt, die dem Gegenstand wörtlich, sondern auch solche, die ihm metaphorisch zugesprochen werden können - warum können wir dann nicht auch davon ausgehen, daß ein Gegenstand, neben Eigenschaften wie rot zu sein, auch Eigenschaften wie dämonisch zu sein exemplifizieren kann? Goodmans fruchtbarer Vorschlag, neben einer wörtlichen, auch von einer metaphorischen Exemplifikation zu sprechen, gibt uns also schließlich auch die Möglichkeit an die Hand, Fälle wie die einer Traurigkeit ausdrückenden Blume als Fälle von Exemplifikation zu behandeln. 2. Goodman meint nun, daß auch Kunstwerke exemplifizieren und daß der Begriff der Exemplifikation uns hilft, manche Rede über das, was uns Kunstwerke “vermitteln”, als Rede über exemplifizierende Symbole zu rekonstruieren. Er knüpft dabei an den Alltagsgebrauch des Wortes “Ausdruck” an. So sprechen wir davon, daß Bilder, Skulpturen, Gedichte usw. etwas ausdrücken: Mut, Freude, Aggressivität usw. Wie Goodman richtig gezeigt hat, kann solche Rede nicht als Ausdruck des Innenlebens des Künstlers aufgefaßt werden. Aber, wie sollen wir Ausdruck dann verstehen? Wie wir gesehen haben, könnten wir ihn als metaphorische Exemplifikation rekonstruieren: Eigenschaften, die nur metaphorisch vom Objekt besessen werden, werden exemplifiziert. Dieser Vorschlag hat etwas Bestechendes. Zum einen bietet er eine weniger mysteriöse Erklärung für Ausdruck als die naive psychologische Erklärung unter Rekurs auf das Innenleben des Künstlers. Zum andern wird er dem Umstand gerecht, daß Kunstwerke weit mehr als nur psychologisch deutbare Eigenschaften ausdrücken können. Denn Eigenschaften wie Lebendigkeit, Dynamik, Schwung, Fiebrigkeit - samt und sonders bloß metaphorische Eigenschaften eines Kunstwerkes - gehören nicht zu ihnen, sind aber gleichwohl Eigenschaften, die sinnvollerweise von Kunstwerken zum Ausdruck gebracht werden
76 können. Für Goodmans These, Exemplifikation trage der Wirkungsweise von Kunstwerken Rechnung, spricht auch, daß wir auch vom Ausdruck eines Kunstwerkes sprechen, wenn es um nichtmetaphorische Eigenschaften geht. Beispielsweise sprechen wir davon, daß ein Gebäude seine Funktionalität, ein Gemälde seine klare Formgliederung oder eine Bewegung Schnelligkeit zum Ausdruck bringt. Eine nähere Betrachtung der These, der am Alltagsfall der Exemplifikation gewonnene Begriff der Exemplifikation stelle eine adäquate Rekonstruktion des für die Kunstheorie so wichtigen Ausdrucksbegriffes dar, konfrontiert uns allerdings mit einer Reihe von Problemen. Wenden wir uns im folgenden diesen Problemen im einzelnen zu. Der Alltagsfall der Exemplifikation läßt sich als ein Fall des Probe-Nehmens verstehen. Die Telefonzelle, die ich dem ausländischen Besucher zeige, wie auch das Stoffmuster im Schaufenster des Schneiders, fungieren als Probe für die Beschaffenheit einer ganzen Klasse von Gegenständen. Eine Probe ist nur dann “richtig gezogen”, wenn ihre Merkmale repräsentativ sind. Wie steht es hiermit im Fall des Ausdrucks? In welchem Sinn können wir hier Repräsentativität erwarten? Nehmen wir den Fall eines Gemäldes, von dem wir sagen, es drücke die Atmosphäre von Feierlichkeit aus. Es gibt viele Beispiele von Bildern (oder anderen Gegenständen), die diese Eigenschaft ausdrücken. Wollen wir also sagen, daß unser Bild repräsentative Merkmale von Feierlichkeit ausdrückenden Bilder (oder anderen Gegenständen) besitzt, so daß es als gute Probe einer Klasse von Bildern (oder von Feierlichkeit ausdrückenden Objekten allgemein) angesehen werden kann? Offensichtlich führt das am Problem des Ausdrucks vorbei. Ausdruck durch Kunstwerke dient nicht dazu, Bekanntes lediglich zu illustrieren. Vielmehr ist es so, daß wir, wenn wir von ausgedrückten Merkmalen sprechen, wissen wollen, inwiefern hier etwas auf eine interessante, aufschlußreiche bzw. neuartige Weise ausgedrückt wird. Wir fragen folglich nicht nur nach dem Inhalt des Ausdrucks, sondern auch nach der Form, also - wenn wir hier von Exemplifikation sprechen wollen - nicht nur nach den exemplifizierten Eigenschaften, sondern auch nach der Art und Weise, wie diese Eigenschaften “vermittelt” werden. Wir sehen sofort, daß zur Beantwortung der letztgenannten Frage die Analyse der Alltagsexemplifikation bisher nichts
Exemplifikatorische Darstellung
77
beigetragen hat: Die ästhetisch zentrale Frage, wie etwas Bekanntes auf neue und interessante Weise exemplifiziert werden kann, ist für das Verständnis alltäglicher Formen von Exemplifikation unerheblich. Die alltäglichen Formen der Exemplifikation beinhalteten eine Selektion: Nicht alle, sondern nur einige der vom Symbol besessenen Eigenschaften werden exemplifiziert. Goodman hebt hervor, daß dies auch für die Exemplifikation in den Künsten zutrifft: Lediglich eine begrenzte Menge von Eigenschaften des Kunstwerks werden hier exemplifiziert. Es stellt sich die Frage, welche vom Kunstwerk besessenen Eigenschaften nicht exemplifiziert werden. Man könnte mit Goodman an die folgenden, typischerweise in ästhetischen Kontexten irrelevanten Eigenschaften denken: eine bestimmte Molekularstruktur zu besitzen, soundsoviel Kilogramm zu wiegen, bei bestimmten Beleuchtungsverhältnissen entstanden zu sein usw. Ähnlich wie die geologische Steinprobe in der Vitrine eines Museums nur die geologisch relevanten Eigenschaften exemplifiziert, exemplifizieren Kunstwerke nur die ästhetisch relevanten Eigenschaften. Goodman geht aber einen Schritt weiter. So behauptet er, daß Meinungsverschiedenheiten zwischen Kunstkritikern häufig die Frage betreffen, welche Eigenschaften eines Werkes exemplifiziert und welche nicht exemplifiziert werden. Sicher glaubt Goodman nicht, daß es unter Kunstkritikern strittig ist, welche Eigenschaften dem Typ nach für künstlerischen Ausdruck relevant oder irrelevant sind. Wenn er also annimmt, daß Kontroversen in der Interpretation eines Werkes auf die Frage zurückzuführen sind, welche Eigenschaften vom Werk exemplifiziert und welche nicht exemplifiziert werden, muß er annehmen, daß es Eigenschaften eines Kunstwerkes gibt, die zwar typischerweise , nicht aber im gegebenen Fall für das Verstehen des Werkes relevant sind. Vermutlich hat Goodman einen Alltagsfall der Exemplifikation wie den folgenden im Auge. Stellen wir uns vor, ein Kunde betritt den Laden unseres Schneiders und fragt, welche Farbe der Stoff von angebotenen Stoffballen hat. Der Schneider antwortet dem Kunden, indem er ins Schaufenster greift und die Stoffprobe, die hier Farbe und Webart exemplifiziert, nun als Probe nur für die Farbe verwendet. Für das Verstehen dessen, was exemplifiziert wird, reicht es also nicht aus zu wissen, was die
78 Stoffprobe kraft institutionellem Rahmen exemplifiziert: Die vermittelte Information ist durch Ostension spezifischer geworden. Bisher hat Goodman kein einziges überzeugendes Beispiel vorlegen können, das uns belegt, daß ein solcher Fall von Exemplifikation auf Kunstwerke übertragbar wäre. Man könnte vielleicht an die Ähnlichkeit eines Portraits denken, die für die Interpretation nicht zählt, weil das Bild nicht ausdrücklich eine Abbildung von jemandem sein will, sondern nur ein Portrait im allgemeinen (z.B. Leonardos Mona Lisa). Oder an eine Plastik, bei der das Gewicht des verwendeten Materials nicht anschaulich in Erscheinung treten soll. (Man beachte: Es gibt Plastiken, bei denen das anders ist, z.B. bei vielen Plastiken von Richard Serra.) Dennoch bleibt es unklar, ob dies typische Fälle sind oder eben nur untypische Einzelfälle. In jedem Fall kann ohne hinreichend schlüssige Beispiele, die These Goodmans, daß Meinungsverschiedenheiten über die richtige Interpretation wesentlich Meinungsverschiedenheiten hinsichtlich der Frage sind, was ein Kunstwerk exemplifiziert, nur schwer begründet werden. Aber selbst die schwächere These, daß wir die Exemplifikation brauchen, um diejenigen Eigenschaften “auszumustern”, die für das Werkverstehen generell irrelevant sind, gibt Anlaß zu Fragen. Denn gehören nicht die erwähnten Beispiele für nichtexemplifizierte Eigenschaften alle zum Typ der nichtwahrnehmbaren Eigenschaften, so daß wir nur zu sagen brauchen, wenn eine Eigenschaft keine Wahrnehmungseigenschaft ist, ist sie für das Werkverstehen uninteressant? Man kann Goodmans Mißtrauen gegenüber einer klaren Unterscheidung von Anschauung und Begriff sicher zustimmen. Denn was ist eine reine, vom Wissen unberührte Wahrnehmungseigenschaft? Viele der Eigenschaften im Kunstwerk sind ohne Wissen eigentlich nicht wahrnehmbar. Ist der Flaschentrockner von Marcel Duchamp ohne Hintergrundwissen als ein im Warenhaus gekaufter Flaschentrockner identifizierbar? Oder die bedrohliche Massigkeit einer Plastik von Richard Serra ohne das Wissen, wie schwer ein großer Stahlkörper ist? Trotzdem ist die Unterscheidung von wahrnehmbaren und nichtwahrnehmbaren Eigenschaften nicht völlig unbegründet. Denken wir an die Molekularstruktur eines Bildes. Eine solche Eigenschaft ist auch dann
Exemplifikatorische Darstellung
79
von uns nicht wahrnehmbar, wenn wir mit allem nur erdenklichen Wissen über die Molekularstruktur des Bildes ausgerüstet sind. Es ist sicher nicht allzu kühn, zu behaupten, daß Eigenschaften wie diese für die Rezeption eines Kunstwerkes ohne Bedeutung sind. Leider gehören aber die von Goodman angeführten Beispiele von Eigenschaften, die für das Werkverstehen unerheblich sind, alle zu diesem Typ prinzipiell nicht wahrnehmbarer Eigenschaften, und so müssen wir feststellen, daß selbst die schwächere These, die Exemplifikation sei für die Grenzziehung zwischen für das Verstehen von Kunstwerken relevanten und nichtrelevanten Eigenschaften erforderlich, bisher noch auf wackligen Beinen steht. Es fällt auf, daß man bei der Suche nach nichtexemplifizierten Merkmalen im Nebel herumzutappen scheint. Sicher, die Frage welche Eigenschaften ein Symbol exemplifiziert und welche nicht, ist im Fall der Stoffprobe des Schneiders einsichtigerweise zentral. Aber kann das Gleiche für den Fall des exemplifizierenden Kunstwerkes gesagt werden? Um diese Frage beantworten zu können, sollten wir zunächst einmal überlegen, was Goodman mit seiner These, Selektion sei für ästhetische Exemplifikation zentral, eigentlich zu erklären versucht. Goodman geht es letztlich um eine Theorie des ästhetischen Verstehens. Verstehen eines Kunstwerkes bedeutet aber, so Goodmans Überzeugung, Verstehen
von
symbolischen
Bezügen.
Wenn
von
Symbolen
im
Zusammenhang von Kunstwerken gesprochen wird, denkt man zuerst einmal an Abbildungen oder allgemeiner, an Repräsentationen. Aber auch Musik, gegenstandslose Kunst oder Architektur sind nicht frei von symbolischem Gehalt, schließlich kommunizieren auch sie etwas: formale Strukturen, Ideen und andere Ausdrucksgehalte. Mit dem Exemplifikationsbegriff versucht Goodman also, unserer Rede davon, daß auch nichtabbildende Werke bedeutsam sein können, einer Erklärung zuzuführen, und er tut es, indem er Werkverstehen nach dem Muster des Verstehens einer Stoffprobe als die Fähigkeit auffaßt, zu identifizieren, was das Werk exemplifiziert, und somit zwischen relevanten und nichtrelevanten Merkmalen zu unterscheiden.
80 Eine genauere Betrachtung, des Werkverstehens konfrontiert uns aber mit einer komplizierteren Situation, und es wird fraglich, ob das exemplifizierende Stoffmuster ein brauchbares Modell für seine Untersuchung abgibt. Wir verlangen von einem Kunstwerk, daß sein Stil zum Sujet paßt, die Farbe zur Form, der Ausdruck eines Details zum Ausdruck des Ganzen, kurz: Wir erwarten vom Kunstwerk ein funktionierendes Zusammenspiel aller Teilaspekte. Das gilt zunächst für die formale Seite des Kunstwerkes. Alle formalen Aspekte sollen formal zusammenpassen und das heißt, sie sollen funktionierende übergreifende formale Einheiten bilden. Tatsächlich ist jede xbeliebige Gestalt und jede x-beliebige Form aus Elementen zusammengesetzt, die die Eigenschaft haben, sich zu der fraglichen Einheit zusammenzusetzen. Wenn wir im Alltag ein Gesicht identifizieren, fragen wir aber in der Regel nicht danach, woraus sich die Gesamtstruktur zusammensetzt, finden es also nicht beachtenswert, daß Nase, Mund, Augen usw. im Zusammenspiel dafür verantwortlich sind, daß wir das erkennen, was wir gerade erkennen - und erst recht bewundern wir die Natur nicht dafür, daß das Zusammenspiel der Gesichtsteile so schlüssig “ein Gesicht” ergibt. Am Kunstwerk interessieren uns aber im Unterschied zum Mustererkennen im Alltag nicht nur die Muster selbst, sondern auch die Art und Weise, wie sie aus Elementen gebildet werden, einschließlich der Frage nach dem Grad der Geschicklichkeit, mit der sie realisiert worden sind. Von ausgedrückten metaphorischen Eigenschaften, wie z.B. Stimmungen, erwarten wir, daß sie nicht sozusagen frei über dem Werk schweben, sondern an die Existenz bestimmter formaler Mittel gebunden sind. Entgegen Goodmans Rede, das Werk drücke eine Stimmung aus, sagen wir üblicherweise, daß bestimmte Eigenschaften eines Werkes eine Stimmung ausdrücken, etwa ein grauer Farbton die Stimmung des Gedrücktseins oder ein kompositorisches Muster die Atmosphäre der Ruhe. Es ist eine zentrale Aufgabe der Kunst, metaphorischen Ausdruck nicht nur zu erzeugen (wie das Werke der Unterhaltungskunst tun), sondern uns auch zu erläutern, d.h. verstehbar zu machen, mit welchen formalen Mitteln er entsteht. Wir haben weiter oben schon erwähnt: Ein Kunstwerk kann bestimmte Ausdrucksmerkmale auf neue und
Exemplifikatorische Darstellung
81
interessante Weise präsentieren und damit das Wie der Konstitution von Ausdruck zum bedeutsamen Merkmal des Werkes werden lassen. Zum anderen müssen wir die komplexen Verflechtungen, die zwischen einzelnen Ausdrucksmerkmalen bestehen, beim Verstehen des Werkes beachten. Eine Stimmung, die ein Gedicht auf der Ebene des Inhaltes transportiert, finden wir vielleicht wiederholt auf der Ebene des Rhythmus, genauso wie die Stimmung, die ein Bild in der Farbe vermittelt, in der Form wieder auftauchen kann. Neben den Wiederholungen von Ausdrucksmerkmalen spielen auch Kontraste zwischen ihnen eine Rolle. Etwa der Kontrast zwischen einer sanften und einer aggressiven Stimmung. Wie bei den formalen Elementen des Kunstwerkes sind wir auch bei den Ausdruckselementen an der Frage des Passens interessiert: Hier an der Frage des Zusammenpassens im Sinne von Wiederholung und Kontrast. Das komplexe Wechselspiel von Teil und Ganzem, mit dem wir beim Verstehen des Ausdrucksgehaltes eines Kunstwerkes konfrontiert werden, bestimmt unsere beständige Suche nach Ähnlichkeiten und Kontrasten. Daher fungieren Elemente, die etwas ausdrücken, z.B. eine Linie oder ein Rhythmus, häufig als Proben von innerhalb des Werkes projizierbaren Markmalen. Wir entdecken eine Stimmung, die uns die Farbe vermittelt, in der Form wieder und schließlich im dargestellten Motiv: So sind wir beständig auf der Suche - nach der Gemeinsamkeit aller Teilaspekte, d.h. der den unterschiedlichen Teilen des Bildes gemeinsamen Ausdrucksstruktur. Es würde unserer beständig mit veränderter Deutung konfrontierten Rezeption eines Kunstwerkes jedoch widersprechen, wenn wir sagen würden, daß diese Suche nur Mittel zum Zweck ist, um schließlich das durch das Werk als Ganzes exemplifizierte Ausdrucksmerkmal erfassen zu können. Es entspricht vielmehr unserer Erfahrung beim Betrachten eines Gemäldes, daß sich das, was ausgedrückt wird, im Fortgang des Eindringens ins Werk fortlaufend verändert, und eben auch, daß diese Veränderungen einen kalkulierten Effekt darstellen und einen Teil des Vergnügens ausmachen, das wir beim Betrachten von Kunstwerken empfinden. Aus den eben gemachten Beobachtungen folgt, daß Kunstwerke nicht bloß gewisse ihrer Merkmale kommunizieren, sondern vielmehr auch die Mittel, mit
82 denen sie erzeugt werden, und das gilt sowohl für die formalen Aspekte, die metaphorischen Aspekte, wie auch für die kausalen Zusammenhänge zwischen formalen und metaphorischen Aspekten eines Werkes. Darüber hinaus spielt auch die Bewertung der eingesetzten Mittel für das Verstehen eine wichtige Rolle: Denn auf die Mittel zu achten, bedeutet hier zwangsläufig, sie auch zu bewerten.2 Wir verstehen nun, was das Verstehen der Bedeutungsstruktur eines Werkes alles umfaßt und auch, warum die Frage nach einer Grenzziehung zwischen bedeutungsvollen und nicht bedeutungsvollen Merkmalen eines Kunstwerkes zwar vielleicht nicht unerheblich ist, aber doch am eigentlichen Punkt vorbeigeht: Die für das Erfassen von Bedeutungsstrukturen eines Werkes so wichtige Frage nach den eingesetzten Mitteln wird nicht gestellt. Man könnte allerdings einwenden: Gut, was hier über die autoreflexive Struktur des künstlerischen Ausdrucks gesagt wird, ist interessant und präzisiert unsere Vorstellung von dem, was wir als ästhetisches Verstehen bezeichnen. Aber, warum sollen wir nicht die komplexen Einsichten in die Konstitution von Bedeutung, die uns das Werk vermittelt, wiederum als exemplifizierten Inhalt ansehen? Die Antwort liegt auf der Hand: Die exemplifizierte Eigenschaft würde dann im Grenzfall einen mehrseitigen Aufsatz über das betreffende Werk umfassen. Formal wäre gegen die Vorstellung, exemplifiziert werde ein solches komplexes Prädikat, nichts einzuwenden - aber hilfreich zur Erläuterung dessen, was man als “Verstehen der komplexen Verflechtung der Ausdrucksmomente” bezeichnen kann, wäre sie aber nicht.3 Vor allem der Umstand, daß Goodman als Ausdrucksträger das Kunstwerk als solches, nicht aber, wie es für unsere Zwecke wünschenswert wäre, einzelne Merkmale des Kunstwerkes ansieht, macht seinen Exemplifikationsbegriff unbrauchbar zur Beschreibung der Ausdrucksdynamik eines Werkes. Wenn eine Anzahl von Formen sich zu einem kompositorischen Muster zusammenfügt, können wir lediglich feststellen, daß das Bild dieses Muster exemplifiziert. Von den einzelnen Formen zu sagen, sie exemplifizierten Eigenschaften, z.B. die, das fragliche Muster zu konstituieren, erlaubt uns der Exemplifikationsbegriff in der vorliegenden Form aber nicht. Oder betrachten wir ein graues Bild, daß Trauer ausdrückt. Goodman ist lediglich in der Lage
Exemplifikatorische Darstellung
83
festzustellen, daß das Bild sowohl “Grau” als auch “Trauer” zu exemplifizieren in der Lage ist, dem für das Verstehen des Kunstwerkes bedeutsamen Umstand aber, daß die Form die Bedingung des Ausdrucks ist, kann er mittels seines Exemplifikationsbegriffes nicht Rechnung tragen. Ein Exemplifikationsbegriff, der für die Exemplikation von “Ausdruck” adäquat wäre, hätte dem Umstand Rechnung zu tragen, daß wir Farben, Formen oder andere Bildmerkmale als Ausdrucksträger bezeichnen. Darüber hinaus müßte auch die Wirkung der Darstellung Beachtung finden. Eine Exemplifikation ist nicht nur dann mißlungen, wenn die exemplifizierten Merkmale nicht repräsentativ sind, sondern auch dann, wenn die Merkmale nicht oder nicht ausreichend gut vom Adressaten erkannt werden können. Die Stoffprobe des Schneiders im dunklen Raum erfüllt diese Bedingung der Erkennbarkeit offensichtlich nicht. Oder stellen wir uns vor, wir wollten das Gewicht eines Objektes exemplifizieren. Es einfach hinzulegen, genügt sicher nicht. Wir müssen uns Mittel einfallen lassen, mit denen wir das Gewicht anschaulich zum Ausdruck bringen können, z.B. können wir, um den gewünschten Effekt zu erreichen, den Gegenstand auf eine Waage oder eine weiche, leicht verformbare Unterlage legen. Oder denken wir schließlich an eine zu exemplifizierende grelle Farbe. In welcher Umgebung fällt sie sowohl als individuelle Farbe als auch als grelle Farbe auf? Sicher nicht in der Umgebung anderer greller Farben - sondern eher in der von blassen Farben. Das letzte Beispiel führt direkt hinein in die praktischen Darstellungsprobleme des Künstlers, denn in der Kunst spielt die Frage, wie Wirkungen von Farben und Formen hervorgehoben werden können, eine wichtige Rolle. Vom Künstler verwendete Mittel zur Verstärkung und Hervorhebung von Merkmalen sind Kontrastierung und Wiederholung. Daß, wie wir angedeutet haben, die Wiederholung von Ausdrucksmerkmalen auch dem Aufbau übergreifender Ausdrucksstrukturen dient oder der Kontrast von Ausdrucksmerkmalen in sich bedeutsam sein kann, steht hierzu nicht im Widerspruch. Es verweist lediglich darauf, daß die Elemente eines Werkes durchaus gleichzeitig verschiedene Funktionen haben können. Betrachten wir unter dem Gesichtspunkt der Wirkung auch den Fall sogenannter Definitionen mittels paradigmatischer Beispiele. Es ist bis heute
84 rätselhaft geblieben, wie solche Exemplifikationen überhaupt funktionieren können. Klar ist aber, daß auch in diesem Fall der Exemplifikation Darstellungsgeschick eine Rolle spielt - die Fähigkeit, im Gesprächskontext und den darin eingebetteten Hintergrundannahmen die Ostension wirkungsvoll zu plazieren. Eine Ähnlichkeit mit dem erwähnten, auf die ästhetische Exemplifikation verweisenden Beispiel der exemplifizierenden Farbe fällt ins Auge: Hier wie dort geht es bei der Fähigkeit, wirkungsvoll zu exemplifizieren, um ein geschicktes Einpassen von Information: Hier um das geschickte Einpassen einer Ostension in einen Gesprächskontext, dort um das geschickte Einpassen einer Farbe in einen Kontext von anderen Farben. Sicher sind Untersuchungen wie diese nicht mehr mit der Annahme verträglich, zum Verstehen der “Exemplifikation” genannten symbolischen Beziehung genüge es festzustellen, was jeweils kraft Konvention oder Ostension durch das Exempel bezeichnet werde. Doch Ziel dieses Aufsatzes sollte es nur sein, festzuhalten, daß und warum Goodmans Begriff ästhetischer Exemplifikation nicht das leistet, was er zu leisten beansprucht - wenn auch mit der weitergehenden Absicht, auf diese Weise weitere Forschungen auf dem Gebiet der Kunstsemiotik anzuregen.
Anmerkungen 1 Nelson Goodman: Language of Art (1969), Cambridge, Mass. 1981; deutsch: Sprachen der Kunst, Frankfurt/Main 1973 Nelson Goodman: Ways of Worldmaking, Cambridge, Mass. 1978; deutsch: Weisen der Welterzeugung, Frankfurt/Main 1984 Nelson Goodman: Of Mind and other Matters, Cambridge, Mass. 1984; deutsch: Vom Denken und anderen Dingen, Frankfurt/Main 1987 Nelson Goodman, Catherine Z. Elgin: Reconceptions in Philosophy and Other Arts and Science Indianapolis, Mass. 1988; deutsch: Revisionen: Philosophie und andere Künste und Wissenschaften, Frankfurt/Main 1989 Eine systematische Darstellung von Goodmans Theorie der exemplifikatorischen Darstellung findet sich in: Catherin C.Elgin, With Reference to Reference, Indianapolis, Mass. 1983. 2 Hier zeigt sich, daß Goodmans These, in kunstsemiotische Untersuchungen könne man bedenkenlos von der Frage der Bewertung von Kunstwerken absehen, nicht stichhaltig ist. 3 Die Unterscheidung zwischen relevanten und nichtrelevanten Merkmalen eines Werkes spielt beim Werkverstehen in einem speziellen, von Goodmans Vorstellungen allerdings abweichenden Sinn, eine Rolle: als Unterscheidung von gelungenem und nichtgelungenem Ausdruck. Zum Verstehen eines Werkes gehört es, zu verstehen, was beabsichtigter und nichtbeabsichtigter Ausdruck ist. Da in einem Kunstwerk selten (oder wohl nie) das Ideal vollkommener Konsistenz und vollkommener
Exemplifikatorische Darstellung
85
Materialbeherrschung erreicht wird, spielt in der Kritik die Unterscheidung von relevanten und nichtrelevanten Merkmalen eine zentrale Rolle. Wenn ein Filmdialog Spannung vermitteln soll, aber tatsächlich nur einen blassen Eindruck hinterläßt, werden wir sicher nicht sagen, daß er “Spannungslosigkeit” ausdrückt. (Wir sagen das höchstens im Sinne einer Festellung hinsichtlich dessen, was der Dialog faktisch ausdrückt. Jedenfalls nicht im Sinne der Interpretation.) Wir erkennen, was der Dialog ausdrücken soll, und identifizieren den faktischen Ausdruck daher als für das Verstehen irrelevanten Ausdruck. Das Erfassen dessen, was das Werk ausdrücken soll, liefert daher die Kriterien, an Hand deren wir in der Lage sind, “unbeabsichtigten” Ausdruck zu identifizieren. Möglicherweise liegt hier der Schlüssel zum Werkverstehen und nicht, wie Goodman mutmaßt, im Ausschluß von Eigenschaften, die bei der Herstellung des Werkes zwar notwendig realisiert werden, in der Interpretation aber keine Rolle spielen.
86
NATURALIZED EPISTEMOLOGY, RATIONALITY AND NORMATIVITY
Paul K. Moser and David Yandell Against Naturalizing Rationality
abstract Recent obituaries for traditional non-naturalistic approaches to rationality are not just premature but demonstrably self-defeating. One such prominent obituary appears in the writings of W. V. Quine, whose pessimism about traditional epistemology stems from his scientism, the view that the natural sciences have a monopoly on legitimate theoretical explanation. Quine also offers an obituary for the a priori constraints on rationality found in “first philosophy”, resting on his rejection of the “pernicious mentalism” of semantic theories of meaning. Quine’s pronouncements of the death of traditional conceptions of rationality in epistemology and in the theory of meaning are, we contend, but misguided wishes for their death, wishes that face severe problems of self-defeat. In addition, Quine’s naturalistic epistemology is subject to damaging skeptical worries, the force of which one cannot escape by ignoring them. A non-naturalistic approach to rationality is here to stay, whether friends of Quine’s naturalism like it or not. Any sweeping claim that nonnaturalistic accounts of rationality are dead will face insurmountable obstacles from unavoidable questions about its own rational justification. Such questions will keep non-naturalistic epistemology and first philosophy alive forever, or at least as long as philosophers endure. An increasingly popular dogma among philosophers implies that any reputable field of inquiry must be continuous with the natural sciences. Many advocates of this dogma presume that in analyzing rationality, theorists must restrict their conceptual apparatus to that of the “naturalist” — the term now current for a scientistic materialist. This dogma has led some theorists to suppose that traditional metaphysics and epistemology are moribund, if not dead already. Some recent influential obituaries for traditional non-naturalistic approaches to rationality are, we shall argue, not just premature but demonstrably self-
Against Naturalizing Rationality
87
defeating. One such prominent obituary appears in the writings of W. V. Quine. Quine’s pessimism about traditional epistemology stems from his scientism, the view that the natural sciences have a monopoly on legitimate theoretical explanation.
Quine holds as a consequence of scientism that
epistemology is at best a chapter of empirical psychology. Quine also provides an obituary for the a priori constraints on rationality found in “first philosophy”, resting on his rejection of the “pernicious mentalism” of semantic theories of meaning.
These pronouncements of the death of traditional
conceptions of rationality in epistemology and in the theory of meaning, we shall argue, are but misguided wishes for their death, wishes that face severe problems of self-defeat. Further, Quine’s naturalistic epistemology is, we shall argue, subject to damaging skeptical worries, the force of which one cannot escape by ignoring them. We shall see that a non-naturalistic approach to rationality is here to stay, whether friends of Quine’s naturalism like it or not. 1. Quine’s Naturalist Obituary for Epistemology Naturalism, put broadly, states that whatever exists is part of the natural order of things. A common understanding of the natural order implies that whatever is natural is explainable in principle by the natural sciences. Naturalism in general affirms that philosophy, psychology, and sociology, as well as all other cognitively significant disciplines, are continuous with the natural sciences — where the natural sciences are whatever one’s favorite list of broadly empirical sciences includes. Naturalism is now the dominant explanatory outlook among philosophers, for better or worse. (For a lucid exposition of naturalism, see Papineau 1993; for criticism of Papineau’s naturalism and other supervenience approaches to naturalism, see Moser 1996, and Moser and Trout 1995.) Quine’s naturalized epistemology recommends a kind of naturalism about the theory of knowledge. His naturalism aims not for a mere description of our ordinary epistemological concepts, but rather for a kind of “explication” that, in the words of Carnap, “consists in transforming a given more or less inexact concept into an exact one or, rather, in replacing the first by the second” (1950, p. 3). Aiming for such explication, Quine (1969a) introduces
88 conceptual substitutes for various ordinary epistemological and psychological concepts. Quine proposes, for instance, that we replace our ordinary notion of justification with a behaviorist notion of the psychological relation between sensation and theory. Quine proposes, more generally, that naturalists should regard the theory of knowledge as a chapter of psychology, that empirical psychology should exhaust the theoretical concerns of epistemologists (Quine 1975a, p. 72).
Call this Quine’s epistemological naturalism.
Quine’s
epistemological naturalism implies that traditional epistemology is dispensable, if not already defunct. In particular, Quine’s naturalism opposes any effort to found the natural sciences on epistemological principles independent of the natural sciences (Quine 1990, pp. 19-20). Quine’s psychological behaviorism (e.g., in Quine 1960, chap. 2; 1979) is perhaps dubious and unpromising even by the standards of our current natural sciences, but this is not our worry now. Our main objection is that Quine’s epistemological naturalism is not itself a thesis of the natural sciences, including empirical psychology. Quine’s epistemological naturalism thus violates a standard of Quine’s own naturalism in general — what we may call Quine’s scientism. Quine’s scientism denies that there is any cognitively legitimate philosophy prior to, or independent of, the natural sciences, and thus implies that one should not make philosophical claims exceeding the natural sciences (see Quine 1954, p. 222; 1981, p. 21, for an identification of the domains of the scientific and the cognitive). Quine’s own epistemological naturalism is itself, however, an instance of philosophy prior to the natural sciences. To overcome this objection, Quine must show that his epistemological naturalism is an hypothesis of the natural sciences. Quine does not, and cannot, discharge this burden, because the natural sciences are not in the business of making sweeping claims about the status of epistemology (even if an individual scientist makes such claims on occasion). This may be an empirical truth about the natural sciences, but it is a warranted truth nonetheless, and it characterizes the sciences generally. It follows that Quine’s epistemological naturalism, as combined with his scientism, is self-defeating. (Quine’s epistemological naturalism may even be a metaclaim unverifiable in principle by the natural sciences, but we shall not digress.) Quine himself, in any case, should care to avoid self-defeat
Against Naturalizing Rationality
89
inasmuch as the natural sciences do and inasmuch as theoretical conflict is disadvantageous to unified explanation. One might try to rescue Quine’s epistemological naturalism by offering a notion of science broader than that underwritten by the natural sciences as standardly characterized. Such a proposal would perhaps relax the implied requirement that Quine’s epistemological naturalism be an hypothesis of the natural sciences. This, however, would place Quine on the horns of a troublesome dilemma: Either there will be a priori constraints on what counts as a science (since actual usage of “science” would not determine the broader notion), or the broader notion of science will be irredeemably vague and unregulated in its employment. To serve Quine’s purposes, the new notion of science must exclude traditional epistemology, while including epistemological naturalism, in a way that is not ad hoc. Such a strategy for escaping self-defeat demands, in any case, a hitherto unexplicated notion of science, which is no small order. Quine has not defended any such strategy; nor has he otherwise resolved our problem of self-defeat. Traditional epistemologists, past and present, have focused on three main areas of the theory of knowledge: (a) what human knowledge consists in — for example, justified true belief of a certain sort, (b) what human knowledge originates from — for example, sensory experience and/or reason, and (c) what the scope, or extent, of human knowledge is — for example, facts about minddependent things and/or mind-independent things. Philosophical discussions concerning these focal areas have guided epistemology since the time of Plato, and they continue in our own day.
Such epistemological discussions
encompass some of the so-called perennial problems of philosophy, problems enduring seemingly without end. (On the importance of such epistemological problems and the question why they endure without end, see Moser 1989, 1993.) An adequate epistemology, however traditional, relies on epistemological principles that specify, among other things, what conditions epistemic warrant (or, justification) consists in. These principles comprise, or at least yield, an intelligible notion of warrant. Even Quine’s naturalized epistemology relies on epistemological principles. One of Quine’s main epistemological principles is
90 his “maxim of minimum mutilation”: a principle of conservatism implying that it is good not to alter our antecedent theory more than necessary (1990, pp. 15, 56). Quine does hold that another epistemological principle — concerning the maximization of the “simplicity” of theory — can prevail over his principle of conservatism; but this will not affect the present discussion. For simplicity, we shall bracket cases where the two principles conflict. A key question now is whether Quine’s epistemological principle of conservatism is itself an hypothesis of any of the natural sciences. Quine has not shown that it is; nor has anyone else. People engaged in the natural sciences perhaps use this principle at times, but no natural science endorses it, assesses it, or seeks to confirm it. Once again, the natural sciences, given their theoretical objectives, are not in the business of endorsing or assessing general epistemological principles. Witness the absence of epistemology courses taught in science departments. Quine’s preferred species of epistemological naturalism thus includes a principle barred by his own scientism. In this respect, Quine’s version of epistemological naturalism yields self-defeat and thus fails to challenge traditional epistemology. Quine’s epistemological principles, we believe, actually function as analytic truths for him, contrary to his own assumptions. Consider these questions: In virtue of what is Quine’s epistemological principle of conservatism true, or correct? In virtue of what is it true — or actually the case — that warranted theory revision conforms to the maxim of minimum mutilation? What, in other words, makes Quine’s epistemological principle true rather than false? These questions will highlight the importance of analyticity for epistemology, including Quine’s naturalized epistemology. They are not questions seeking a causal explanation of why certain people use Quine’s epistemological principles. They rather seek a specification of what constitutes the truth rather than the falsity of Quine’s epistemological principles. What answer might Quine give? Quine cannot answer by saying that the principle of conservatism requires that warranted theory revision be constrained by the principle of conservatism. It is uninformative to say here that given the principle of conservatism, the principle of conservatism is true. Our question asks what makes it the case that
Against Naturalizing Rationality
91
warranted theory revision is constrained by the principle of conservatism. We submit that it is just part of Quine’s usage of the term “epistemic warrant” that the principle of conservatism constrains epistemic warrant.
Given this
assumption, we may say that it is analytically true for Quine that the principle of conservatism constrains epistemic warrant. A traditional alternative to this truth’s being analytic proposes that it is a factually substantive principle about the nature of warrant, somehow still knowable a priori (as the empirical sciences do not discuss, let alone endorse, it). The latter alternative would, however, be even more alien to Quine’s naturalistic project, violating both his scientism and his opposition to “first philosophy” (to be discussed in the next section). Quine suggests that his epistemological principles of conservatism and simplicity find support in actual scientific practice. He claims that these principles “are maxims by which science strives for vindication in future predictions” (1990, p. 15). This suggests that Quine’s epistemological principles are justified by their role in actual scientific practice. Quine might propose, in addition, that his principle of conservatism is true in virtue of its role in actual scientific practice. Let’s grant this proposal for the sake of argument, and ask: In virtue of what is it true — or really the case — that actual scientific practice constrains epistemically warranted theory revision? Our answer is that it is just part of Quine’s usage of “epistemic warrant” that actual scientific practice constrains epistemic warrant. It is analytically true for Quine that scientific practice constrains epistemic warrant. Appeal to scientific practice thus does not free Quine from the importance of analyticity. Barring analyticity, we would have great difficulty answering questions of the sort just raised. Perhaps this explains why Quine remains silent on such questions. (See Moser 1993, chap. 3, for a detailed effort to salvage analyticity in the face of Quine’s influential objections.) Common appeals to epistemological holism take nothing away from the importance of analyticity. The epistemological holist uses the term “epistemic warrant” in such a way that considerations of coherence determine epistemic warrant. A question of the sort just raised can thus reveal the importance of analyticity even for the epistemological holist, Quine included. One can ask:
92 In virtue of what is it true that coherence determines warrant? As for semantic holism — holism about meaning rather than evidence — Quine’s commitment to it is explicitly qualified, given his view that some observation statements have their empirical content individually (1986, p. 426; 1990, chap. 1). Holism about warrant, in any case, does not require holism about meaning. Meaning can be a function of coherence relations even if warrant, or justification, is not. Considerations about holism thus do not threaten our remarks about the significance of analyticity, even for Quine. Quine might recommend, by way of defense, that we simply forego talk of epistemic warrant and all such normative talk. This, however, would be a move of true desperation, a move inconsistent with Quine’s own linguistic practices.
It would remove all evaluative talk from epistemology and
philosophy in general.
Instead of evaluating statements relative to
epistemological standards, we could, on this view, only describe statements relative to how entrenched, or firmly held, they are. Quine himself does not settle for mere descriptions of how entrenched statements are (see Quine 1990, pp. 19-20). He is famous, even notorious, for his view that “the lack of a standard of identity for attributes and propositions can be viewed ... as a case of defectiveness on the part of ‘attribute’ and ‘proposition’” (1960, p. 244). Such talk of defectiveness is not the language of someone avoiding normative, or evaluative, talk. In “Two Dogmas of Empiricism” (1951) and elsewhere, Quine uses his views of actual scientific theory revision to set evaluative epistemological standards — standards involving holistic coherence, simplicity, and minimum mutilation. Since Quine does have evaluative epistemological standards, he must face the questions about correctness raised previously. Those questions reveal the philosophical importance of analyticity, even for naturalized epistemology. They also manifest that the natural sciences do not have a monopoly on epistemology or on philosophy in general. (As we have suggested, some philosophers — though not, of course, Quine — will push here for factually substantive necessary truths in epistemology, but this is a topic independent of this paper.)
Against Naturalizing Rationality
93
We must acknowledge a distinction neglected by Quine, especially in “Two Dogmas of Empiricism”: the distinction between what is true in virtue of a certain policy of linguistic usage and what justifies such a policy.
This
distinction separates (a) what a policy of usage involves or entails and (b) what supports such a policy. Confusion over this distinction underlies Quine’s opposition to analyticity. A statement can be analytically true for a language user just in virtue of a usage policy, even if that usage policy is supported, or justified, only by certain alterable explanatory purposes a language user has. The alterability of the supporting purposes does not discredit the analyticity arising from a policy of usage. The category of the analytic is not the epistemological category of the a priori; nor does it entail unrevisability. Usage policies can and do change — often as a result of changing explanatory purposes. Change in a usage policy is a change in language. The category of the analytic characterizes a kind of truth resulting just from a policy of usage. It is not an epistemological category that connotes a special kind of warrant or evidence. Still, the category of analyticity can contribute to epistemology: It enables us to give plausible answers to the previous questions about correctness of epistemological principles. In addition, it manifests that epistemology is not swallowed up by the empirical sciences, Quine’s empiricist wishes notwithstanding. 2. Quine’s Obituary for Meaning and First Philosophy Quine’s naturalism about philosophy has led him to reject the categories of a priori knowledge in general and a priori ontological commitment in particular. Quine opposes any a priori “first philosophy” independent of the sciences, finding questionable assumptions about meaning to be characteristic of such first philosophy. In “Speaking of Objects” (1969c) and “Ontological Relativity” (1969b), Quine argues against the “copy” or “museum myth” accounts of meaning espoused, according to Quine, by Mill, Frege, and Russell, among others. Such accounts of meaning take meanings to be or involve mental entities, Platonic ideas (by which Quine presumably means any abstracta taken to have mind-independent existence), or concrete objects (as the denotations of
94 words). In contrast, a naturalistic account of meaning rests solely on overt behavior and dispositions to overt behavior, for, according to Quine, “semantics is vitiated by a pernicious mentalism as long as we regard a man’s semantics as somehow determinate in his mind beyond what might be implicit” in his behavior (1969b, p. 27; cf. Quine 1979, pp. 46-47; 1990, pp. 37-38). We shall contend that Quine cannot defend his naturalism about philosophy and meaning without relying on principles unsusceptible to empirical warrant. We shall argue, accordingly, that Quine must have either a priori justification or no justification at all for the needed principles. Quine’s argument against non-naturalistic theories of meaning has several steps. First, Quine asserts that philosophy, including philosophical semantics, ought to be a wholly empirical project. In Quine’s words: “There is no room for a prior philosophy,” or a “first philosophy” (1969b, p. 26; cf. 1975a, p. 72). Second, the only way we can learn meaning is through the evidence of other people’s overt behavior, which will, of course, include their behavior toward us. As Quine claims: “Meanings ... end up as grist for the behaviorist’s mill” (1969b, p. 26; cf. 1990, pp. 37-38). Third, since meaning must be learned socially, there can be no private language. Fourth, meanings are not mental entities, and we can dispense with the domain of mental entities (1960, pp. 26265; 1981, pp. 18-19). Knowing what an expression means, according to Quine, is a matter of knowing how to use certain sounds learned through observing and imitating others (cf. Quine 1979; 1981, pp. 3-5; 1987). Fifth, learning how to use these sounds depends on our observing what it is that is stimulating the persons from whose behavior we learn how to use them. No matter how complex and obscure the linguistic material we learn, overt behavior of other speakers is the only source of linguistic knowledge. Sixth, because behavior is the only source not only of knowledge of meaning but of meaning itself, and since behavior alone never determines any particular meaning, there is no objective truth, no fact of the matter, concerning what words mean (Quine 1960, chap. 2; 1990, chap. 3). Meanings are indeterminate not only from an epistemic standpoint but ontologically as well. Quine has offered an hypothetical model for cases involving translational indeterminacy. Consider an expression in a non-English natural language
Against Naturalizing Rationality
95
having the following features: (a) the native use of the expression can be translated into two English expressions with different meanings, given appropriate modifications in the translation of the surrounding words; and (b) each of the two translations accords equally well with all observable behavior on the part of speakers and with all their behavioral dispositions. In such a case, Quine maintains, “it would be forever impossible to know of one of these translations that it was the right one,” and “you have to see the notion of likeness of meaning [between the non-English and English expressions] in such a case simply as nonsense” (1969b, pp. 29-30; cf. Quine 1970a). Since the adherents of the museum myth do not see it as nonsense, Quine reasons, so much the worse for their theories. Opposing copy theories of meaning, Quine notes that whenever a rabbit is present, so are undetached parts of a rabbit and a temporal stage of that rabbit (i.e., the rabbit existing at that time). Suppose, Quine suggests, that nonEnglish natives utter the expression “gavagai” whenever a rabbit (and hence rabbit parts and the present temporal stage of the rabbit) is present. In translating “gavagai,” Quine claims, there will be no factually determined way of deciding which of these things (rabbit, some undetached rabbit part, or the present temporal stage of a rabbit) they mean. The natives, given a certain stimulus — such as the sight of a rabbit or of some other thing — will assent or dissent to our employing the expression regardless of which translation we give it. The problem is that “rabbit” has a divided reference, and the division into rabbits, parts, or stages will depend entirely on the principle of individuation applied to it. The referent, Quine argues, cannot be learned through ostension, as one cannot pick out what is being indicated without already knowing how the relevant person is individuating among the rabbity bits of the world. Any of various possible translations will be equally adequate as long as the appropriate adjustments are made in the rest of the translation of the language. So, given that the division could ultimately be settled only on the basis of some observable ostensive behavior, it is impossible to give a determinate translation for “gavagai” (Quine 1969b, pp. 30-36; see also 1969c, pp. 1-6; 1970a, pp. 181-82).
96 Quine contends that it is not only in radically foreign translation that indeterminacy arises.
Within our own language, it is also factually
undetermined whether “rabbit” means an entire animal, an undetached part, a time-slice, or a state or condition of having bunny-properties. Only by fixing the meaning of certain background individuating terms, in what must ultimately be a factually undetermined imposition exceeding behavioral grounding, can we fix the meaning of “rabbit.” Since this holds for all public languages, and there are no private languages or languages of thought, all meanings are relative to hypotheses concerning individuating terms. Reference or extension of terms shares this relativity, and this, according to Quine, is “the substance of ontological relativity” (1970a, p. 183). Since “rabbit,” “rabbit part,” and “rabbit stage” “differ not only in meaning [but also] are true of different things, reference itself proves behaviorally inscrutable” (1969b, p. 35; cf. Quine 1981, pp. 19-21).
Hence, on Quine’s view, reference proves
indeterminate, and ontology is relative. The inscrutability of reference, according to Quine, is not merely a matter of our being unable to know what our expressions refer to. Insofar as there is no resultant difference in behavior, there simply is no fact of the matter concerning what an expression refers to. If, Quine asserts, it makes sense to say concerning oneself whether one is referring to rabbits or rabbit parts, then it would make sense to say the same concerning others — language being exhaustively describable in terms of publicly observable behavior. Since, however, one cannot offer an intelligible account of others’ reference as determinate, one cannot do so for oneself, and hence cannot do so at all. All we are left with for reference is a collection of theories discussable only relative to one another, with no allowable mention of the theories’ corresponding to objects. Neither words nor theories concerning words refer by themselves to objects of any kind. Quine’s argument takes the following general form: Since a philosophical account of meaning, like any philosophical account, is uniformly empirical, any philosophical account of meaning making appeal to mental entities or abstracta is “defective.”
In addition, behavior is the only ground for
interpreting language, and there are cases where behavior is indifferent
Against Naturalizing Rationality
97
concerning (a) which of two interpretations we give a word or phrase and (b) what the reference of that expression is. Such cases can be resolved only by appeal to other facts about the language in which the expression occurs. So, one’s use of a language constitutes a hypothesis concerning reference, developed via stimulus-response conditioning (depending on “inborn propensities” to associate certain stimuli), and the relevant hypothesis can be adjusted to accommodate more than one reference. As the reference hypothesis of each person cannot be known to correspond to anything factual, reference hypotheses can only be compared in terms of their relations to other hypotheses. Therefore, reference and meaning are indeterminate, both in terms of our knowledge and in terms of the facts of the matter. Quine’s case for naturalism about meaning rests on the view that a philosophical account of meaning, like any philosophical account, must be uniformly empirical. As a result, Quine cannot rely on any a priori principles in making his case. Quine, we shall contend, fails to meet this requirement. In claiming that appeal to mental facts cannot adequately explain determinacy of meaning and reference, Quine relies on assumptions about conditions for adequate explanation that are not themselves empirical. If Quine’s argument against mentalism about meaning rests ultimately on physicalism and empiricism, as many have supposed, then we must ask about the status of physicalism and empiricism in Quine’s philosophy. Do they function as analytic a priori standards in Quine’s position? If so, Quine is open to a charge of self-defeat; he is then using analytic a priori standards to debunk the role of such standards in philosophy, particularly in a philosophical account of meaning. We doubt, however, that physicalism and empiricism are now Quine’s ultimate philosophical standards, even if he seemingly suggested otherwise at some point. Quine’s current assumptions about conditions for adequate explanation include requirements on adequate explanation that demand a basis in the natural sciences. Quine now grants that neither physicalism nor empiricism is his ultimate standard for rational theory assessment, on the ground that natural science could, after a convulsion, do without such standards (1990, pp. 20-21). The heart of natural science, according to Quine, is neither physicalism nor
98 empiricism but its “hinging ... on checkpoints in sensory prediction” (1990, p. 21; cf. Quine 1975b, pp. 68-69). Still, Quine assumes that rational philosophical theories, including theories about meaning, must be constrained by what is predictively acceptable to the natural sciences. What, however, is the status of that fundamental assumption by Quine? The natural sciences themselves do not include that assumption as one of their scientific hypotheses. Indeed, it is doubtful that they could, given that they are, as noted previously, not in the business of making sweeping epistemological claims. Quine has not shown that his fundamental assumption belongs to the natural sciences; nor has anyone else. The best explanation of Quine’s fundamental assumption is that it functions as an analytic a priori truth for him. We have no reason to regard it as an empirical hypothesis, and it has a normative function, for Quine at least, equivalent to the normative function of traditional analytic a priori epistemological principles. As a result, it appears that Quine’s attack on semantic determinacy and first philosophy is self-defeating, owing to its resting on a philosophical assumption that is itself a piece of first philosophy. Having claimed that first philosophy is impossible, Quine devotes much of “Ontological Relativity” (1969b), among other essays, to describing what constraints are placed upon semantics given the explanatory commitments of a naturalist.
The problem is that the relevant semantic constraints and
explanatory commitments evidently rely on principles from a priori first philosophy. At least, Quine has not explained why the matter is actually otherwise. This sort of objection, if sometimes shrugged off by those under criticism, is a sufficient reason to reject the position offered. If, moreover, Quine is allowed his a priori methodological commitments, then others must be granted theirs, and the arena of contention will then shift to the relative merits and demerits of competing theories of rational explanation. Scientism will then no longer enjoy uncritical acceptance. In that case, Quine would have to give independent support for his scientistic naturalism, and that, we believe, is a tall order indeed if it cannot rest on any a priori principle whatever. The problem, again, is that the natural sciences themselves do not settle the general
Against Naturalizing Rationality
99
philosophical issue of scientism. The natural sciences do not offer, for instance, scientific hypotheses identifying the domains of the cognitive and the scientific. The problem of self-defeat is decisive against Quine’s effort to free rationality of any a priori feature. Without the presumption of the (evidently a priori) truth of empiricism about meaning, the underdeterminative character of ostensive behavior does not entail indeterminacy of knowledge of reference and meaning. Similarly, without the presumption of the (evidently a priori) truth
of
Quine’s
own
scientistic
first
philosophy,
behavioral
underdetermination of reference and meaning in no way implies indeterminacy of semantic or referential fact. In addition, it seems, without indeterminacy of semantic and referential fact, Quine cannot rule out a priori constraints on individuation, and so cannot rule out a first philosophy positing such a priori constraints. Quine’s inability to defend a naturalist theory of meaning without importation of a priori assumptions illustrates the difficulty of settling philosophical issues without reliance on a priori assumptions. 3. Naturalism and Skepticism Quine’s naturalism proposes that skeptical doubts are “an offshoot of science,” on the ground that such doubts stem from simple physical science about the reality of bodies (1975b, pp. 67-68). Elementary physical science, according to Quine, contributes indispensably to our distinction between reality and illusion and hence undergirds skeptical doubts. Quine thus proposes that epistemology should be treated as “an enterprise within natural science,” adding that “Cartesian doubt is not the way to begin” (1975b, p. 68). We shall leave aside the role of Cartesian doubt and the claim that skepticism’s origins lie in science. Even granting Quine this claim, we must distinguish between (a) the conditions for the genesis of our concept of reality and (b) the conditions for justified or reliable application of our concept of reality. The natural sciences might be crucial to our having the distinction between what is real and what is illusory but still fail to be a reliable avenue to reality, that is, to true beliefs about what is real.
We can, accordingly,
coherently entertain hypotheses about the general unreliability of the natural
100 sciences. It is not conceptually incoherent to suppose that most of the claims of the natural sciences are false. (Claims to the contrary resting on Donald Davidson’s principle of interpretive charity will prove to be unconvincing; see Moser 1993, pp. 228-37.)
In fact, one might propose, coherently if
unconvincingly, that the turbulent history of natural science itself lends credibility to claims of the unreliability of natural science. Neither the hypothesis that the natural sciences are generally reliable nor its denial is an hypothesis of the natural sciences.
Those are philosophical
hypotheses that go beyond any claim of the natural sciences. They make claims about scientific reliability in general, thereby exceeding natural science proper. The skeptical hypothesis that the natural sciences are generally unreliable will thus receive no effective challenge from hypotheses within the natural sciences, as the latter hypotheses are not designed to bear on such skepticism. Even if skepticism relies on a concept of reality whose genesis involves elementary natural science, skepticism offers hypotheses that are not adjudicated by the natural sciences themselves. Quine’s naturalism apparently operates with a principle of credulity regarding the reliability of the natural sciences. Quine remarks: ... I also expressed, at the beginning, my unswerving belief in external things — people, nerve endings, sticks, stones. This I reaffirm. I believe also, if less firmly, in atoms and electrons and in classes. Now how is all this robust realism to be reconciled with the barren scene that I have just been depicting? The answer is naturalism: the recognition that it is within science itself, and not in some prior philosophy, that reality is to be identified and described (1981, p. 21). Quine has explicitly endorsed an ontological realism about the existence of at least physical particulars and classes (1970b, pp. 93-97). Quine’s principle of credulity implies that we may presume the reliability of the natural sciences in describing reality. One might hope, then, to construct a reply to general skepticism regarding the sciences based on this principle. Quine’s principle of credulity, however, is not itself an hypothesis of the natural sciences. It is a general epistemological principle about the natural sciences. Individual scientists may presuppose a principle of credulity, but the principle is not included among their scientific hypotheses. Furthermore, in
Against Naturalizing Rationality
101
light of worries already discussed, it is unclear how the principle can be empirically established in a non-circular manner satisfactory to skeptics. It appears, in any case, that Quine’s principle of credulity functions as an analytic a priori commitment of his naturalism. If this is so, we have yet another illustration of a troublesome kind of inconsistency in Quine’s naturalism. This offers further evidence of the difficulty of formulating a uniformly naturalistic philosophy. Quine might, of course, disown any principle of credulity regarding scientific reliability. In that case, however, Quine will lack an effective way to evade skeptical worries about the reliability of scientific theories. He will then have no discriminating way to dissociate his own naturalistic position from skepticism, as he will then lack justification for relying on the reliability of prediction concerning sensory checkpoints as a constraint on theory formation. Naturalism would then look a lot like traditional skepticism, contrary to Quine’s avowed intentions. 4. Conclusion We have seen that the most prominent effort to bury traditional categories of analyticity and the a priori is actually self-defeating. Quine’s naturalism suffers the same dismal fate in this respect on three counts noted above. Traditional epistemology evidently loses nothing at the hands of Quine. More generally, any sweeping claim that non-naturalistic accounts of rationality are dead will face insurmountable obstacles, for any such claim will be open to unavoidable questions about its own rational justification. Such questions will keep nonnaturalistic epistemology and first philosophy alive forever, at least as long as philosophers endure. Quine may protest otherwise, but such protests are, we have seen, doomed to self-defeat.
References: Carnap, Rudolf. 1950. Logical Foundations of Probability. Chicago: University of Chicago Press. Moser, Paul K. 1989. Knowledge and Evidence. New York/Cambridge: Cambridge University Press. _____, 1993. Philosophy after Objectivity. New York/Oxford: Oxford University Press.
102 _____, 1996. “Physicalism and Mental Causes: Contra Papineau.” Analysis 56. Forthcoming. Moser, Paul K., and J. D. Trout. 1995. “Physicalism, Supervenience, and Dependence.” In E. E. Savellos and Ü. D. Yalçin, eds., Supervenience: New Essays, pp. 187-217. New York/Cambridge: Cambridge University Press. Papineau, David. 1993. Philosophical Naturalism. Oxford: Blackwell. Quine, W. V. 1951. “Two Dogmas of Empiricism.” In Quine, From a Logical Point of View, 2d ed., pp. 20-46. Cambridge, Mass.: Harvard University Press, 1953; 2d ed., 1964. _____, 1954. “The Scope and Language of Science.” In Quine, The Ways of Paradox, pp. 215-32. New York: Random House, 1966. _____, 1960. Word and Object. Cambridge, Mass.: The MIT Press. _____, 1969a. “Epistemology Naturalized.” In Quine, Ontological Relativity and Other Essays, pp. 6990. New York: Columbia University Press. _____, 1969b. “Ontological Relativity.” In Quine, Ontological Relativity and Other Essays, pp. 26-68. New York: Columbia University Press. _____, 1969c. “Speaking of Objects.” In Quine, Ontological Relativity and Other Essays, pp. 1-25. New York: Columbia University Press. _____, 1970a. “On the Reasons for Indeterminacy of Translation.” The Journal of Philosophy 67, 17883. _____, 1970b. “Existence.” In W. Yourgrau and A. D. Breck, eds., Physics, Logic, and History, pp. 89103. New York: Plenum. _____, 1975a. “Five Milestones of Empiricism.” In Quine, Theories and Things, pp. 67-72. Cambridge, Mass.: Harvard University Press, 1981. _____, 1975b. “The Nature of Natural Knowledge.” In S. Guttenplan, ed., Mind and Language, pp. 67-81. Oxford: Clarendon Press. _____, 1979. “Use and Its Place in Meaning.” In Quine, Theories and Things, pp. 43-54. Cambridge, Mass.: Harvard University Press, 1981. _____, 1981. “Things and their Place in Theories.” In Quine, Theories and Things, pp. 1-23. Cambridge, Mass.: Harvard University Press, 1981. _____, 1986. “Reply to Hilary Putnam.” In L. E. Hahn and P. A. Schilpp, eds., The Philosophy of W. V. Quine, pp. 427-31. La Salle, Ill.: Open Court. _____, 1987. “Indeterminacy of Translation Again.” The Journal of Philosophy 84, 5-10. _____, 1990. Pursuit of Truth. Cambridge, Mass.: Harvard University Press.
Naturalism, Instrumental Rationality, and the Normatvity of Epistemology
103
Harvey Siegel Naturalism,
Instrumental
Rationality,
and
the
Normatvity
of
Epistemology
abstract Advocates of naturalized epistemology who wish to secure epistemology’s normativity want that normativity to be restricted to instrumental concerns, because these can be understood naturalistically. But epistemic normativity cannot be so limited; a ‘categorical’ sort of normativity must be acknowledged. Naturalism can neither account for nor do away with this sort of normativity. Hence naturalism is at best a seriously incomplete and therefore inadequate meta-epistemological position.
Introduction Epistemology has traditionally been conceived as a normative discipline, concerned to develop and articulate criteria governing the appropriateness of belief. Ideally, it informs us of the warrant or justification which candidate beliefs enjoy, and of the nature of warrant and justification themselves. That is, ideally epistemology helps us to determine which of our beliefs are justified and so worth believing (and why they are); in so far, it helps to determine what we should believe. A central concept of (normative) epistemology is that of rationality, since (roughly) we believe rationally just when our beliefs are warranted and so worthy of belief. A large and growing body of work suggests that epistemology should be naturalized: reconceived as an empirical discipline, and pursued in accordance with the principles, standards and techniques of natural science.
One
outstanding question this work raises is precisely that of the status of epistemology’s supposed normativity. Can epistemology be naturalized in a way that fully preserves and accounts for that normativity? If not, should naturalism be adopted at the cost of the weakening of that normativity? These are the questions to be pursued in this paper.
104 Most naturalists do not advocate the abandonment of epistemology’s normativity.1 Rather, they propose to reconceive and limit it. They reject traditional epistemology’s conception of rationality as ‘categorical’, and argue instead for an ‘instrumental’, hypothetical or strategic conception of rationality, according to which rationality is best understood in means-ends terms, i.e. in terms of the ability of our beliefs (and actions) to secure our epistemic and other ends. Naturalists whose positions otherwise diverge considerably — for example Boyd, Brown, Foley, Fuller, Gibson, Giere, Hooker, Kitcher, Kornblith, Laudan, Lycan, Maffie, Quine, Roth, Shimony, Solomon and Stich — agree (a) that rationality should be understood in this instrumental way, and (b) that this instrumental relationship is completely open to naturalistic investigation, since the ability of our beliefs (and actions) to secure our ends is an open empirical issue. In this way, these authors argue, the normativity of epistemology is preserved within a naturalistic framework. The main focus of this paper is on the ability of this naturalistic, instrumental conception of rationality to account fully for the normativity of epistemology. In section I I review a variety of statements of/arguments for instrumental-normative naturalism.
I then argue (in section II) that the
instrumental rationality of the normative naturalist is insufficient to account for the normativity of epistemology. If my arguments succeed, I will have shown that instrumental-normative naturalism is unable to capture or account for that normativity; and consequently that naturalism must be seen as an inadequate, or at best a seriously incomplete, meta-epistemological stance. I. Normative Naturalism and Instrumental Rationality There is an unusual degree of agreement among normative naturalists concerning the nature of the normativity properly recognized and sanctioned by a properly naturalized epistemology.
For example, Roger Gibson, a
prominent interpreter and defender of Quinean naturalized epistemology, insists both that Quine is best understood as holding, and that it is in any case correct to hold, that naturalized epistemology is instrumentally normative: “Quine conceives of naturalized epistemology as a partly normative inquiry.” ((1988), p. 47)
“Such a naturalized epistemology is both descriptive and
Naturalism, Instrumental Rationality, and the Normatvity of Epistemology
105
normative, but it is not justificatory in the way that old-time epistemology aspired to be.” (Gibson (1989), p. 564) “Quine’s point about justification is not that science needs no justification but that it needs no justification in terms prior to science. Science is justified in Quine’s eyes by its measuring up to observation and prediction, i.e. the nomological deductive method.” (Gibson (1988), p. 75, emphasis in original) As these remarks make clear, on Gibson’s view Quinean naturalism embraces, and does not repudiate, normativity. Moreover, the normativity embraced by naturalism is instrumental: “The point that needs noticing and emphasizing is that [according to Quine] science itself, including psychology, is normative. The norms involved are, of course, hypothetical, not categorical: ‘One ought to do x, if one wants y’, not ‘One ought to do x’.” (Gibson (1988), p. 69, emphasis in original) On Gibson’s view Quine’s “pragmatic philosophy of science” is properly characterized as “instrumentalism: ‘As an empiricist,’ Quine says, ‘I continue to think of the conceptual scheme of science as a tool, ultimately, for predicting future experience in the light of past experience’.” (Gibson (1988), p. 16, citing Quine (1953), p. 44, emphasis in original) Thus Gibson interprets Quinean naturalism as embracing an instrumental normativity, such instrumentalism focusing mainly on the predictive efficacy of scientific theory, and defends that conception of instrumentally-normative naturalism.2 Other proponents of instrumentally-normative naturalism develop their positions without explicit reference to Quine. For example, Ronald N. Giere also explicitly distinguishes categorical or unconditional rationality from instrumental rationality, and insists that the latter, though not the former, has a proper home in his naturalized philosophy of science. (1988, pp. 7-10) And in his (1989) Giere underlines this insistence: The central issue, I believe, is this....[According to] the dominant tradition,...it is possible to discover epistemological principles that are autonomous from science. Such principles would provide an autonomous warrant for normative claims as to how scientists should act. They would provide criteria for categorical, or unconditional, rationality among scientists.
106 The naturalist, by contrast, believes that there is no autonomous realm of epistemological principles. This is not to deny that there are better and worse ways of attempting to do science, or to reject the possibility of giving advice about how best to proceed. But the corresponding principles of rationality are only instrumental, or conditional. They connect research strategies with the goals of research. And establishing these connections itself requires scientific inquiry. (Giere (1989), p. 377, emphases in original) If there were autonomous principles of justification, they would provide standards of what is often called categorical, or unconditional, rationality. But there is another, weaker, form of rationality which is conditional, or instrumental. To be instrumentally rational is simply to employ means believed to be conducive to achieving desired goals....[T]here is also a more objective sense of instrumental rationality which consists in employing means that are not only believed to be, but are in fact conducive to achieving desired goals. This latter, objective, sense of instrumental rationality provides the naturalistic theorist of science with ample means for making normative claims about science. These claims, however, are not autonomous but are grounded within science itself. It requires empirical research to determine whether a particular strategy is in fact likely to be effective in producing valuable scientific results. (1989, pp. 379-80, emphases in original) Thus a naturalized philosophy of science...can provide a basis for normative judgments. These judgments would, of course, be only instrumentally, and not categorically, normative. But for the naturalist, that is the only kind of normative judgment anyone can legitimately make. There is no “higher” rationality. (1989, p. 382, emphases in original) In these passages Giere makes clear both his rejection of categorical rationality and his emphatic acceptance of instrumental rationality. He also makes clear why he thinks the latter sort of rationality is at home in a naturalistic setting: it is at home because (“objective”) instrumental rationality “consists in employing means that are not only believed to be, but are in fact conducive to achieving desired goals”, and whether means are so conducive is an empirical question open to naturalistic investigation. Determinations of instrumental rationality thus require naturalistic investigation, and such
Naturalism, Instrumental Rationality, and the Normatvity of Epistemology
107
investigation fully licenses judgments of instrumental rationality. Thus are naturalism and instrumental rationality joined. Philip Kitcher similarly provides a very clean account of the reasons why naturalists both turn away from a priori analysis, and embrace a means-ends conception of epistemic normativity. Speaking of the traditionalist’s insistence that the epistemological task is that of providing an analysis of the “ways in which people ought to think”, which analysis can be conducted largely independently of the psychology of belief, Kitcher asks: What grounds the claim that our favored logical principles are prescriptions for thought? What are the sources of these principles? Do such idealized recommendations really apply to us? A traditional response is to propose that they present conceptual truths about rationality, thereby formulating an ideal at which we aim. For naturalists, however, such prescriptions must be grounded in facts about how systems like us could attain our epistemic goals in a world like ours.... The failure of appeals to conceptual truth, to analyticity, is fully general ... The root issue will always be whether the methods recommended by the theory are well adapted for the attainment of our epistemic ends, and that cannot be settled by simply appealing to our current concepts. (Kitcher (1992), pp. 63-64)3 As Kitcher here makes clear, for the normative naturalist the normativity of epistemic principles derives from their ability to contribute to the realization of our epistemic ends, and so that normativity will be instrumental in character. Since it is an open empirical question whether acting and believing in accordance with proposed epistemic principles actually do facilitate — for creatures like us in a world like ours — the achievement of our epistemic ends, we have no choice but to turn to psychology, and to natural science more generally, to investigate the normative status of such proposed principles. Thus we see again how instrumental conceptions of epistemic normativity and the naturalizing of epistemology go hand in hand for the normative naturalist. I hope that the reader will forgive these lengthy citations, but it is important to see just how basic this view of normativity is to extant versions of naturalism. These cited passages are I think entirely representative. Advocates of normative naturalism are virtually unanimous in embracing this sort of
108 instrumentalist account of epistemic rationality/normativity.4 I turn next to the critical evaluation of that instrumentalist account. II. On the Need for a ‘Categorical’ Conception of Rationality The fundamental difficulty with regarding instrumental rationality as exhaustive of rationality or normativity in general is that making sense of it requires appeal to an underlying, non-instrumental conception of rationality; consequently, instrumental, means-ends concerns cannot be the whole story about rationality or epistemic normativity.5 It is clear, as naturalists insist, that judgments of instrumental efficacy require appeal to empirical evidence concerning the efficacy of proposed means with respect to the achievement of given ends. In a case in which such efficacy is established by such evidence, we have good instrumental reason to utilize the means established by that evidence as efficacious for the realization of those ends, in so far as we embrace them as our ends. But how are we to understand the relationship between the evidence for instrumental efficacy and the means-ends pairs concerning whose efficacy it is evidence? What we have is a situation of the following form: Evidence E suggests that means M is instrumentally efficacious with respect to goal G. It is M’s efficacy with respect to G which is established by E.
What is the
relationship between E and the rest of this ‘formula’? In order for the judgment (that M is indeed instrumentally efficacious with respect to G) to be justified, it must be the case that E constitutes evidence which warrants, or makes justified, or renders it rational to accept, the belief/claim C that M is indeed so efficacious. But this further claim, concerning the probative or evidential force of E with respect to C (the claim concerning M’s efficacy with respect to G), is not a claim involving instrumental efficacy (or rationality) at all. M may be instrumentally efficacious with respect to G; but the relationship between E and C is not itself one of instrumental efficacy. On the contrary: in order for our judgments concerning instrumental efficacy to be themselves rationally justified, they must be related to the evidence for them in a non-instrumental, standardly epistemic or probative way.
In this way, claims concerning
instrumental efficacy presuppose, and depend for their own justification on, a
Naturalism, Instrumental Rationality, and the Normatvity of Epistemology
109
non-instrumental (and in that sense ‘categorical’) relation between such claims and the evidence for them. That relation cannot itself be understood in terms of instrumental efficacy: it is not that regarding the evidence for such a claim as powerful is a matter of seeing that regarding it that way serves to further some other goal that we happen to have. Rather, the evidence must establish it as justified or warranted that the means is indeed instrumentally efficacious with respect to the goal. This relation, between the evidence which justifies and the claim (concerning instrumental efficacy) which it renders justified, is just the traditional (categorical) epistemic relation between a claim or belief and the reasons or evidence which support(s) it.
Thus the instrumentalist-only
normative naturalist requires a non-instrumental account of evidential support or epistemic warrant; she needs a ‘categorical’, i.e. non-instrumental, normative theory of evidence to make her instrumental story work.6 The point can be seen more clearly if we attend to a buried equivocation in the case for instrumental rationality considered thus far. The instrumentalist conflates instrumental efficacy and instrumental rationality, and uses these notions interchangeably. This adds undeserved plausibility to her account of epistemic normativity. For the former is a causal notion: M is efficacious with respect to G iff (the utilization of) M tends to bring about the achievement of G. But why should such causal efficacy be thought to have anything to do with rationality, or with normative notions of epistemic evaluation more generally? Consider an example (originally introduced by Laudan). Let M = the utilization of double-blind methodology. Let G = the discovery of the actual medicinal properties of a drug, e.g. its ability to ameliorate some disease. Now, what is the relationship between M and G? Suppose that M is efficacious with respect to G. This is a causal relation: if we utilize double-blind methodology, we are more likely to discover the actual medicinal properties of the drug. How does rationality enter the picture? Once we’ve established the causal efficacy of double-blind methodology with respect to that goal, we are rational to utilize that methodology given our wish to accomplish that goal. The rationality of our utilization of M is not constituted by the causal relation obtaining between M and G, however. Rather, it is constituted by an epistemic
110 rather than a causal relation — namely, the relation between E (the evidence which suggests that M is in fact causally efficacious with respect to G) and the claim concerning causal efficacy, C, for which it provides evidential support. That is, what makes the utilization of M rational is the evidence which justifies our judgment that that utilization is efficacious with respect to the achievement of G. The relation between M and G is causal, not epistemic; the relation between E and the efficacy claim C it supports is epistemic, not causal. When the instrumentalist runs together instrumental efficacy and instrumental rationality, she runs together two quite distinct relationships, which obtain between quite distinct relata.7 Thus, underlying judgments concerning instrumental efficacy is an epistemic, (non-instrumentally) normative relation between reasons or evidence and the judgments, beliefs, and claims concerning causal efficacy which those reasons or that evidence render(s) justified and so rational to believe. Judgments of instrumental efficacy — or, if we continue to conflate causal and epistemic relations, instrumental rationality8 — are dependent upon judgments concerning that epistemic relation. Consequently, instrumental rationality must be seen not as the whole of rationality or epistemic normativity, but rather as itself dependent upon non-instrumental, categorical conceptions both of rationality or epistemic normativity and of the relation obtaining between good reasons/evidence and the beliefs, judgments, and claims for which they are (it is) good reasons/evidence. Instrumental rationality can be regarded as a dimension or form of rationality only to the extent that it is underwritten by non-instrumental rationality. Naturalists are of course correct that instrumental rationality requires appeal to (naturalistic) evidence. The present point, however, is that a nonnaturalistic, non-instrumental story about that evidence and the rational warrant it provides is needed in order to make sense of the alleged instrumental connection between candidate means and ends. Recall the passage from Kitcher cited earlier: For naturalists, however, such [epistemic] prescriptions must be grounded in facts about how systems like us could attain our epistemic goals in a world like ours....The root issue will always be whether the methods
Naturalism, Instrumental Rationality, and the Normatvity of Epistemology
111
recommended by the [epistemological] theory are well adapted for the attainment of our epistemic ends. (Kitcher (1992), pp. 63-64) But how will we tell whether or not such prescriptions do help us attain our goals, or whether such methods “are well adapted for the attainment of our epistemic ends”? By gathering evidence, presumably, about that attainment and the efficacy of those methods. When the evidence is gathered and evaluated, it will (ideally) yield conclusions like “Method M is efficacious for the attainment of our epistemic ends; method M* is not (or is less so). Therefore we should utilize method M.” But that the evidence indeed warrants such conclusions is not something that can be understood in instrumental terms: to what further end could we appeal in arguing that our evidence does or does not support such conclusions? There is no such further end — and, moreover, it is a mistake to understand the question in this way, since it confuses causal and epistemic notions and relations. Rather, we have no choice but to refer to our best theory of evidence; to our best theoretical account of the epistemic or normative force that reasons and evidence might enjoy and transmit to the claims which they support. This theory cannot be a naturalistic theory, if naturalism restricts itself to instrumental concerns, for instrumental considerations will not serve to justify such claims of instrumental efficacy. When the naturalist argues that “E shows or suggests that M is more efficacious than M* with respect to G”, she is appealing not to some further goal.9 She is appealing rather to some non-instrumental account of evidential warrant or probative force, such that (according to that account) E warrants that claim. I do not for a moment suggest that any particular account of such force enjoys wide acceptance among contemporary epistemologists. I am suggesting rather that the naturalist needs such an account every bit as much as the non-naturalist does, but that such an account cannot be had naturalistically, if naturalism is restricted to instrumental concerns. Hence naturalism is at most a seriously incomplete epistemology — and a ‘categorical’ conception of epistemic normativity a prerequisite for its completion. If epistemology aims at shedding light on epistemic normativity, then a ‘categorical’ conception of epistemic normativity is an epistemic inevitability.10
112
Conclusion The instrumental-normative naturalist wants to tell a comprehensively naturalistic story concerning epistemic normativity. But such a story cannot be told from within the confines of naturalism, and the instrumental-only rationality that it acknowledges; the naturalist needs a non-instrumental, and so nonnaturalistic, account of evidence or warrant in order to judge that judgments of intrumental rationality are themselves rationally warranted. Thus naturalism must be regarded as at best a seriously incomplete epistemology; it fails to address, let alone answer, fundamental epistemological and meta-epistemological questions concerning epistemic normativity. In particular, it provides no way of establishing that our judgments concerning instrumental rationality are themselves rationally warranted. If this point is correct — that is, if the naturalist’s commitment to instrumental rationality as the whole of epistemic normativity is undermined by the fact that instrumental rationality requires appeal to conceptions and theories of non-instrumental normativity — then naturalism is, at best, seriously incomplete; moreover, if correct, then any version of naturalism which holds or presupposes that rationality or epistemic normativity is completely captured by instrumental considerations stands refuted.11 Postscript Two further points must be noted. First, I have said relatively little about the naturalist’s main argument for naturalism: the impossibility of ‘first philosophy’. The point goes back to Quine’s rejection of the possibility of any ‘cosmic exile’ outside of science from which the normative status of science can be judged; it is endorsed, in some form, by many of the philosophers discussed above, and needs to be squarely met if my argument against naturalism is ultimately to succeed.
Boyd, Brown, Gibson, Giere, Hooker, Ketchum,
Kitcher, and Maffie, among others, join Quine in rejecting first philosophy; if it is rejected, these naturalists argue, then “unlimited” naturalism follows.12 So one task not addressed here is that of demonstrating that the naturalists’
Naturalism, Instrumental Rationality, and the Normatvity of Epistemology
113
argument from the rejection of first philosophy to the full embrace of naturalism — and so the complete repudiation of ‘categorical’ conceptions of rationality and epistemic normativity — does not succeed.13 A second locus of concern involves truth. I have argued against instrumental conceptions of epistemic normativity. But a very popular view, endorsed by many epistemologists (e.g. Alston (1985), BonJour (1985), Foley (1987), Goldman (1986), Goldman (1988), Haack (1989, 1993a), and indefinitely many others) who defend a variety of positions on the issues treated thus far, is that the over-arching aim of scientific or cognitive activity is that of truth, and that epistemic normativity — rationality, justification, epistemic evaluation generally — is a function of its ability to achieve that end. This view, if correct, appears to re-establish epistemic normativity as instrumental. It behooves me, then, to show that regarding truth as the ultimate epistemic end does not result in the establishment of the instrumental character of epistemic normativity. While I have begun this effort, by arguing that so regarding it involves a misrepresentation of the relationship between epistemic normativity and truth (Siegel 1983), it is clear that more needs to be said. Saying it must await another opportunity. Having mentioned these further issues, I want now simply to summarize and close the present effort.
The instrumental-normative rationality
championed by normative naturalism, I have argued, is insufficient to account for the normativity of epistemology; naturalist attempts to account for the normativity of traditional epistemology in instrumental, means-ends terms fail. Consequently, naturalism offers at most a severely limited alternative to traditional epistemology. Traditional, non-naturalized epistemology is not eliminable by naturalism; nor can it be replaced or done justice by ‘going natural’.14
Notes 1 I discuss the difficulties facing that abandonment in Siegel (1996). 2 Louise Antony (1987, pp. 251-255) and Paul Roth (1983, 1987) also interpret and defend Quinean naturalism in this way. A subtle and compelling discussion — partly critical and partly supportive — of the normative dimensions of Quine’s version of naturalized epistemology may be found in
114 Haack (1993). It is developed further in Haack (1993a), ch. 6. 3 Boyd likewise argues that the “justifiability” of cognitive strategies is not an a priori matter “but instead a matter of contingent fact about the reliability of those strategies in the actual world.” (Boyd (1980), p. 624) 4 In addition to the sources cited above, see also Brown (1988, p. 65); Fuller (1988, 1989, 1991); Kornblith (1993); Maffie (1990a, pp. 286-8; 1990b); Quine (1986, p. 655); Shimony (1987a, p. 6; 1987b, pp. 291-2; 1987c, pp. 353-4); Solomon (1994); and Stich (1990, p. 24). Laudan (1984, 1987, 1988, 1990) is an ardent proponent of this sort of instrumentally normative naturalism — for references and critical discussion see Siegel (1990), but see also Laudan’s response (1990a). I reply in detail to that response, and also to Giere’s (1989), in Siegel (1996a). Foley also defends an instrumentalist account of rationality, although it is not motivated by any explicit concern with naturalism. See Foley (1987a), pp. 235, 238; (1988), p. 126, 131, passim. The position is most fully worked out in Foley (1987). 5 The following six paragraphs also appear (with some changes) in Siegel (1996a). 6 Virtually the same point, made in terms of “irreducible epistemology,” is made by John Worrall (1990, p. 318).
7 For more systematic discussion of the naturalistic penchant for conflating causal and epistemic notions, see Kim (1988), Siegel (1996). Thanks to John Biro for helpful discussion. 8 If the argument just rehearsed is correct, then ‘instrumental rationality’ is a poorly chosen locution, since it runs together the notions and relations whose conflation I have just deplored. Nevertheless, given the propensity of the naturalists discussed to use it, I cannot very well abandon it altogether. So in the remainder of the paper I will continue to use it — hoping that the reader will keep in mind my criticisms of it — in my further effort to establish that, even if the conflation is not fatal, it remains that the naturalist’s account of epistemic normativity in terms of it does not succeed. 9. If she is, then not only is she conflating causal and epistemic questions; in addition, a problematic regress threatens. 10 For this phrase I am indebted to Susan Haack. 11 A similar conclusion is defended by Hilary Putnam, though for somewhat different reasons. See Putnam, ‘Beyond the Fact/Value Dichotomy’, reprinted in Putnam (1990), pp. 135-141.
12. The expression “unlimited naturalism” is Maffie’s. I should note that some prominent naturalists — Goldman, Laudan, and Shimony, among others — disagree, and offer versions of naturalism which allow ‘analytic’ as well as naturalistic inquiry, and combine a priori and naturalistic considerations. So there is an in-house dispute within the naturalist camp as to whether naturalism should be, in Maffie’s terms, “unlimited” or
Naturalism, Instrumental Rationality, and the Normatvity of Epistemology
115
“limited”; whether traditional, non-naturalistic issues and/or techniques should be recognized as legitimate by card-carrying naturalists. 13. I attempt to do this in Siegel (1995). See also Siegel (1984); Almeder (1990). 14. This is a revised and considerably shortened version of an invited address presented at the Eastern Division APA meeting in Washington, D.C. on December 29, 1992. I am grateful to Robert Almeder for his insightful commentary on that occasion, to Jonathan Adler, Leonard Carrier, Christoph Lumer, Timothy McGrew, and Matthias Steup, and to the members of audiences at the APA session, the University of Florida, and the University of Miami, especially John Biro, Harold Brown, Edward Erwin, Susan Haack, Risto Hilpinen, Alan Goldman, Kirk Ludwig, Peter Klein, James Maffie, and Howard Pospesel, for their excellent criticisms of earlier drafts. REFERENCES Almeder, R. (1990): ‘On Naturalizing Epistemology’. American Philosophical Quarterly 27, pp. 263279. Alston, W. (1985): ‘Concepts of Epistemic Justification’. The Monist 68, pp. 57-89. Antony, L. M. (1987): ‘Naturalized Epistemology and the Study of Language’. In Shimony and Nails (eds.), (1987), pp. 235-257. BonJour, L. (1985): The Structure of Empirical Knowledge. Cambridge: Harvard University Press. Boyd, R. (1980): ‘Scientific Realism and Naturalistic Epistemology’. In P. D. Asquith and R. N. Giere (eds.), PSA 1980: Volume Two. East Lansing, Michigan: Philosophy of Science Association, pp. 613-662. Brown, H. I. (1988): ‘Normative Epistemology and Naturalized Epistemology’. Inquiry 31: 53-78. Foley, R. (1987): The Theory of Epistemic Rationality. Cambridge: Harvard University Press. Foley, R. (1987a): ‘Epistemic Rationality and Scientific Rationality’. International Studies in Philosophy of Science 1: 233-250. Foley, R. (1988): ‘Some Different Conceptions of Rationality’. In E. McMullin (ed.), Construction and Constraint: The Shaping of Scientific Rationality, Notre Dame: University of Notre Dame Press, 1988, pp. 123-152. Fuller, S. (1988): Social Epistemology. Bloomington: Indiana University Press. Fuller, S. (1989): Philosophy of Science and Its Discontents. Boulder: Westview Press. Fuller, S. (1991): ‘Naturalized Epistemology Sublimated: Rapprochement without the Ruts’. Studies in History and Philosophy of Science 22: 277-293. Gibson, R. F. (1988): Enlightened Empiricism: An Examination of W.V. Quine’s Theory of Knowledge. Tampa: Univ. Presses of Florida. Gibson, R. F. (1989): ‘Review of C. Hookway, Quine: Language, Experience and Reality’. The British Journal for the Philosophy of Science 40: 557-567.
116 Giere, R. N. (1988): Explaining Science: A Cognitive Approach. Chicago: University of Chicago Press. Giere, R. N. (1989): ‘Scientific Rationality as Instrumental Rationality’. Studies in History and Philosophy of Science 20: 377-384. Goldman, A. H. (1988): Empirical Knowledge. Berkeley: University of California Press. Goldman, A. I. (1986): Epistemology and Cognition. Cambridge: Harvard University Press. Haack, S. (1989): ‘Rebuilding the Ship While Sailing on the Water’. In R.Barrett and R. Gibson (eds.), Perspectives on Quine. Oxford: Blackwell, pp. 111-127. Haack, S. (1993): ‘The Two Faces of Quine’s Naturalism’. Synthese 94: 335-356. Haack, S. (1993a): Evidence and Inquiry: Towards Reconstruction in Epistemology. London: Blackwells. Hahn, L. E., and P. A. Schilpp, eds. (1986): The Philosophy of W. V. Quine (The Library of Living Philosophers, vol. XVIII). La Salle, Illinois: Open Court Publishing Company. Hooker, C. A. (1987): A Realistic Theory of Science. Albany: State University of New York Press. Hooker, C. A. (1995): Reason, Regulation, and Realism. Albany: State University of New York Press. Ketchum, R. J. (1991): ‘The Paradox of Epistemology: A Defense of Naturalism’. Philosophical Studies 62: 45-66. Kim, J. (1988): ‘What Is “Naturalized Epistemology”?’ In J. E. Tomberlin (ed.), Philosophical Perspectives, 2: Epistemology, 1988, Atascadero, California: Ridgeview Publishing Company, pp. 381405. Kitcher, P. (1992): ‘The Naturalists Return’. The Philosophical Review 101: 53-114. Kornblith, H. (1993): ‘Epistemic Normativity’. Synthese 94: 357-376. Laudan, L. (1984): Science and Values. Berkeley: University of California Press. Laudan, L. (1987): ‘Progress or Rationality? The Prospects for Normative Naturalism’. American Philosophical Quarterly 24: 19-31. Laudan, L. (1987a): ‘Relativism, Naturalism and Reticulation’. Synthese 71: 221-234. Laudan, L. (1988): ‘Methodology’s Prospects’. PSA 86, Volume 2, pp. 347-354. Laudan, L. (1990): ‘Normative Naturalism’. Philosophy of Science 57: 44-59. Laudan, L. (1990a): ‘Aim-less Epistemology?’ Studies in History and Philosophy of Science 21: 315-322. Lycan, W. G.: (1988): Judgement and Justification. Cambridge: Cambridge University Press. Maffie, J. (1990a): ‘Recent Work on Naturalized Epistemology’. American Philosophical Quarterly 27: 281-293. Maffie, J. (1990b): ‘Naturalism and the Normativity of Epistemology’. Philosophical Studies 59: 333349. Putnam, H. (1990): Realism with a Human Face. (J. Conant, ed.) Cambridge: Harvard University Press. Quine, W. V. (1953): ‘Two Dogmas of Empiricism’. In Quine, From a Logical Point of View. Cambridge: Harvard University Press, pp. 20-46. Quine, W. V. (1969): ‘Epistemology Naturalized’. In Quine, Ontological Relativity and Other Essays. New York: Columbia University Press, pp. 69-90. Quine, W. V. (1986): ‘Reply to Morton White’. In Hahn and Schilpp (eds.), (1986), pp. 663-665. Roth, P. A. (1983): ‘Siegel on Naturalized Epistemology and Natural Science’. Philosophy of Science 50: 482-493. Roth, P. A. (1987): Meaning and Method in the Social Sciences: A Case for Methodological Pluralism. Ithaca: Cornell University Press. Shimony, A. (1987): ‘Integral Epistemology’. In Shimony and Nails (eds.), (1987), pp. 299-318. Shimony, A. (1987a): ‘Introduction’. In Shimony and Nails (eds.), (1987), pp. 1-13.
Naturalism, Instrumental Rationality, and the Normatvity of Epistemology
117
Shimony, A. (1987b): ‘Comment on Levine’. In Shimony and Nails (eds.), (1987), pp. 291-294. Shimony, A. (1987c): ‘Comment on Agassi’. In Shimony and Nails (eds.), (1987), pp. 352-355. Shimony, A., and D. Nails (eds.), (1987): Naturalistic Epistemology: A Symposium of Two Decades. Dordrecht: D. Reidel Publishing Company. Siegel, H. (1983): ‘Truth, Problem Solving and the Rationality of Science’. Studies in History and Philosophy of Science 14: 89-112. Siegel, H. (1984): ‘Empirical Psychology, Naturalized Epistemology, and First Philosophy’. Philosophy of Science 51: 667-676. Siegel, H. (1990): ‘Laudan’s Normative Naturalism’. Studies in History and Philosophy of Science 21: 295-313. Siegel, H. (1995): ‘Naturalized Epistemology and “First Philosophy”’. Metaphilosophy 26: 46-62. Siegel, H. (1996): ‘Naturalism and the Abandonment of Normativity’. In W. O’Donohue and R. Kitchener (eds.), Psychology and Philosophy: Interdisciplinary Problems and Responses. Allyn & Bacon (in press). Siegel, H. (1996a): ‘Instrumental Rationality and Naturalized Philosophy of Science’. Philosophy of Science (in press). Solomon, M. (1994): ‘Social Empiricism’. Nous 28: 325-343. Stich, S. P. (1990): The Fragmentation of Reason. Cambridge: M.I.T. Press. Worrall, J. (1990): ‘Rationality, Sociology and the Symmetry Thesis’. International Studies in the Philosophy of Science 4: 305-319.
118 Ralf Naumann Internal Realism, Rationality and Dynamic Semantics
abstract Putnam’s internal realism implies a form of conceptual relativity with respect to ontology. There can be different descriptions of the world which are based on distinct ontologies. It has been argued that this relativity forecloses any possibility of unifying our knowledge and can even lead to inconsistency. If this is true, internal realism should be abandoned because it is compatible with non-rational positions. We will argue that these objections can be dismissed if truth as idealized warranted assertibility is understood as stability of a belief state under new evidence. This view of truth is still compatible with the existence of distinct belief states expressing different views on the world. This understanding of the notion of truth is a consequence of interpreting both our cognitive activities and the notion of meaning dynamically. The meaning of a sentence is no longer given in terms of (static) truth conditions but as a relation between belief sets, that is, as a kind of information change potential. One of the most prominent theses put forth by Putnam in recent years is the thesis of internal realism. Recently it has been characterized by Putnam in the following terms. The point of internal realism is not that there are perspectives that you cannot conjoin ... but that there is no privileged ‘ontology’ in terms of which reality is to be described. Even unified knowledge can have a plurality of forms (Putnam(94a), p.254). Let us first illustrate what is meant by different perspectives or descriptions of the world by means of an example. Suppose there is some kind of world with just three different objects; call them a, b and c. Object a is black, object b is white and object c is red. According to the description we have just given, the following sentence is true. (1)
There are exactly three objects.
Let us call this perspective or theory theory 1. But now suppose the following is done. One not only counts the objects a, b and c but also their mereologi-
Internal Realism, Rationality and Dynamic Semantics
119
1
cal sums. For instance, the mereological sum which corresponds to the objects a and b can be taken to consist of the matter (or space) of both objects. These mereological sums can be taken to be a kind of plural object. Formally, the move from ‘normal’ objects to a universe including plural objects can be modelled by embedding the ‘old’ objects in a set-theoretical universe by means of the so-called I-operator whose definition is given in (2). (2)
8x 8y.x=y
This operator maps each object x of type e to the singleton {x}. Next one defines that if a and b are objects, so is their (set-theoretical) union. This (recursive) definition allows one to build more complex objects on the basis of a given base set of atomic objects. In our example the base set consists of the objects a, b and c. Alternatively, one could proceed as follows. Given a set of objects S, one maps this set to V+(S), i.e. the set of all non-empty subsets of S, and counts all elements of V+(S) as objects. In the above example the result will be the following universe. {a,b,c} {a,b}
{a,c} {a}
{b,c} {b}
{c}
Figure 1 As a consequence the universe no longer contains exactly three objects but seven. Thus, the following sentence is true in this changed perspective or theory. (3)
There are exactly seven objects.
Let us call this perspective theory 2. Besides the two sentences about the cardinality of the universe, there are other sentences which evaluate differently in the two theories. Consider the sentence in (4). (4)
There is an object which is partly red and partly black.
120 Such an object exists according to theory 2 because one has that the object {a,c} satisfies the predicate in (4): object a is black and object c is red such that their mereological sum is partly black and partly red. In theory 1, on the other hand, this sentence cannot be (literally) true because there all objects are of exactly one colour. The example shows that the thesis of internal realism is essentially a thesis about ontology. Understood in this way its content is mainly negative: it does not make sense to speak of the totality of all objects. Rather, what is an object depends on what kinds of objects are posited inside a theory or a language. This thesis has subsequently been called conceptual relativity by Putnam.2 This conception of realism has consequences for the notion of truth which is admissible. (5)
Truth is, at least in part, dependent on our (current) belief system, knowledge, interests and desires.
This follows from the fact that there is no privileged ontology, that is, no built-in ontology which science can aim to discover eventually. Rather, the ontology which is used both in science and common sense always presupposes some decisions on the part of the user which are not determined by nature or the ontological structure of the world. But this means that the truth conditions of a sentence cannot be given in terms of any mind-independent ontology. (6)
Truth cannot be defined in terms of a (non-trivial) notion of correspondence.
If truth cannot be defined by means of a built-in ontology, it follows that truth cannot be defined by some kind of correspondence between sentences or parts of sentences and parts or chunks of the world which are given as a totality before any language for which a notion of truth is defined is in place. Formally, this would mean that the domain of each language had to be a subset of this ontology, if the sentences are true. Note that it is not excluded that there will be some kind of trivial notion of correspondence in the definition of truth for a particular language in the sense that the truth conditions of a sentence are given with respect to objects and relations which have been posited inside the
Internal Realism, Rationality and Dynamic Semantics
121
language. For instance, in the example above one can define two different reference relations between objects in the world and terms in the two different languages, depending on which of the two theories one uses. Yet, the question is how it is possible to define the notion of truth in positive terms. As is well known, Putnam offers the following attempt. (7)
Truth is idealized rational acceptability.
The problem is to explain what is meant by ‘idealized rational acceptability’. Internal Realism and Rationality There seems to be something fundamentally wrong with the thesis of internal realism and the notion of truth it implies. It appears that adopting this kind of realism leads to a position which is relativistic and skeptic in a sense which seems to defy rationality, or which is at least compatible with such positions. If this is in effect true, internal realism is a position which it is not rational to accept. The relativism stems from the fact that it is possible that there are different, logically incompatible sentences which are nevertheless all true.3 This is just a consequence of the thesis of internal realism according to which there can be different perspectives or views of the world which need not be unifiable. As an example take sentences (1) and (3) from above. Both sentences are true. The former according to theory 1 and the latter according to theory 2. But it is not possible to conjoin both sentences to one complete description of the world because the conjunction of sentence (1) with sentence (3) is inconsistent. There can be no world in which one has exactly three and at the same time exactly seven objects. Consequently, internal realism seems to be compatible with the existence of genuine inconsistent descriptions of the world.4 But such a possibility seems to defy any notion of rationality. Next consider the following skeptical argument that the world doubled in size ten minutes ago. According to a metaphysical realist position, there is a fact of the matter which makes this claim either true or false. Put in semantic terms, one can say that there either is some kind of causal (correspondence)
122 connection between the sentence and the world or not. As we have seen, internal realists eschew such talk of a metaphysical connection between language and the world. But then it seems possible to accept both hypotheses, that is, that the world doubled in size ten minutes ago or not. The difference between the two hypotheses only concerns the size of the objects and, therefore, can be seen as postulating two different ontologies such that nevertheless both hypotheses can be true. The general problem for an internal realist can be described as follows. If there are different incompatible ways of talking about or describing reality, what distinguishes these from all those other ways one could use or conceive of but does not want to use because they are wrong or incorrect, that is, cannot be taken as a description of reality. The problem, thus, is how different theories or perspectives of describing the world are possible at all, without at the same time leaving room for too many theories. It is just at this point that some nonepistemic notion seems to be called for as providing a criterion with respect to which the different ways or perspectives can be evaluated. Such a non-epistemic notion can supply an objective standard because it is independent of our own current subjective standards of justification and proof. Blackburn, for example, holds that a move towards unity is necessary because different perspectives must be reconciled if they shall be taken to be theories about the world and not as mere instrumental acceptances.5 For him, acknowledging some kind of conceptual relativity is eo ipso a rejection of this possibility of a unified world view and a rejection of the notion of idealized rational acceptability. Rather, the notion of a unity of science or knowledge is a kind of regulative ideal which guides all scientific thinking and inquiry. Realism based on the idea of a totality of objects and a corresponding definite totality of properties is taken to be a necessary condition for the thesis of the existence of objective knowledge. Irrational positions, on the other hand, deny the existence of such objective knowledge which is independent of any subjective factors.6 One symptom of irrationality is that it has to acknowledge the existence of other, incompatible views or theories. Of course, in most cases such opposing views are said to be false or even unintelligible because they fail to agree with one’s own view. But this falsity is only ‘falsity from the
Internal Realism, Rationality and Dynamic Semantics
123
standpoint of x’ and not from the standpoint which uses some kind of objective standard. Consequently, it seems that avoiding irrationality is to describe the world or part of it in such a way that it should not reflect any biased or subjective interests or standpoints at all.7 The same point can also be made by requiring that what is needed is some kind of ‘view from nowhere’. Metaphysical realism can be seen as complying with this requirement. By postulating a totality of objects as well as a totality of properties with respect to which truth is defined (via a relation of correspondence), there is an objective standard with respect to which sentences (beliefs) or whole theories can be evaluated. There is no room for a plurality of views which is characteristic of irrational positions because there is only one world, the WORLD in Putnam’s critical description of the metaphysical realist position, which fits exactly one description. Relativistic positions, then, are prone to succomb to irrationality just because they allow a plurality of views and do not insist on some kind of uniqueness. Yet, internal realism as understood by Putnam should rather be seen as a middle way between these two extremes, that is ‘reactionary metaphysics’, on the one hand, and ‘irresponsible relativism’, on the other.8 The question, of course, is how an internal realist can manage to hold course between these two extremes. A first answer Putnam could give to the charge of an irresponsible relativism is to ressort to some kind of empirical underdetermination in the sense of Quine. This would amount to the claim that there is no fact of the matter with respect to which a choice between two incompatible descriptions can be made. For instance, the two descriptions we have given in the example above are empirically equivalent in the sense that they lead to the same set of testable predictions and that they have the same explanatory power. There even exists an effective translation between the two theories which is truth preserving. As an example take the following translation of theory 1 into theory 2. It is based on the fact that the objects of theory 1 are the atomic objects of the universe of theory 2, where the predicate atomic can be defined as in (8). (8)
AT =df. 8X8Y. Y f X v |Y| = 1
124 An atomic object is a set the cardinality of which is 1, that is a singleton. Sentence (1) of theory 1, then, receives the following translation in theory 2. (9)
There are exactly three atomic objects.
Thus, one sees that the word ‘object’ of theory 1 is translated as ‘atomic object’ in theory 2. Sentence (4), on the other hand, can be translated as in (10). (10)
There is a non-atomic object which is partly red and partly black.
(10) now expresses in more precise terms the fact that the non-uniqueness of a colour ascription applies to plural objects and therefore not necessarily to atomic objects. Yet, the Quinean thesis of underdetermination is not the way in which Putnam wants to be understood although he accords with Quine in rejecting the above objection that he has to acknowledge the truth of genuine inconsistent sentences. This objection presupposes a single use of the word ‘object’ because it is only under this premise that the two sentences in (1) and (3) cannot be conjoined. Such a use assumes that there are fixed answers to the questions ‘Are there mereological sums?’ and ‘Are mereological sums objects?’ But questions like these only make sense against the background of the notion of a totality of mind-independent objects which together make up the ontology of the world. On Putnam’s view the impossibility of conjoining the two sentences directly is simply a consequence of the fact that it is not possible to conjoin two conventions which underly different ways of speaking.9 On the other hand, it is possible to conjoin the sentences after one of the sentences has been translated into the language underlying the other theory.10 The difference between Putnam and Quine consists in the role these different notions of objects have. For Putnam the example of the mini-world with exactly three atomic objects reflects different conventions to speak about (part of) the world. These conventions, in turn, are grounded in different interests or desires of those using the different schemes.11 The descriptions or theories are thus at least in part expressed in intentional terms which cannot be eliminated. These descriptions of the world are therefore made from above and not from below, that is, from the standpoint of science itself, where science is
Internal Realism, Rationality and Dynamic Semantics
125
understood as being opposed to common sense. It follows that Putnam does not defend some kind of naturalism, as it is the case for Quine, who aims at a theory which is completely made from the point of view of science. According to Putnam, neither reason nor mind can be naturalized, that is, be eliminated or reduced to notions which are employed in the natural sciences. He writes: In Quine’s sense, to be a ‘naturalist’ is to believe that there is nothing to be said about science except what science itself can discover about science, i.e. there is no distinctive activity of philosophy apart from science (Putnam(94a), p.251).12 Consequently, a convention, which does not correspond to a fact of the matter, will in general be useful, even in science. A prime example for such a convention is the distinction between cause and background conditions (or background assumptions). This distinction is not built-in into the structure of the world but, rather, depends on human interests and tendencies. Consequently, there is no ‘fact of the matter’ making something a cause or a background condition. Yet, the distinction does play an important role in everday argumentations where the question of what is the cause of some effect or event is at issue. A first stab at another way of looking at the whole question might come from recalling that whether causation ‘really exists’ or not, it certainly exists in our ‘life world’. What makes it ‘real’ in a phenomenological sense is the possibility of asking, ‘Is that really the cause?’ - that is, of checking causal statements, of bringing new data and new theories to bear on them. If we say this, while leaving aside the problematic idea of ‘really existing’, then we have a picture not too different from Wittgenstein’s or Austin’s, or, for that matter, Husserl’s. The world of ‘ordinary language’ (the world in which we actually live) is full of causes and effects. It is only when we insist that the world of ordinary language (or the Lebenswelt) is defective (an ontological ‘jungle’, vague, gappy, and so on) and look for a ‘true world’ (free of vagueness, of gaps, of any element that can be regarded as a ‘human projection’) that we end up feeling forced to choose between the picture of ‘a physical universe with a built-in structure’ and ‘a physical universe with a structure imposed by the mind,’ not to mention such pictures as a physical-universe-plus-a-mysterious-relation-of‘correspondence,’, or a physical-universe-plus-mysterious-‘essences’; to
126 choose, that is, between pictures that are at once terribly alluring and perfectly contentles (Putnam(90), p. 8). Yet, Blackburn’s (or in more general terms: the metaphysical realist’s) objection can be restated in a different form. Although it is not true to say that an internal realist has to acknowledge genuine inconsistent knowledge, it is not the case that he can simply assume the law of bivalence: (11)
Either p is true or its negation is true.
Consider again sentence (1) There are exactly three objects. Upon hearing this sentence, an internal realist always has to ask first in what sense the word ‘object’ in this sentence has to be understood or is intended to be used. He must, so to speak, know the conventions governing this word or know what view on the world is presupposed by the utterance in order to be able to understand the claim which is made by a particular utterance of (1). Note that this knowledge is different from simply knowing the meaning of the word ‘object’ or any other word of a language which one must grasp in order to understand sentences in which this word occurs. Rather, it is like knowing the language which is presupposed by the utterance. In this case there can be many different ways of using the word ‘object’ and those who want to understand an utterance of (1) must know of these different uses which can underly the occurrence of the word ‘object’ in (1). Now Putnam may claim that the formulation in (11) is incomplete. What is missing is a reference to a particular language: (12)
Either p is true in L or its negation is true in L.
It follows that (1) should always be understood with an implicit reference to a particular choice of a language L, say the language L1 corresponding to theory 1. In that case sentence (1) is bivalent (and true). Yet, this reply of Putnam misses something essential from an internal realist point of view, namely, that our cognitive practice is not divided in different languages in which the use of a word can differ in ways which amount to assigning different meanings to one word, here the word ‘object’, even if there may be different perspectives which are used at the same time. Putnam’s reply is open to the same objection which he levels against Dummett, who argues that for example the word ‘small’ has different meanings in the two expressions
Internal Realism, Rationality and Dynamic Semantics
127
‘the small boy’ and ‘things too small to see with the naked eye’. Whereas the first occurrence modifies a noun which denotes observable objects, the second occurrence is linked to objects which are by definition unobservable (at least for a verificationist like Dummett). Putnam will probably reply that what is different is not the meaning of the word but its use. What one has are not so much different languages but different language games in the sense of Wittgenstein. This view is explicitly embodied by him in the following passage taken from his recent Dewey-Lectures: There is a certain ‘holism’ here; knowing what truth is in a particular case depends on knowing the use of signs in the language game just as knowing what checking is depends on knowing the use of the various pieces in chess (Putnam(94b), p.513).13 Yet, how exactly the difference between meaning and use can be understood is not explained. But note that drawing on such a distinction undermines Putnam’s first reply that the notion of bivalence must be understood with respect to a particular language L. If there is only one language involved in the different games, it follows that bivalence does not apply because one first must know the use (or the game) in order to understand the claim which is made with an utterance of, say, (1). But then bivalence does not hold for sentences like (1) because specifying a particular language L, say English, is not enough to make a sentence bivalent. A further problem with the above reply is the following. Putnam himself argues, e.g. against deflationist positions, that many sentences of a language are not definitely either true or false.14 Yet, if a sentence like (1) is not bivalent because of the non-uniqueness of reference of the word ‘object’, which, in turn, is due to the interest-dependence of the underlying ontology, then almost no sentence will come out as bivalent on an internal realist picture. But this is clearly at odds with our common-sense practice of how sentences are used to make claims about the world. Let us come back to the possible answers Putnam has against the charge that internal realism is compatible with strong forms of relativism and thus with non-rational positions. We have already shown that an internal realist is not committed to accepting genuine inconsistent sentences as true. But what happens if the number of different perspectives is rather large and that it may
128 even not be possible to translate the different perspectives into each other? In this case there will be many different incompatible views which cannot be reconciled and as a consequence opponents holding different views can never agree. Here a non-epistemic notion which allows an objective evaluation of these different views is called for, or so it seems at least. To this objection Putnam can reply as follows. Any attempt to refute relativism by means of some non-epistemic notions of truth, ontology and realism is itself doomed to failure because a position which is based on such purportedly non-relativistic notions is compatible with even very strong forms of antirealism. Consequently, if the opponent believes that a position which uses only non-epistemic notions cannot lead to relativism, he is wrong. As is well known, Putnam’s argument amounts to formally defining an alternative notion of truth, namely truth as determined by a set of operational and a set of theoretical constraints. The class of true sentences can then be defined as the class of all those sentences which satisfy all the constraints in both sets. The problem for a metaphysical realist is that the class of sentences which is true on this latter conception can well be identical to the class of true sentences on his own metaphysical conception of truth. But if the class of true sentences can be the same on both conceptions, one can show that there are different reference relations for the language assigning different objects in the world to one and the same word in the theory without affecting the distribution of truth values to whole sentences. Thus, the problem is that all possible constraints one can put on a theory can at most determine the truth values of sentences but not the semantic values of subsentential constituents and it is just these values for which the metaphysical realist claims that they are unique. The general objection to this argument of Putnam was (and still is) that Putnam wrongly presupposes that a metaphysical realist has to assume that reference and truth are fixed by theories and therefore in the end by a language in which this theory is formulated. Rather, so the argument goes, reference is fixed by some kind of causal connection between the words used in a theory and the world. Putnam’s answer to this argument is that this claim too will be true under different conceptions of truth and reference. Another way of making this point is that as long as the opponent sticks to notions which can be
Internal Realism, Rationality and Dynamic Semantics
129
justified from a scientific point of view, Putnam’s argument applies to them. Now the opponent could try to use some stronger notions to defend his claim. David Lewis, for example,15 argues that there is some ‘natural constraint’ which fixes the reference of our words. Natural kind terms are said to refer to ‘elite’ classes. The problem with such arguments is that the notions which are used in them are not explained by the author, here Lewis, and that these notions are not used in science either. Thus, one is at a loss in trying to understand what exactly is meant, say, by the notion of eliteness. More seriously, if it is nature or the world itself which determines reference, it should be possible to define concepts like that of eliteness in natural science. But this seems to be impossible.16 I think that if one views this debate in the context of the problem of how an internal realist position is compatible with non-rational arguments a stronger reply is possible. So far the opponent to internal realism has argued that allowing different views of the world cannot foreclose the possibility of these views being to a large degree based on subjective elements which will turn out to be wrong if they were compared with respect to objective standards. The existence of different, incompatible views is always an indication that at least one of these views must describe reality not correctly. On the other hand, in order to be of any use for a definition of what it means to be rational a radically non-epistemic notion of, say, truth is of no help either for the following reason. If the metaphysical realist were right in claiming that truth is determined, say, by some kind of causal connection which may even exist independently of our means of discovering it, we could never use this connection to justify our beliefs because it could always be the case that even though these beliefs pass all tests, they are nevertheless wrong just because they do not get this connection right. To put it differently, rationality is an epistemic notion and it is therefore necessary to define it in terms of notions which we can at least in principle live up to, that is, the application of which to sentences or beliefs can be decided by us as human beings. Notions which are used to provide some kind of objectivity to our beliefs which are not in an essential way linked to our intellectual practices, and this means to what we are in principle able to detect, are of no use for us in defining what it means to be rational. The metaphysical
130 realist is certainly right when he argues that if the criteria according to which the truth (or correctness) of our beliefs (or sentences we believe true) stay too close to our own actual standards, one runs the risk to accept false theories. But this must not be read in the sense in which the metaphysical realist understands this argument, namely, that the only cure against an irresponsible relativism are radically non-epistemic notions of truth and reference. On the other hand, one has to be careful not to read too much of a verificationist approach into Putnam’s internal realism. For example, one may argue that any notion of truth for sentences about the past which is epistemically useful must depend on a kind of effective procedure to eventually decide the truth of such a sentence. According to Putnam, such a conception is ‘radically misguided’ (Putnam(92):357) To give an example, the truth of the sentence ‘Dinosaurs existed 50 million years ago’ does not depend on any traces of this species we can find or have already found somewhere. Even if all vestiges of dinosaurs had been destroyed shortly after their extinction, the above sentence would be either determinately true or either determinately false on an internal realist conception of truth. At one place Putnam writes: My position entails that ‘Lizzie Borden murdered her parents with an axe’ has a truth-value regardless of whether evidence that exists now or that will exist in the future will ever enable anyone to verify that Miss Borden committed the crime or to verify that she did not. Indeed, even if quantum mechanical fluctuations, or whatever, have destroyed the relevant evidence, I maintain that the accusation against Miss Borden has a definite, if unknown, truthvalue. In this sense, it is consistent with my position that some statements should depend for their truth on ‘conditions the obtaining of which may be, in principle, inaccessible to human beings’ (that is, inaccessible as things now stand, even if they were at one time accessible) (Putnam(92), p.363; italics not added). At other places Putnam says that there could be sentences for which the conditions of their truth are recognition-transcendent, even though this could not happen to hold for the vast majority of the sentences we use.17 The example he discusses is the following. (13)
Even if there happened to be intelligent extraterrestrials, we may never be able to verify that there are.
Internal Realism, Rationality and Dynamic Semantics
131
The antecedent of this conditional presupposes that the sentence ‘There do not happen to be any intelligent extraterrestrials’ could be true. The question then is how it is possible to verify this. The answer could be easy if there are some reasons of why there could not be other forms of life somewhere in the universe except those forms which exist here on earth. In this case there may be some cosmological principle which together with biological and physical facts implies the impossibility of other forms of life. The problematic case rather is if it just happens that there are no extraterrestrials, that is, it is contingently true that there is no life outside earth but that there could in principle be such life. In this case there can be no explanation which is based on underlying principles of our sciences. Now it seems that this concession to a notion used by a metaphysical realist points in the direction of how Putnam can try to refute the objection of a strong form of relativism which is compatible with internal realism and which can lead to forms of irrationality. What is needed is some form of recognitiontranscendence which is not based on the notion of a totality of objects out there waiting to be discovered where this discovery is explicated on the semantic level as establishing the correct correspondence relation between words and the world. On the other hand, the feature of a possible recognition-transcendence of truth separates an internal realist position from that of verificationist accounts like that of Dummett, for example, because it excludes the definition of truth in terms of some effective procedure which will enable us (or our descendants) to eventually arrive at the truth about the world, that is, at a correct and complete theory of the world.18 Directedness versus Unity The idea of eventually conjoining our knowledge of the world is not one thesis but rather consists of two independent claims which, therefore, have to be distinguished. On the one hand, this thesis presupposes that there is, among other things, a mind-independent structure which can be described in a unique way which is independent of any particular point of view. This property of uniqueness guarantees that there cannot be many different descriptions of this
132 structure which are incompatible to each other and consequently that our knowledge will be conjoinable, if it is true with respect to this structure. It follows that the danger of irresponsible relativism is avoided. On the other hand, it is obvious that it is not possible to conjoin our total knowledge at any given time without running the risk of ending up with an inconsistent theory. For example, so far it is not possible to consistently conjoin general relativity and quantum theory. The reason for this impossibility is due to the fact that our current theories still contain many errors and falsehoods. It follows that there can be theories sentences of which are incompatible with each other. Thus, the fact that theories cannot be conjoined is a sympton of incorrectness. To overcome this situation those theories must be further developed towards the ultimate goal of a unified theory of knowledge. This means that our cognitive activities must be directed towards a particular goal which should be reached eventually. Besides uniqueness, the idea of a unified theory of knowledge therefore also presupposes some kind of directedness. The notion of directedness implies that there will be (or at least is in general) a gap between what is currently believed and what should be believed according to this goal. It follows that the notion with respect to which this goal is defined is a normative and not only a descriptive one. It is this gap which seems to be the feature which forecloses the possibility of irresponsible relativism because the irresponsible character follows from the fact that one is allowed to choose different standards in an ad hoc manner such that there need be no gap between these standards and what is currently believed. Internal realism can now be characterized as a position which denies the first claim, i.e. that of uniqueness, but not the second one, i.e. that of directedness. The thesis of internal realism, then, is that irresponsible relativism can be avoided if our cognitive activities are directed, that is, if one acknowledges that there is a gap between what is believed at a particular moment and what should be believed, but that there need not be a single goal towards which our intellectual activities are directed. The question is whether the notion of directedness is compatible with or even required for an internal realist position. I think the reason for requiring directedness on an internal realist is the following. According to Putnam, truth
Internal Realism, Rationality and Dynamic Semantics
133
cannot be identified with warranted assertability at a given moment by a particular individual or community. In a certain way truth transcends the ‘hic et nunc’ of current belief. This transcendence is just what makes truth a property of sentences. On the other hand, if truth must be obtainable, at least in most cases, to be an understandable property for us, there must be the possibility of ‘moving’ from one’s current (incorrect) belief state to a belief state in which the sentences can be said to have the property of truth in the sense understood by Putnam. The question is in what sense directedness without unity is sufficient for avoiding the possibility of irresponsible relativism. Finding an answer to this question means first giving an answer to the question towards what exactly our cognitive activities are directed. It is obvious that it is not possible to say that it is the truth because this would presuppose that there is something unique which characterizes our beliefs (and sentences) and this is incompatible with the moderate relativism which underlies internal realism. One would at once get the problem of the unity of our knowledge which Blackburn addresses according to which it should be possible to conjoin sentences which are taken to be true. But this is not possible in an internal realist position, as we have seen. Note that for a metaphysical realist the factual development of our cognitive activities and the achieving of the goal are not linked to each other. This is due to the radical non-epistemic character of the notion in which the goal is defined, that is, correspondence truth. According to Putnam, the goal cannot be something that is radically nonepistemic because it has to depend, at least partly, on our general interests and desires because it is only then that the truth of sentences can be made intelligible to us. Compare the following passage: As I have formulated my position in the past, every truth that human beings can understand is made true by conditions that are, in principle, accessible to some human beings at some time or other, if not necessarily at all times or to all human beings. (Putnam(92), p.364) Consequently, the goal with respect to which the direction of our inquiries is defined cannot require a ‘view from nowhere’. But what can be used to fill in
134 this lacuna on an internal realist position? In order to answer this question let us come back to other notions of truth. Putnam rejects the disquotational account of truth according to which the claim that a sentence S is true amounts to nothing more than the claim that S, or, to put it differently, that ‘S is true or false’ is just the same as saying ‘S or not-S’. It follows that for a deflationist truth is not a genuine property of sentences nor is it explained in terms of other notions like correspondence or degree of confirmation. For Putnam giving up the idea that truth is a genuine property of sentences is wrong. With respect to Quine’s position, which can be taken to be a deflationist one, he writes: The price one pays for Quine’s solution to the metaphysical problem is abandoning the idea that truth is a substantial notion, the idea that truthor-falsity is a genuine parameter with respect to which we appraise one another’s utterances and writings. When I say that I am trying to decide whether what you have said or written is true, then, in Quine’s view, all I mean is that I am making up my mind whether to ‘assent’. But this is to give up what is right in realism. The deep problem is how to keep the idea that statements are true or false, that language is not mere noise and scribbling and ‘subvocalizations’, without being driven to postulate mysterious relations of correspondence(Putnam(90), p.93). Let me first point out what seems to be right about a disquotational theory of truth. If a sentence is accepted by someone or if it is part of a theory, it is eo ipso treated as a true proposition at the time of its acceptance.19 Being part of our belief system means that, at least for the time of acceptance, the falsity of the sentence is not regarded as being a serious possibility. Thus, ‘S is true’ is just another way of asserting S. For example, we use our beliefs to make inferences to guide our actions or to calculate our expectations. In all those practices we always suppose that the inferences or calculations are based on true premises. This is different for a metaphysical realist who defines truth in terms of some kind of metaphysical correspondence. On this account asserting S or claiming S to be true cannot be identified with S being true in this metaphysical realist sense. The reason again is that both asserting and claiming to be true are epistemic notions which can well be warrantedly be used without it being the case that the right correspondence relation exists between the words in a sentence and parts of the world. Consequently, for a metaphysical realist truth
Internal Realism, Rationality and Dynamic Semantics
135
is a genuine property of sentences or a ‘genuine parameter’ to use Putnam’s words because truth is defined by means of something which is ‘outside’ of our current belief systems or our current standards of justification and proof. It is just this non-epistemic character which makes the notion of truth appropriate as the central notion towards which scientific inquiry can or even should be directed. As we have seen, Putnam wants to follow the metaphysical realist in taking truth to be a genuine property of sentences. The ‘genuiness’ can now be said to consist in the independence of the truth of a sentence from our current beliefs. Formally, this shows up in the non-validity of the disquotational scheme. Yet, the question is what exactly Putnam wants to use instead of the metaphysical realist notion of truth. Note that trying to link the notion of truth to epistemic notions like verification or degree of confirmation is no alternative for Putnam for the following reasons. First, there is the well known objection that it is not possible to define the truth of a sentence in terms of any combination of epistemic notions like confirmation or verification conditions because a sentence can have, say, a high degree of confirmation without being true. This does not only hold on the metaphysical realist picture but also for an internal realist because the degree of confirmation is always linked to a particular theory and therefore to a particular point in time. Consequently, there would be no independence of the truth of a sentence from what is actually believed if it were defined in terms of degree of confirmation. This kind of argument is used not only by a metaphysical realist but also by those who do not follow him and reject any attempt at defining truth in terms of correspondence like Carnap or Davidson, for example. On the other hand, the account of truth given by these two authors is a disquotational one and thus does not yield, according to Putnam, a substantive notion of truth. The second reason for not reducing truth to any combination of epistemic notions has already been mentioned above. Putnam does not want internal realism to itself reduce to any form of verificationism according to which a sentence can only be true because of some kind of proof or empirical evidence one has. Yet, Putnam holds that our understanding of the notion of truth depends essentially on a prior understanding of the notion of warranted assertability:
136 I still continue to insist ... that our grasp of the notion of truth depends on our grasp of the notion of warranted assertability (Putnam(92), p.365, italics not added). The reason for this insistence is that truth must be related to our practices of justifying the assertion of sentences in particular situations or contexts. Without such a grounding in those practices the same objection which Putnam levels against the notion of truth used by the metaphysical realist would be possible, namely, that this notion is simply unintelligible from the standpoint of a human being. This linkage must not be misunderstood as a claim that our conception of when a sentence is true is exhausted by our conception of possible situations in which this sentence is correctly asserted by someone. The problem with such a reduction is that it is based on the assumption that there is a general relationship between the truth of a sentence and the class of situations in which it can be correctly affirmed. For the metaphysical realist this relationship is, of course, the unique correspondence relation. But even a verificationist will hold that there is such a relationship which is invariant for at least a large class of sentences, for example, a high degree of confirmation in the case of empirical sentences or some kind of (normal) proof in the case of mathematical sentences. Closely related to this objection is another one. The verificationist believes that it is possible to eventually specify the verification conditions in an effective way such that there can be, at least in principle, a convergence to a final state of inquiry, that is, a situation in which we make no more mistakes about anything.20 For Putnam such a possibility does not take seriously enough the fact that our standards of justification and evaluation of sentences are constantly changing. Taking such a possibility as a serious option comes close to adopting a ‘view from nowhere’ which characterizes metaphysical realism. The difference between the two positions, then, reduces to what is taken to be the objective standard, correspondance truth on the one hand and effectively given justification conditions on the other hand. In both cases the relationship to our actual practices is lost. The question, of course, is in what exactly the relationship between warranted assertability and truth consists. Here Putnam’s answer is already adumbrated in the definition given in (7) that truth is idealized rational accept-
Internal Realism, Rationality and Dynamic Semantics
137
ability. The relation to the notion of warranted assertability is that the idealization must be understood as an idealization of warranted assertability.21 This idealization must not be understood as implying the idea of an ultimate coherent and complete account of the world, that is, an end of inquiry in the sense of Peirce. But what, then, is meant by this idealization? Putnam is not very explicit about this. At one place he writes: If a statement can withstand all the criticism that is appropriate given its context, perhaps that is truth enough (Putnam(90), p.223). Yet, this seems to be too weak because it allows a position according to which those sentences are true which are assented to by most of the people at a time and against which no one is able to find a strong enough criticism. In a reply to Dummett he gives the following example for what it means to be in an ideal epistemic position to warrantedly assert the sentence ‘There is a chair in my study’: The ideal epistemic situation would be for me to be in my study, with the lights on or with daylight streaming in through the windows, with nothing wrong with my eyesight, with an unconfused mind, without having taken drugs or being subjected to hypnosis, etc., and look to see if there is a chair there (Putnam(94a), p.291). What is missing is some kind of independence from the context which is mentioned in the last but one quotation above which, at the same time, does not imply the existence of an end of all inquiry in the Peircean sense. One way of achieving this is to define truth with respect to different perspectives or views of the world. To avoid the charge of relativism and irrationality this definition must not be local to one particular stage of inquiry which is associated with the given perspective but rather the definition must be given in terms of the development which this perspective can take in the light of new evidence. Internal Realism and Theory Dynamics Let us summarize the theses about the notion of truth according to an internal realist position. There are in sum five different theses:
138 (i)
Truth is a genuine (or substantive) property of sentences.
(ii)
Truth may be recognition-transcendent, even if this can not generally be the case.
(iii)
Truth is not (metaphysical) correspondence.
(iv)
Truth or truth conditions of sentences must be based on a notion of warranted assertability or the notion of a warrant,even if it cannot be reduced to these notions. Rather, truth is an idealization of the notion of warranted assertability.
(v)
Truth is, at least in part, dependent on our (current) belief system, knowledge, interests and desires.
Truth can be said to be a genuine property of sentences because of (iv), that is, because it is not exhausted by what is warrantedly assertible at a particular moment of time by a particular person or a particular community. The feature of idealization makes it also possible to say that truth need not be tied to what is in principle possible for human beings to recognize as a verifying situation for a sentence. On the other hand, even if truth is an idealization of warranted assertability, it is linked in an essential way to it and thus to an understanding of how sentences can be used in particular situations in which one has a warrant to assert this sentence. The relation between the notion of truth on an internal realist account and the idea of a dynamic conception of our cognitive activities is given in the fifth thesis: if the standards of truth and justification can possibly change in the course of our cognitive activities, truth cannot be defined independently of those activities when they themselves are viewed as not being restricted to a single moment in time but as something which evolves through time. Yet, this is exactly what both the metaphysical realist and the Dummettian antirealist do, as we have seen in the last section. For them, the parameters with respect to which a sentence is evaluated are defined independently of the course our cognitive activities take. This accordance between realists and antirealists reveals another point on which they agree, namely, the idea of a static world which science or common sense have to describe or investigate as the ultimate aim of all cognitive activity. The difference between the two positions, then,
Internal Realism, Rationality and Dynamic Semantics
139
stems from the fact with respect to which notion such a description of the world is evaluated or has to be correct and complete: correspondence truth in the case of a realist and some kind of effective verification conditions in the case of an antirealist, as we have seen. Consequently, one is primarily interested in characterizing the set of true or effectively verified sentences. What is missing are any sentences characterizing our policies or strategies of changing and revising our current belief state. According to a static conception, this is simply not necessary because one always works under the assumption of what has to be the case in some final state of knowledge. In this situation there is no need for any methodological policy of how to revise one’s belief state because no such revision is needed any more or even possible. Let us call such policies revision strategies. Ramsey distinguished two different kinds of beliefs: factual beliefs which are (directly) about the world and general beliefs which express methodological policies of how we should change our beliefs in the light of new evidence. General beliefs can be taken to express revision strategies. According to a dynamic conception of our cognitive activities, what is important is not only a possible final state of knowledge which can be arrived at, at least in an idealized sense, but the relation between any two consecutive belief states. It follows that what is needed is some kind of strategy or methodological policy of how a belief state is changed or revised in the face of new information which is incompatible with the information contained in this current belief state. This means that what is important for an inquirer or individual to be rational is not only (or perhaps not so much) to have a set of true beliefs or to have a strategy which ultimately arrives at such a set, in whatever sense of true, but, rather, to have a strategy to change his beliefs or belief state. The important point to note about the conception of Carnap or, to put it in more general terms, those who base a notion of meaning on epistemic notions like degree of confirmation or some similar notions is that the impetus to change a theory must at least in most cases come from the ouside, for example by doing experiments or making new observations, and that what is affected by possible revisions which are triggered by those experiments or observations is the degree of confirmation of a sentence.22 The reason for being
140 interested in a higher degree of confirmation of a sentence is that theories the sentences of which have such a high degree of confirmation tend to lead to better predictions with respect to testable consequences and also to have a higher explanatory value. It follows that a theory cannot be revised on the basis of the truth of a sentence. This is a consequence of the fact that truth is not taken to be a substantive property of a sentence. A sentence cannot be said to have this property in one theory and to lack it in another one, when viewed from the point of the two theories, respectively. For the deflationist the notion of truth is internal to a given theory and inside a particular theory the truth predicate trivially applies to sentences which are an element of the theory. To put it differently: truth does not, so to speak, transcend a given theory. Consequently, there can be no gap between a sentence being true and a sentence being believed to be true in so far as the sentence is an element of the current theory. This is in contrast to the position of a metaphysical realist. For him the change should ultimately take place with respect to the notion of (metaphysical) truth. Degree of confirmation (or verification) can only be used if the use of a theory is instrumental rather than epistemic. For an internal realist too the change of our theories or our current belief sets should be made with respect to the notion of truth, because it is this property we are ultimately interested in.23 On the other hand, contrary to what the metaphysical realist believes, truth must be related to what can be known in principle by human beings, i.e., truth must be epistemically obtainable or accessible, at least in most cases. But this requirement can only be met if a theory is revised according to our current standards of evaluating sentences, as it is the case for a deflationist. The relevant criterion for a deflationist is to maximize the degree of confirmation (or verification) of a sentence.24 Yet, there is an important difference between a deflationist and an internal realist. The deflationist can determine the success of revising a theory immediately, that is, of whether the degree of confirmation has increased. This is not possible for an internal realist because the notion of truth is not a property which can be determined by inspecting only our current beliefs, in contrast to the notion of degree of confirmation (or that of warranted assertability, for that matter), the exact value
Internal Realism, Rationality and Dynamic Semantics
141
of which can be determined in each particular stage of an inquiry. One can express this difference between the two notions by saying that whereas (degree of) confirmation is a local property of a theory, truth as understood by an internal realist is not a local property but must be seen more globally. This global character can only be defined with respect to a particular inquiry or research program. Truth must be a global property of a particular inquiry. This independence of truth from a particular theory or belief state expresses the fact that the truth of a sentence is independent of the hic et nunc in the form of the current standards of justification and proof. The dependence on whole inquiries (or research programs), on the other hand, shows that truth does depend on what is possible for us. Note that for a metaphysical realist truth is a local property too because if it were possible for us to adopt a point from nowhere (or a God’s eye perspective), we could at each stage of an inquiry know which sentences stand in the correct correspondence relation to (parts of) the world and are therefore true (in the metaphysical realist sense) and for which this does not hold. It follows that what is needed on the internal realist account is a framework which allows him to model the changing standards with respect to which sentences are evaluated, on the one hand, and to model the idea that truth is a substantive property of sentences, on the other hand. We want to suggest that what is needed for an internal realist not to run the risk of being compatible with non-rationalist positions is to shift from a static to a dynamic conception of knowledge and belief or scientific inquiry. Revision Strategies How can revision strategies be represented formally? There has been much work in recent years on this topic, especially by Peter Gärdenfors.25 He distinguishes three different types of operations which can change a given belief set K. (i)
Expansion: Expanding a belief set K with a sentence p, written K+p, means that p is added to K. If p is already in K or is consis tent with K, the resulting belief set is itself consistent, otherwise it
142 is inconsistent. If a belief set K is modelled as a set of sentences, K+p can be formally defined as K c {p}.26 (ii)
Revision: In this case, the new sentence p is inconsistent with K but the result of adding p to K, i.e. the revision of K with p, writ ten KÐ p, is required to be a consistent belief set. It follows that at least some of the old beliefs in K have to be deleted before p can be added to K.
(iii)
Contraction: In a contraction, written K-p, p is retracted from K with out there any new sentence q being added to K.27
With a contraction and an expansion operation at hand, it is possible to define the revision operation by means of the two other operations in the following way: (iv)
KÐp=def.(K-¬p)+p
According to this definition, the so-called Levi-identity, in order to revise a belief set with a sentence p one first contracts with the negation of p, i.e. ¬p, thereby removing any possible sentence which is inconsistent with p, and then, in a second step, expands with p. Note that it is not possible to define the contraction operation (and because of the Levi-identity, the revision operation) uniquely by only using logical notions. We will come back to this problem below. An important questions concerns the relation between the two components, i.e., sentences characterizing the revision strategy and sentences (directly) about the world. For example, in what sense is the revision strategy determined by our factual beliefs? Robert Stalnaker argues that different revision strategies are only possible if there is some difference in factual belief. I will argue that different dispositions to change what one accepts are always grounded in different factual beliefs. This is why the distinction between the two components of a belief state does not amount to a distinction between two kinds of belief ... But isn’t it at least conceivable that two people might agree in all their beliefs about how things are but disagree about how to respond to new information? This is not conceivable, I will argue, because even if there is no independent way to specify the factual disagreement that explains the difference in
Internal Realism, Rationality and Dynamic Semantics
143
methodological policy, we take the latter difference itself to constitute a factual disagreement (Stalnaker(87), p.102). It follows that for Stalnaker two people who have exactly the same beliefs will react to new information in the same way. Formally, this means that revision is a function which maps a belief state and a sentence to exactly one (possibly new) belief state. Stalnaker gives the following example to sustain his view. There are two people, call them John and Bill. Neither John nor Bill believes Ted Kennedy to be the Democratic nominee for President in 1984. John believes that if contrary to what he expects Kennedy will try to obtain this nomination, he will win. Bill, on the other hand, thinks this is wrong: even if Kennedy will be candidate for the Democratic nominee, he will not win. Thus, they use different revision strategies. If both John and Bill learn that Kennedy will be candidate, John revises his belief state to the effect that Kennedy will win, whereas for Bill such a revision is not necessary because he thinks that even in this case Kennedy will not be the nominee because he will loose. This difference must be grounded in differences with respect to what John and Bill believe, say, about the preferences of those who decide on the nominee or the political qualities of Ted Kennedy. John may think that Democrates think that Kennedy will be a good president, perhaps comparable to his brother John F. Kennedy, whereas Bill may just believe the opposite: Democrates think that Ted Kennedy does not have the same qualities as his brother and that he only wishes to have political power. It follows that the difference in revision strategy is due to a difference in factual belief. On the level of revision strategy the difference is reflected in the conditional sentences that are accepted.28 For example, one particular revision strategy may be to be disposed to accept a sentence p if one learns that sentence q is true, that is, one is prepared to include p in one’s belief state conditionally on q. But this does mean that one accepts the sentence ‘If q, then p’.29 For instance, in Stalnaker’s example the corresponding conditional sentences are ‘If Kennedy is nominated, he will win’ and ‘If Kennedy is nominated, he will not win’. Note that due to the fact that both conditionals are mutually incompatible to each other this kind of conditional cannot be modelled by means of material implication. The sentence ‘q 6 p v q 6 ¬p is satisfiable. It is true if q is false.
144 But let us come back to the question of whether the revision of a belief set will always be functional. Consider the following example. Let the belief set K consist of the following sentences: p, q, p v q 6 ¬r as well as their logical consequences. Suppose that the new evidence is r. Clearly, r is incompatible with K. Thus, one has to revise K with r. According to the Levi-identity, one first has to contract with ¬r. This means that one must delete ¬r from K. As ¬r is a derived belief, one also has to delete those sentences which enable one to derive this sentence. It follows that in the example at hand at least one of the sentences p, q or pv q 6 ¬r must be given up. But there is no logical reason to choose one of the three options rather than any other. This is the problem of the underdetermination of theories by data. The new evidence r does not logically force a unique revision upon the scientist. What conditions can an internal realist impose on the revision operator to narrow down the possible choices? One possibility is to use the fact of the interest-driven character of inquiry. This allows one to make a distinction between what is tested in an experiment and what is taken for granted or settled, that is, what is taken as a background assumption.30 This distinction can be implemented by assuming that those sentences which are not tested are not eligible for revision. In a particular experimental situation they are taken as a kind of analytic truth. In the above example, for instance, it could be that what is tested is the correctness of the implication. This means that the truth of p and q is taken for granted and one consequently has to give up the implication. On the other hand, this way of proceeding is not the only possible one for an internal realist. Even if it is the implication which is tested according to one set of interests, there could as well be other interests which decide otherwise. For example, one could decide to give up p instead and retain the implication. A consequence of this is that in general there can be many different outcomes of a revision which are all allowed according to an internal realist position. But such a possibility seems to sustain the criticism that in the end internal realism will lead to an irresponsible relativism according to which (almost) anything goes. On the other hand, a metaphysical realist will reply that the underdetermination of theories by data does not exist but is only a consequence of the relativistic basis of internal realism, that is, of his denying the availability
Internal Realism, Rationality and Dynamic Semantics
145
of an objective, non interest-relative criterion. Rather, what is the case is that there is no underdetermination and that consequently each revision leads to a unique result. The question an internal realist has to answer is how it is possible to combine the idea of truth as idealized warranted assertability with this possibility. Internal Realism and Dynamic Semantics Is there any relationship between Putnam’s criticism of both metaphysical realism and verificationist accounts and the static conception of knowledge and belief on which they are based? As we have seen, Putnam criticizes both positions for grounding knowledge, truth and meaning on something which can at least in principle be given once and for all: correspondence truth based on a fixed totality of objects in the case of metaphysical realism and effectively given (recursively defined) justification conditions in the case of the verificationist. The general assumption which both positions share is thus that of a complete procedure which gives rise to a complete and correct description of the world. It is this assumption which leads to the view that the central notion with respect to which sentences are evaluated is local in the sense that it can be defined with respect to a single theory or a single belief state. It is especially the assumption of completeness which runs counter against our actual cognitive or intellectual practices which are inherently partial. This partial character shows up in the fact that those practices are always directed to only a limited part of the world or to several but not all aspects of a given domain. Partiality may have different reasons. For one thing, it is a consequence of the interest-directed character of our intellectual activities. We are interested in one particular problem in one particular domain but never in all problems in all domains (if this is intelligible at all). Consider the following example from natural language. The definite article the is often said to carry a uniqueness condition with respect to the maximal underlying domain. For instance, the sentence ‘The present king of France’ can only be true if there is exactly one individual which is currently king of France. But many sentences lack such a strict presupposition, for example the sentence ‘The man entered
146 the bar’. This sentence can be true even if there is more than one man in the universe. This is due to the fact that what is presupposed by the sentence is not the whole world, that is, one does not make a claim which assumes the whole world as background but only a rather small part of it. On the other hand, partiality is due to our limited cognitive capacities. For example, no one of us will, at least not in general, be able to deduce all logical consequences of our current (explicit) beliefs. It follows that our belief sets are not deductively closed. A consequence of this partial character of our theories or belief states is that the standards we use to evaluate sentences are themselves only partial and therefore not fixed forever. Rather they can change as a result of our cognitive activities. It follows that one can have a belief state s and another belief state s’ such that the standards which are used to evaluate a sentence can be different. Consequently, neither correspondence truth nor effective justification conditions can be that towards which our cognitive activities are directed because such notions do not depend essentially on what is currently believed. Let us illustrate this by means of one of Putnam’s own examples: ‘There is a chair in my study’.31 In case one only has warranted assertability, the claim that there is a chair in my study can be challenged for different reasons which all have to do with one of the conditions which must be satisfied in order that the sentence can be truly (or warrantedly) asserted. For example, it could be the case that one of those conditions does not hold, say, that the observer has taken drugs or that his sight is not normal. Yet, more important are two principled kinds of objections one can raise. First, it can happen that with respect to one of the conditions which is relevant in that the obtaining of it matters for the truth of the claim it is the case that this condition has not been determined in the appropriate way. For example, one may detect so far unknown defects of eyesight such that a person which suffers from those defects is not a reliable observer. Thus, even though the conditions were specified in a correct way in the particular situation at hand, new evidence shows that the standards associated with this factor were too low. The second kind of objection has to do with the aspect of whether the conditions one has determined are complete. There may be conditions which are relevant and which have so far not been
Internal Realism, Rationality and Dynamic Semantics
147
included in the list of relevant conditions. For example, external factors like temperature may have an influence on the constitution of the observer which must be taken into account. In both cases the standards with respect to which the above sentence is evaluated are changed and as a consequence the sentence will no longer be regarded as true. Viewed from a dynamic perspective, this means that the sentence is deleted from the current belief set K as the result of the changed assertability conditions expressed in form of, say, the sentence q. Consequently, one has to revise K with q, i.e., one has to construe KÐq. Note that this revision is a proper one in the sense that old beliefs have to be retracted. Thus, it holds that K é KÐq. Repeating our inquiries will lead to a sequence of belief sets K0, K1, K2, K3, ... as a result of applying some revision strategy in the light of new evidence. According to the positions of Carnap, Horwich and others, what should be maximized in such sequences is the degree of confirmation or justification. Thus, the aim of our cognitive activities can be said to arrive at a belief set K such that for each sentence p in K the degree of confirmation is greater than 0.5.32 According to Putnam’s internal realism, what should be maximized is our knowledge about epistemic ideal conditions under which a sentence can be ideally warrantedly asserted. What happens if these epistemic conditions are known and expressed in a belief set Kn? Now in this case an utterance of the sentence ‘There is a chair in my study’ can no longer be challenged if those conditions are in fact satisfied in the context of utterance. Viewed again from a dynamic perspective, it follows that there can be no more revision with respect to this claim (or this sentence). But this means that the sentence is stable in the sense that it will be an element of all later belief sets. In other words: this sentence will not be deleted from future belief sets. Stability of sentences with respect to revision amounts to the fact that each revision is an expansion which does not result in an inconsistent belief set. Consequently, new evidence is compatible with what one believes at the time when the new evidence is registered. The relation between stability and truth as idealized warranted assertability can then be defined as follows. Definition 1
148 The sentences of a belief set K are true in the sense of idealized warranted assertability (or idealized rational acceptability) just in case the belief set is stable under a revision strategy RS. The fact that a belief set K is stable under a revision strategy RS can be defined in the following way. Definition 2 A belief set K is stable under a revision strategy RS just in case all revisions can be reduced to (consistent) expansions, i.e., if one has KÐ p = K+p for all sentences p. That a particular revision strategy RS leads to truth in the sense of internal realism can be defined as given in Definition 3. Definition 3 A revision strategy RS leads to truth in the sense of idealized warranted assertability just in case there is a time t such that for all t’ with t’ > t it holds that (KÐRSp)t’ = (K+RSp)t’. If all revisions are (consistent) expansions, it follows that for each new evidence represented by a sentence p it holds that it either is already in the belief set K or that it is not in K but compatible with the information contained in K. It follows that no sentences of K have to be retracted in the light of new evidence.33 Let us make the following observations. First, the conception we have presented is compatible with there being not a single research program based on one view of the world. There can be several such programs which are based on different views having distinct ontologies. Consequently, progress need not consist in approximating one complete and correct description of the world which details the unique totality of objects existing in the world. Thus, no totality of all objects which is fixed once and for all is presupposed. On the other hand, this conception can be seen as implying some kind of coherence between what is believed and the evidence one can get for what one believes. This is in accordance with what Putnam himself expressed about truth in ‘Reason, Truth and History’: ‘Truth’, in an internalist view, is some sort of (idealized) rational acceptability - some sort of ideal coherence of our beliefs with each other
Internal Realism, Rationality and Dynamic Semantics
149
and with our experiences as those experiences are themselves represented in our belief system - and not correspondence with mind-independent or discourse-independent ‘states of affairs’ (Putnam(81), p.90, italics added). Second, it is not only the current belief state and the view embodied in it which is relevant for an evaluation of the beliefs an agent has, as is held by many relativists. Rather, one also has to look back at previous belief states, that is, one has to take into consideration what has been believed before. This is necessary in order to be able to detect situations like those in which the cognitive activities have gone into a kind of loop. In such a situation one starts in a belief state s0 and after a finite number of (proper) revisions one is in a belief state sn which is identical to the belief state s0 one started in. Furthermore, the perspective adopted here is a dynamic one in that what is relevant is not only the fact of whether a sentence is true but also how this sentence can be incorporated into a given belief set K. Consequently, what is important with respect to a sentence or the meaning of a sentence are not so much its truth conditions but rather the change this sentence brings about in relation to the belief set to which it is added. Let us elaborate on this distinction. In static semantic theories the meaning of a sentence is a set of assignments or, working in an intensional setting, a set of possible worlds, namely, the set of all those assignments under which the sentence is true or all those worlds in which the sentence is true. In a dynamic setting the truth conditions become secondary. Instead, one focuses on the information change potential of a sentence. For example, a belief set is a particular information state. Applied to such an information state, a sentence will change this state in a particular way. For instance, in the example we used above to illustrate the non-functional character of revisions, the sentence r can be said to change the belief set K, consisting of the sentence p, q and p v q -> ¬r, to a new belief set KÐ r. It takes a belief set K and transforms it into a new belief set. Applied to the parameters with respect to which the truth conditions of a sentence are defined in static approaches, the meaning of a sentence is a relation between assignments or a relation between sets of possible worlds. For example, in the case of an expansion the meaning of a sentence can be taken to be a function which takes a set of possible worlds, namely, all those worlds which are
150 compatible with the input belief set, to another set of possible worlds which is the intersection of the first set with all those worlds in which the sentence is itself true. This dynamic perspective on the meaning of a sentence is directly related to the importance the notion of coherence has for the evaluation of beliefs. Stability means that new evidence does not conflict with what is believed so far and this can be expressed by saying that new evidence formulated as a sentence or a belief must cohere with the sentences in our belief set K (or with the beliefs making up our belief state). As a consequence, the methodological policy we are suggesting here does not require that one is justified in maintaining a sentence in a belief set K only if one has a specific reason to do so, for example in form of a deductive argument which is ultimately based on some kind of basic belief which is self-justifying or self-evident. Part of the justification of a sentence in a belief set comes from the fact that it is compatible with the other beliefs which are elements of this set. Thus, the proposed methodological policy incorporates a principle of conservatism. This principle is defined by Harman in the following way: Principle of Conservatism One is justified in continuing fully to accept something in the absence of a special reason not to.(Harman(86), p.46) On the other hand, stability is not a local property of a belief state or a sentence because one cannot decide whether this property applies to a sentence by inspecting only the current belief state. Rather, what is necessary is to see whether this belief state is a (proper) subset of further belief states. This independence of the truth of a sentence from what is currently believed or from the fact whether it is an element of the current belief set can be seen as the feature which makes up that truth is not reduced to warranted assertability. Warranted assertibilty is a property of a sentence which solely depends on the current belief state and not on other belief states as well. From this non-local or global character of stability it also follows that truth can be recognitiontranscendent because we cannot be sure that if a sentence is an element of a belief set K at time t that it will be an element of all further belief sets in this research program. An example is provided by the sentence ‘There do not happen to be any extraterrestrials’. Suppose that this sentence is an element of
Internal Realism, Rationality and Dynamic Semantics
151
the belief set K at time t and that the evidence for having incorporated this sentence into K has not been conclusive. Then we cannot be sure that at a later time t’ we will encounter extraterrestrial forms of life, irrespective of what time t we choose. A further characteristic of the above method is that stability depends on the revision strategy which is used. Assuming that the revision strategy itself is not fixed once and for all such that there can be different strategies makes truth dependent on the choice of a particular revision strategy. It follows that contrary to what Dummett requires there need not be any fixed justification procedure for a sentence. A sentence is at least partly justified by being an element of a belief set which is stable. Furthermore, the stability does not apply to the number of research programs (or world views) that are initialized or undertaken. We have already envisaged above the possibility that the result of a revision need not be unique and that different revisions can lead to new research programs. What is important is that each research program stabilizes at some time in the sense that the sentences believed at that time are not deleted at later times from the belief set K representing this research program. The Problem of the Constancy of Reference Let me point out one feature of the approach sketched so far. The revision strategy is a strategy which operates on the level of (whole) sentences and belief sets. The notion of reference does not play any role at all, or, to put it more generally, the semantic values of subsentential constituents do not matter. Those who oppose forms of internal realism may object to this feature just because for them one criterion of the rationality of the scientific enterprise is that we can say that people two hundred years ago have used, say, the word ‘plant’ in a way which is comparable to the way this word is used nowadays. Now this claim must be read as an assertion about the reference of the term ‘plant’: even if many factual beliefs of our ancestors about plants may have been wrong (and so may be many of our current beliefs!), it is nevertheless true to say that they meant (or intended to speak about) the same kind of object as we do when we use this word. Such a constancy of reference seems to be a
152 necessary condition if one wants to treat our ancestors as rational beings and not as mere creatures who uttered noises. This line of reasoning was an essential part of the ‘realist’ Putnam, in particular of that Putnam who wrote ‘The Meaning of Meaning’ and ‘Meaning and the Moral Sciences’. Applied to the approach we have sketched the question cannot be of whether reference has to be stable across different perspectives of the world because it is just one of its central premises that there can be different perspectives which use different ontologies. But what about the development in a single branch, that is, in a single research program? For example, take the case of Newtonian physics where on one version there are particles and forces which act on the particles but where there are no fields through which the forces are propagated, whereas on a second, alternative version there are two such fields, namely the electromagnetic and the gravitational field. Must it be the case that if one works in one of these variants, say the second one, the notion of a field must be a referential constant in order that there can be some kind of growth or directedness? An answer to this question clearly depends on what exactly is meant by referential constancy. In the metaphysical realist picture there seems to be an easy answer. If the word ‘plant’ stands in the right (that is causal) reference relation to the correct (elite) class of objects in subsequent stages of a single theory or two different theories, then the word is used in the same way in both cases despite possible differences with respect to which properties are ascribed to members of this class. The constancy is thus defined in terms of the mind-independent objects in the world and the reference relation between parts of this world and items in a language. But what attitude can and should an internal realist take towards this question? At first it may seem that for him such a constraint is not necessary at all because there is nothing like the correct reference relation. On the contrary, imposing such a constraint rather implies that there is something outside waiting to be referred to by a word in our theories. In order to see this let us first point out what referential constancy cannot mean. First, this constancy can certainly not be identified with constancy of beliefs, that is, sentences held true, in which the word occurs because the question just is how a word can have a constant meaning while the beliefs one has about the referent may vary. Another
Internal Realism, Rationality and Dynamic Semantics
153
possibility may be to locate the constancy in the role the word plays in a theory. Here, ‘role’ could be some kind of conceptual role. The problem with this suggestion is that in conceptual role semantics the role of a word is only defined relative to a particular theory or belief system at one time but not between two systems or for one system at different times. What would be needed to overcome this is some notion of synonymy which would allow one to keep track of the role a word has in a theory which is developing or to compare the roles of a word in two different theories. Thus, the general conclusion one has to draw seems to be comparable to the one which is often made against attempts to reduce truth to some epistemic notion: the constancy cannot be defined in terms of some epistemic notion like belief or conceptual role because they may change although we still want to say that the word refers to the same class of objects. Another view of the problem of constancy of reference comes from the dynamic perspective we have adopted here. As we have observed above, a sentence which is an element of a belief set does not need a particular reason to be justified in form of basic beliefs. Once a sentence is accepted, one can apply the principle of conservatism. With respect to the notion of reference this principle can be interpreted in the sense that it is not necessary to keep track of the particular intentions which were operative when the terms was introduced in the language or the theory. If reference cannot be defined in terms of a fixed totality of objects because the latter notion does not make sense, the meaning of a word cannot be defined with respect to some part of such a fixed totality. Rather reference is defined inside a language and therefore depends partly on the decisions of those who construct the language. But the terms of the language will not be introduced one after the other but by some kind of simultaneous induction (or definition). It follows that there is a certain holism which governs the meanings of words34 and that the meaning of a word is partly defined by which other words are present in the language. In a sense, the role or function of words is reduced to that which Quine attributes to them: helping to forge structure into sentences and among sentences.35
154 Conclusion Let us advance the following two theses: (i)
Rationality has not only to do with the notions of truth or realism one has but also with the revision strategy one
uses to (ii)
change one’s beliefs. The set of possible revision strategies is invariant with respect to the different perspectives which may be pursued, that is, this set is common to all belief strategies. They can only differ with respect to the way in which possible revision strategies are applied.
The first thesis is a consequence of the rejection of the idea of a fixed totality of objects and a dynamic conception of our cognitive activities and of the notions of truth and meaning. If the notions of truth and reference are not fixed once and for all but can change as a result of our cognitive activities, rationality cannot be defined solely with respect to those notions. This is what is correct with the objection to internal realism. The weak point of Putnam’s account of internal realism is that he still tries to model the notion of truth after a static conception both of our intellectual or cognitive activities as well as of the meaning of sentences expressing our beliefs which are the result of those activities. The changing character of the standards with which we evaluate those sentences must rather be taken to be an essential element of the notions of truth and reference and be integrated into a dynamic perspective of how our beliefs are acquired and changed in the course of our activities. What is needed with respect to the notion of the meaning of a sentence, then, is a definition which incorporates this non-constant character of our standards. This does not exclude the possibility of defining a particular goal towards which our cognitive activities should be directed. On the contrary, by defining the notion of meaning as a relation between belief sets one already builds in a certain directedness (or dynamics) and therefore an independence of the truth of a sentence from what is currently believed. This can be used to define what it means for a sentence to be true. Truth, then, is what one gets if one abstracts from a particular pair of belief sets and focuses on whole sequences of belief
Internal Realism, Rationality and Dynamic Semantics
155
sets. The unity of our knowledge which Blackburn and others require for rationality can be taken to consist in the goal which is common to each research program, namely, to arrive at a stable or equilibrium state in the sense defined above. Notes 1 A mereological sum can be defined to be an object which has arbitrary objects as parts. 2 See The Many Faces of Realism and A Defense of Conceptual Relativity, in Realism with a Human Face. 3 Where ‘true’ is understood in the sense of idealized rational acceptability. 4 This objection is made e.g. by Simon Blackburn in his Enchanting Views. 5 Blackburn(94) p.21. 6 Or, at least they do not define the truth of their own point of view with respect to any objective factors. 7 At one point Putnam lets the metaphysical realist say: ‘The world is as it is independently of the interests of any describer.’ Putnam(94b), p.448. 8 These two labels are used by Putnam in his Dewey Lectures. See Putnam(94b), p.447. 9 See Putnam(94a) p.247. 10 The possibility of translating different theories which when taken at face value seem to make incompatible claims about the world and which therefore can be seen as notational variants of each other is another point on which Quine and Putnam seem to agree. For Putnam see Putnam(92) p.356. 11 Let us give a concrete example of why one may use theory 2 instead of theory 1. If one wants to semantically analyse natural language sentences with plural objects, say, in the context of Montague Grammar, the use of plural objects is almost mandatory. For instance, there is a constraint that only objects of the same type can be conjoined. Now take the sentence ‘John and his friends shared a pizza’. How should the NP in subject position be analysed? Assuming that plural noun phrases like ‘his friends’ denote a plural object of type e is one possible solution. Another is the one used in the text, that is, to assume that ‘his friends’ denotes a set of objects and ‘John’ denotes a singleton. On both analyses one needs plural objects besides the ‘normal’ objects which are the only objects assumed in theory 1. 12 It follows that Putnam’s famous model-theoretic argument which tries to show that it is not possible to construct a theory which is based on exactly one domain of objects, that is, which has only one intended model, should not be taken as a proof of Quine’s thesis of ontological relativity but, rather, as a reductio ad absurdum of this thesis. See Putnam(94a) p.251. 13 A little bit later Putnam speaks of different sorts of discourse: ‘On the one hand, to regard an assertion or a belief or a thought as true or false is to regard it as being right or wrong; on the other hand, just what sort of rightness or wrongness is in question varies enormously with the sort of discourse. ‘Statement’, ‘true’, ‘refers’, indeed ‘belief’, ‘assertion’, ‘thought’, ‘language’ - all the terms that we use when we think about logic (or ‘grammar’) in the wide sense in which Wittgenstein understands that notion - have a plurality of uses, and new uses are constantly added as new forms of discourse come into existence.’(Putnam(94b), p.515) 14 See Putnam(94b), p.511. 15 See Lewis(84). 16 The general problem, thus, is that most metaphysical realists are at the same time materialists which eschew all talk of concepts which are not definable in one of the fundamental (natural)
156 sciences, say, physics for example. But in their arguments for a realist interpretation of semantic notions like truth and reference, they not only fail to give any hints of how such notions can be reduced to concepts which are scientifically definable but they fall back on notions which stand in need of even more explication as the semantic ones, as is shown by the example of Lewis’ notion of eliteness. 17 Putnam(94a), p.261; see also Putnam(92), p.364f. 18 Note that a verificationist account is not necessarily incompatible with the idea of explaining the relation between sentences and the world in terms of the notion of a correspondence. What a verificationist cannot do is to generally define the meaning of a sentence in terms of a truthconditional semantics in which truth is explained in terms of a (non-epistemic) reference or satisfaction relation. But this does not exclude that for a large class of sentences, for instance observation sentences like ‘The cat is on the mat’, the truth-conditions will not differ from that given by a metaphysical realist. 19 Here we disregard cases where a sentence is included in a theory only for the sake of deliberation or for the sake of a reductio ad absurdum. 20 See Putnam(92), p.257. 21 See the following passage: ‘Suppose, for the moment, that what is right in pragmatism is the idea that truth is an idealization - a useful and necessary idealization - of warranted assertability. (Putnam(90), p.222) 22 Note that the positions we have in mind are deflationists with respect to the notion of truth, like Carnap and Horwich for example, but not verificationist accounts like that of Dummett. The difference between the two positions is that whereas the latter uses a notion of conclusive or effective verification, the former hold that a sentence can at most be verified or confirmed to a certain degree. 23 This does not exclude cases in which one is primarily interested in the instrumental value of a theory, for example, its capacity to make correct predictions to guide our behaviour. 24 Let me note that there exist alternative accounts. Isaac Levi, for example, holds that a revision should be made neither with respect to truth nor probability but, rather, with respect to the information value of a theory: what must be minimized in the revision of a theory is the loss of information. See Levi(84) chapter 8. 25 See Gärdenfors(88). 26 If a belief set K is taken to be deductively closed, i.e., if one has K = Cn(K), K+p must be taken to be the closure of K c {p}, i.e. Cn(K c {p}). 27 If a belief set is taken to be deductively closed (see previous footnote), then in most cases contracting with p will only be possible if other sentences are deleted from K as well. 28 Thus, it is possible to say that the general beliefs of Ramsey which express a revision strategy are (indicative) conditional sentences. 29 One should add that p is believed conditionally on q if q is all that the agent learns. There may well be cases in which someone learns that q but at the same time he also gets informed that r and that this further information prevents him from accepting p. 30 Recall the distinction between cause and background conditions which is not built-in into nature. 31 See Putnam(94a), p.291. 32 Here, degree of confirmation can be defined in terms of the notion of conditional probability. 33 The idea to define truth by means of the notion of stability is also alluded to in ‘Reason, Truth and History’. There Putnam writes: ‘Truth is expected to be stable or ‘convergent’; if both a statement and its negation could be ‘justified’, even if conditions were as ideal as one could hope to make them, there is no sense to thinking of the statement as having a truth-value.(Putnam(81), p.56)
Internal Realism, Rationality and Dynamic Semantics
157
Yet, as the context makes clear, Putnam is more concerned with the fact that not both a sentence and its negation should be true under ideal epistemic conditions. 34 Recall the passage from the Dewey-Lectures we quoted above, where Putnam himself acknowledges some form of holism with respect to a language or a language game. 35 Note in this connection the following passage, where Putnam compares his own internal realist position with respect to the problem of ontology to that of Carnap: ‘My position resembles Carnap’s (in “Empiricism, Semantics, Ontology”) inasmuch as I hold that differences in ontology sometimes amount to no more than differences in how we use words.’ (Putnam(94a), p.247, italics not added) REFERENCES Blackburn, Simon (94): “Enchanting Views”, in: Clark, P. et al.(eds.) op.cit., pp.12-30 Clark, Peter/Hale, Bob (eds.) (94): Reading Putnam, Blackwell, Oxford, 1994 Gärdenfors, Peter (88): Knowledge in Flux: Modeling the Dynamics of Epistemic States, MIT Press, Cambridge, MA, 1988 Harman, Gilbert (86): Change in View, MIT Press, Cambridge, MA, 1986 Levi, Isaac (84): Decision and Revisions, Cambridge University Press, Cambridge, 1984 Lewis, David (84): “Putnam’s Paradox”, Australasian Journal of Philosophy, 62, 1984, pp.221-236 Putnam, Hilary (81): Reason, Truth and History, Cambridge University Press, Cambridge and New York, 1981 - (87): The Many Faces of Realism, Open Court, La Salle, 1987 -(90): Realism with a Human Face, Cambridge: Harvard, 1990 -(92): Replies, Philosophical Topics, XX, 1, 1992, pp.347-408 -(94a): “Comments and Replies”, in: Clark, P. et al.(eds.) op.cit., pp.242-295 -(94b): “Sense, Nonsense, and the Senses: An Inquiry into the Powers of the Human Mind, The John Dewey Lectures”, Journal of Philosophy, XCI, 9, 1994, pp.445-517 Stalnaker, Robert (87): Inquiry, MIT Press, Cambridge, MA, 1987
158
Axel Wüstehube Noch einmal: Rationalität und Normativität
abstract The ongoing discussion about a notion of pragmatic rationality has evolved in a variety of different approaches, mainly because every author tries to combine his genuine philosophical point of view with the interpretation of “rationality”. Nevertheless there is an agreement of sorts that rationality cannot proceed mereley descriptively but has also normative implications. The paper investigates the proposals of Nicholas Rescher and Herbert Schnädelbach concerning the question of a normativity of rationality. Moreover it deals with the problem of “unity of reason” and its interconnectedness with the inherent normativity of rationality.
I. Auch wenn in der aktuellen Rationalitätsdiskussion die unterschiedlichsten Standpunkte vertreten werden (je nach philosophischer, sozialwissenschaftlicher, ethnologisch/anthropologischer etc. Ausrichtung), so scheint doch eines gleichermaßen anerkannt zu sein: Eine Theorie der Rationalität kann nicht rein deskriptiv verfahren, sie muß auch die immanente Normativität der Rationalität berücksichtigen. - Ein bekanntes Beispiel ist Habermas’ Begriff der “kommunikativen Rationalität”, die von vornherein normativ konzipiert ist, insofern mit ihrer Hilfe “quasi-transzendentale” Diskurspräsuppositionen thematisiert werden sollen. Nicht so sehr das “Haben von Wissen” sei kennzeichnend für Rationalität, als vielmehr die Art und Weise, wie Subjekte Wissen erwerben und verwenden. Der “intuitiv verfügbare” Begriff der Verständigungsrationalität appelliere “an die Erfahrung der zwanglos einigenden, konsensstiftenden Kraft der argumentativen Rede, in der die Beteiligten ihre bloß subjektiven Auffassungen in Richtung auf vernünftig motivierte Überzeugungen und geteilte Einsichten überwinden - um sich in dieser
Internal Realism, Rationality and Dynamic Semantics
159
Gemeinsamkeit zugleich der Einheit der objektiven Welt und der Intersubjektivität ihres Lebenszusammenhangs zu vergewissern.”1 Habermas opponiert damit ausdrücklich der Vorstellung, daß sich alles, was dem Sprachgebrauch an Rationalität innewohnt, auf Zweckrationalität reduzieren lasse. Vielmehr gelte, und damit geht Habermas über den in der Theorie des kommunikativen Handelns erreichten Standpunkt (daß kommunikative Rationalität die Zweckrationalität als einen ihrer Aspekte unter sich begreife) hinaus, daß beide Rationalitätstypen komplementär ineinander verschränkt sind, sich gegenseitig fordern und aufeinander verweisen. - Auch Karl-Otto Apels vielfältige Versuche, das Problem der Einheit der Vernunft, bei gleichzeitiger Vielfalt von Rationalitätstypen, in den Griff zu bekommen, anerkennen immer aufs Neue die immanente Normativität (deshalb eben: Geltungsansprüche) unserer Sprechhandlungen. In einem der letzten Texte2 entwickelt Apel ein “alternatives Rationalitätskriterium” (nämlich den “Test der Nichtbestreitbarkeit ohne performativen Selbstwiderspruch”), um alle relevanten Rationalitätstypen zwischen den beiden Polen des propositionalen Widerspruchs und des performativen Selbstwiderspruchs (d.h. zwischen “Verstand” und “Vernunft”) verorten zu können. Am einen Ende der “Abstraktheitsskala” befindet sich also die logisch-mathematische Rationalität, am anderen die Diskursrationalität, über die hinaus keine weitere Rationalitätsform gedacht werden kann, weil hier (mittels des erwähnten Tests) die schon von Kant geforderte “Selbsteinstimmigkeit der Vernunft” in einem reflexiv unhintergehbaren Rationalitätskriterium erreicht wird. Die Rationalitätstypen zwischen den beiden Extremen werden je nach ihrer Inanspruchnahme von Argumentation, Verständigung und Diskursivität angeordnet. Apel unterscheidet zwischen (1) szientifischer Rationalität (im Sinne der nomologisch erklärenden Naturwissenschaft und der quasi-nomologischen Sozialwissenschaften), (2) technisch-instrumenteller Rationalität (= Mittel-ZweckRationalität, die als “objektiv-richtige” die szientifische Rationalität voraussetzt), (3) strategischer Rationalität (= reziproke Mittel-Zweck-Rationalität, die auch als abstraktiver Grenzfall der kommunikativen Rationalität verstanden werden kann), (4) kommunikativer qua hermeneutischer Rationalität und (5) kommunikativer qua diskursethischer Rationalität. Wichtig ist, daß Typ (4) und
160 (5) komplementär zu den erstgenannten Typen sein sollen, insofern (4) für die Kommunikation innerhalb von Naturwissenschaft und Technik vorausgesetzt werden muß, und (5) den Typ (3) als abstraktiven Grenzfall der wechselseitigen Verständigung, z.B. in Verhandlungen, in sich enthält, zugleich aber den strategischen Umgang mit normativen Geltungsansprüchen aufhebt. Apel denkt hier sehr hegelianisch: Die Vernunft entäußert sich zwar im abstrakten Verstand, sie hebt diese Entäußerung aber in der selbstreflexiven Diskursrationalität wieder auf - und stellt damit die Einheit von “Sein und Sollen”, von “Faktizität und Geltung”, von Deskription und Normativität wieder her. Auch Autoren, die den eher formalen Rationalitätsbestimmungen in der Spielund Entscheidungstheorie, den verschiedenen Zweigen von Wissenschaftstheorie und Methodologie nicht von vornherein skeptisch gegenüberstehen, anerkennen die Notwendigkeit eines normativen Rationalitätsbegriffs. Stefan Gosepath3 betont, daß die Rationalität von Meinungen und Handlungen, von Wünschen, Normen und Expressionen in ihrer jeweiligen Wohlbegründetheit besteht. Diese Begründungen können sich zwar logischer, mathematischer und entscheidungstheoretischer Hilfsmittel bedienen, was aber für praktische Entscheidungen und Evaluationen nicht hinreicht. Gosepath unterscheidet vier verschiedene Typen bzw. Begründungen von Rationalität. (1) Relative theoretische Rationalität. Begründung von Meinungen durch formale Prozeduren oder Verfahren: “internalistische, kausale, deontologische und prozeduale Konzeptionen von ‘Rationalität’”.4 (2) Absolute theoretische Rationalität. Das Problem ist hier: Sind die theoretischen Rationalitätsregeln für alle Vernunftwesen universell gültig oder sind sie variabel und relativ? Gosepath gesteht zwar eine Relativität von kognitiven Ausgangszuständen, nicht aber der von Standards theoretischer Rationalität zu. Um die wissenschaftlichen Standards selbst zu begründen, bedürfe es des Bezugs auf die Lösung “basaler praktischer Probleme des Lebens”,5 damit auch auf das pragmatische Erfolgskriterium und das aufgeklärte Eigeninteresse jedes einzelnen. (3) Relative praktische Rationalität. Handlungen müssen ebensogut begründet werden wie Meinungen. Voraussetzungen für rationale Handlungen (im Anschluß an Davidson) sind: Freiwilligkeit; Absichtlichkeit; Bezug auf Wünsche, Interessen, Meinungen; Optimalität; Verursachung durch die relevanten Gründe und auf
Internal Realism, Rationality and Dynamic Semantics
161
die richtige Weise. Wünsche und Meinungen können als interne Gründe motivational und kausal wirksam werden. Gosepath geht es um eine “zielgerichtete Überlegung zur Lösung eines praktischen Problems ..., die bestimmte Standards oder Maßstäbe der Korrektheit erfüllen soll”.6 Zwischen praktischen (ebenso wie theoretischen) Alternativen läßt sich mittels Modellen rationaler Wahl eine Entscheidung treffen. (4) Absolute praktische Rationalität. Als solche bezeichnet Gosepath einen substantiellen Rationalitätsbegriff, der es ermöglichen würde, Normen und Werte in einem “starken” Sinne zu begründen. Gosepath lehnt substantialistische Positionen (wie die Kants, der Transzendentalpragmatik oder eines “aristotelischen” Werte-Objektivismus) ab, und hebt als letzte Begründungsinstanz die konkrete Freiheit und die konkreten Interessen der Individuen hervor. Dem strikten Normativismus setzt Gosepath die Einheit von wertorientiertem und normengeleitetem Handeln entgegen. Die “Einheit der Vernunft” sieht Gosepath in den gleichen Begründungsstrukturen von relativer theoretischer und relativer praktischer Rationalität verwirklicht. Deontologische, utilitaristische und entscheidungstheoretische Kriterien müssen hinreichen, um das aufgeklärte Eigeninteresse der theoretischen und praktischen (und damit auch: normativen und evaluativen) Rationalität zu versichern. - Und auch Robert Nozicks “The Nature of Rationality”7 muß die normative Komponente von Rationalität anerkennen. Einmal spielen für ihn Prinzipien eine wichtige Rolle für rationales Denken und Handeln, da sie Hilfsmittel bzw. Entlastungen sind, und wir in unseren intellektuellen Operationen nicht immer von vorn beginnen müssen. Dabei kann es sich um epistemologische Prinzipien handeln, wie auch um solche personalen Handelns. Eine Person vermag mittels Prinzipien ihre Identität zu bestimmen, und ebenso gilt, daß Prinzipien als Filter oder als Ausschlußkriterium dienen können: nur solche Handlungen dürfen als rationale “live options” gewählt werden, die unsere Prinzipien nicht verletzen. Ein weiteres normatives Element führt Nozick ein, wenn er die Kernbereiche der rationalen Entscheidungstheorie um wichtige Elemente ergänzt. Nozick schlägt vor, den Gewinnerwartungswert (GEW) einer Handlung durch einen Entscheidungswert (decision value, DV) zu ersetzen. Wurde der GEW vor allem aus der Summe von (subjektiv angenommenem) Nutzen und erwarteter Eintrittswahrscheinlichkeit eines Ereignisses gebildet, so kommen
162 beim DV neue Elemente ins Spiel. Einmal wird das Prinzip der Maximierung des erwarteten Nutzens durch die Prinzipien (a) des kausal erwarteten Nutzens (evidentially expected utility, EEU) ersetzt. Zum andern führt Nozick ein Prinzip des symbolischen Nutzens (symbolic utility, SU) ein. Und schließlich werden die Prinzipien jeweils besonders gewichtet. Neu und wichtig in unserem Zusammenhang ist der Begriff des symbolischen Nutzens. Ethisches Handeln symbolisiert immer auch, welche Werte der Handelnde am höchsten schätzt oder wie er selbst behandelt werden will. Abweichungen von rationalen Standardantworten können damit erklärt werden, ohne daß psychologische Erklärungen bemüht oder vom Konzept einer rationalen Entscheidungsprozedur abgewichen werden müßte. Jenseits von Instrumentalismus, Funktionalismus und Evolutionstheorie (alles Theoriebestandteile, die Nozick dennoch in Anspruch nimmt) kann Rationalität uns schließlich dazu verhelfen, Problemlösungsprozeduren,
Fragetechniken,
Methoden
intellektuellen
Vorgehens usw. zu entwickeln. So sollte ein “wohldefiniertes Problem” nach Nozick zumindest folgende Elemente enthalten: (1) ein Ziel (ein evaluatives Kriterium, um Ergebnisse und Zustände zu beurteilen), (2) einen Anfangszustand (Startsituation und zugehörige Ressourcen), (3) zulässige Vorgehensweisen (Regeln, um Anfangszustände zu transformieren), (4) Einschränkungen (die bestimmen, welches Ziel mit welchen Operationen erreicht werden soll) und (5) ein anzustrebendes Ergebnis (“final state”). Nozick geht es darum, nichtmechanische Regeln und Prinzipien zur Konstruktion und Formulierung philosophischer und anderer intellektueller Theorien zu finden. Die von ihm vorgeschlagenen sechzehn “Faustregeln”8 könnten den Beginn einer Theorie der Vorstellungskraft bzw. des Einfallsreichtums und ihrer jeweiligen Funktionsweisen darstellen. Dieser kurze Überblick mag genügen, um auf einige grundlegende Probleme hinzuweisen: (1) Nahezu alle neueren Ansätze in der Rationalitätstheorie anerkennen das Problem der Einheit der Vernunft, trotz der unumgänglichen Differenzierung in Rationalitätstypen;9 allerdings herrscht keine Einigkeit über Art und Umfang der Rationalitätstypen, ebensowenig darüber, wie die Einheit der Vernunft herzustellen ist. (2) Ebenso ist allgemein die Notwendigkeit eines
Internal Realism, Rationality and Dynamic Semantics
163
normativen Rationalitätsbegriffs (oder einer normativen Theorie der Rationalität) anerkannt, ohne daß jedoch Einigkeit über die Natur dieser Normativität bestünde. (3) Insbesondere bleibt unklar, ob sich die Normativität dem eher formalen Kriterium verdankt, daß Bewertungen oder das Bilden von Präferenzen rationale Handlungen sind und somit die “Einheit der Vernunft” von vornherein die Normativität verbürgt - oder ob Rationalität “in sich” normativ ist (mit einer Verpflichtung bzw. einem Imperativ zu rationalem Überlegen, Handeln und Beurteilen). Da diese Probleme im vorliegenden Rahmen nicht “direkt” bewältigt werden können, wähle ich eine eher “exemplarische” Vorgehensweise. Zwei Philosophen haben für die Problembereiche “Einheit der Vernunft” und “Normativität und Rationalität” wichtige und interessanteste Beiträge geliefert: Nicholas Rescher und Herbert Schnädelbach. Im folgenden soll der Versuch unternommen werden, (I) die Grundzüge der Rescherschen Rationalitätstheorie darzustellen, insbesondere die dort entfalteten Rationalitätstypen, die “Einheit der Vernunft” und (II) das Verhältnis von Normativität und Rationalität, ferner (III) Herbert Schnädelbachs Aufsatz über “Rationalität und Normativität” dazu in Kontrast zu setzen und schließlich (IV) daraus allgemeine Konsequenzen für das Verhältnis von Rationalität und Normativität anzudeuten. II. Reschers Rationalitätstheorie ist bislang am ausführlichsten in Rationality (1988)10 dargestellt. Mehrere Thesen sind hier zentral: Rationalität besteht (im wesentlichen) im intelligenten Verfolgen angemessener Ziele; die wichtigsten Aspekte von Rationalität beziehen sich alle auf menschliches Handeln, nämlich auf Kognitionen, auf die verschiedensten Bereiche von Praxis und auf Evaluationen; die einzelnen Rationalitätstypen stehen nicht unvermittelt nebeneinander, sondern werden unter dem Begriff der “Einheit der Vernunft” zusammengefaßt; nur eine normative Theorie der Rationalität kann dem komplexen Gegenstand gerecht werden, d.h. daß sozialwissenschaftliche Ansätze (in Psychologie, Ökonomie, Entscheidungstheorie etc.), die ebenfalls eine Rationalitätstheorie vorlegen, dabei aber “wertfrei” verfahren möchten,
164 von vornherein zum Scheitern verurteilt sind. Zunächst zu den beiden erstgenannten Aspekten. Auch wenn “Rationalität” in den verschiedensten Bereichen und Zusammenhängen (wie Handlungen, Plänen, Übereinkünften, Fragen, Antworten, Steuergesetzgebungen, Verkehrssystemen ...) nachweisbar ist, so kann sie für Rescher nichtsdestotrotz in einem einzigen Zugriff erfaßt werden. Die Formel lautet: “Rationality consists in the intelligent pursuit of appropriate ends”.11 Damit sind die drei wesentlichen Komponenten genannt: Der Gebrauch von Intelligenz zielt ab auf kognitive Rationalität; das Realisieren von Vernunfteinsichten erfordert praktische Rationalität; die Angemessenheit der Zwecke und Ziele verlangt nach einer evaluativen Rationalität. Das bedeutet auch, daß die erwähnten Pläne, Übereinkünfte oder Systeme nur in einem abgeleiteten Sinne “rational” sind, da ihre Rationalität auf rationale Überzeugungen, Handlungen und Bewertungen zurückgeführt werden kann. Was nun eine Überzeugung, eine Handlung oder eine Bewertung rational macht, sind vor allem “gute” bzw. “zwingende” Gründe, d.h. solche, deren Verwirklichung unsere
Bemühungen
optimal
in
die
“angemessenen
Richtungen” führt - unter Berücksichtigung der jeweiligen konkreten Umstände. Die Vorstellung der Optimierung, des Suchens nach den “überragend” guten Gründen, bildet für Rescher den innersten Kern von Rationalität. Aber gute Gründe allein reichen auch noch nicht aus. Hinzukommen muß die Erkenntnis, daß Rationalität immer komplex und vielseitig ist, und daß es für eine rationale, vergleichende Einschätzung brauchbarer Alternativen zumindest fünf wichtiger Fähigkeiten bedarf: (1) Vorstellungskraft (Abwägen alternativer Möglichkeiten); (2) Verarbeitung von Information (Ermitteln der Grenzen des Machbaren); (3) Urteilskraft (Fähigkeit, zu beurteilen, wie wünschenswert verschiedene Arten von Situationen sind); (4) Auswahlorientierte Entscheidung (Fähigkeit mittels 1-3 Alternativen anzunehmen bzw. zurückzuweisen); (5) Durchführung (Fähigkeit, getroffene Entscheidungen auch zu verwirklichen). Nur ein Wesen, das alle diese Bedingungen erfüllt, kann als rationale Person gelten. Nun zu den einzelnen Rationalitätstypen.
Internal Realism, Rationality and Dynamic Semantics
165
(a) Kognitive Rationalität. Gegen verschiedene Spielarten des Skeptizismus möchte Rescher zeigen, daß eine “rational gerechtfertigte Überzeugung” nicht unbedingt auf anderen, völlig sicheren Überzeugungen beruhen muß. Er schlägt vor, von Annahmen und Vermutungen auszugehen, um durch immer erneute Durchgänge durch die verschiedenen (pragmatischen, nichtvitiösen) Argumentationszirkel zu Erkenntnis zu gelangen. “Dialektisches Denken”, “plausibles Denken”, die “erotetische Methode”, “Induktion als Wahrheitsschätzung”, “kognitive Systematisierung” - das sind die in vielen Ansätzen erarbeiteten Hilfsmittel, um kognitive Rationalität näher zu bestimmen. Im folgenden sei, exemplarisch, nur auf die Rolle von Präsumptionen hingewiesen. - Präsumptionen sind Annahmen bzw. Hypothesen, die als Ausgangspunkt, als Rohmaterial von Kognitionen dienen. Sie sind der diskursive Bereich der Rationalität (dem substantiellen oder kategorischen entgegengesetzt), der das konditionale Prinzip in Anspruch nimmt, daß wenn man gewisse Thesen akzeptiert, man dann auch ihre ordnungsgemäß ermittelten bzw. bestätigten Konsequenzen akzeptieren muß. Präsumptionen bestimmen unsere “Ausgangsmenge” ursprünglicher Verpflichtungen und erlauben uns, einen Anfang zu machen, auf dessen Grundlage weiteres inferentielles Argumentieren erfolgen kann. “The salient point is simply that there are some sorts of considerations which can cogently be taken as capable of establishing at least a tentative or provisional presumption of rational acceptability. When the sceptic rejects any such presumptions, he automatically blocks any prospect of reasoning with him within the standard framework of discussion about the empirical facts of the world. The machinery of presumptions is part and parcel of the mechanisms of cognitive rationality; abandoning it aborts the entire project at the very outset.”12 Beispiele für solche eher pragmatisch-ökonomischen Präsumptionen sind: Vertrauen in die eigenen Sinne; Akzeptieren der Erklärungen anderer Personen; Vertrauen in die Verläßlichkeit etablierter kognitiver Hilfsmittel und Instrumente; Akzeptieren der Erklärungen etablierter Experten und Autoritäten (auf ihrem Gebiet). Und als eher epistemische Präsumptionen können gelten: eine natürliche Neigung, etwas ohne weitere Überprüfung zu akzeptieren; eine epistemische Nützlichkeit, insofern das Akzeptieren gewisser Sachverhalte die Erklärung anderer Sachverhalte ermöglicht; Analogien, die mit
166 dem, was sich in anderen Kontexten als akzeptabel erwiesen hat, hergestellt werden; das Zusammenpassen mit anderen akzeptierten Thesen. - Präsumptionen stehen, zugegebenermaßen, im Dienste einer common sense-Philosophie, insofern sie das Gewöhnliche und Natürliche favorisieren. Ihre Aufgabe ist v.a. die Vereinfachung kognitiver Operationen und schließlich die Einsparung von (Untersuchungs)Kosten. Den präsystematischen Anzeichen Glaubwürdigkeit zuzugestehen, ihnen den Status von Präsumptionen einzuräumen, bedeutet auch, daß kognitive Rationalität als solche nur einen “schwachen” Status haben kann. So ist etwa Konsistenz zwar ein anzustrebendes Ziel, aber keineswegs ein unentbehrliches Erfordernis für Rationalität.13 (b) Praktische Rationalität. “Rationale Handlungen” bestehen, so Rescher, im angemessenen Gebrauch der Vernunft, um Entscheidungen auf bestmögliche Weise zu treffen. Wesentliche Bestandteile solcher Handlungen sind der Gebrauch von Intelligenz, die Berücksichtigung konkreter Umstände, das Streben nach einem optimalen Ergebnis. Auf rationale Weise zu handeln, heißt von solchen Motiven bewegt zu werden, die gültige Gründe (valid reasons) darstellen - also solche sind, die einen rationalen Akteur motivieren. Handlungen sind immer auch bezogen auf gute Gründe (evaluativer Aspekt) und intelligente Entscheidungen (kognitiver Aspekt). “The rational thing to do is always the intelligent thing - that is the adoption of the overall most cost-effective means toward the achievement of one’s appropriate goals whose realization is conducive to our ‘real’ or ‘true’ interests.”14 Gute Gründe liegen nur dann vor, wenn das, was die Handelnden wollen (wünschen, begehren) erkennbar in ihrem “besten Interesse” ist, wenn es zwingende Gründe zu der Annahme gibt, daß ihr Handeln wirklich zu ihrem Nutzen ist. Eine Schwierigkeit besteht freilich darin, daß unsere Informationen normalerweise unvollständig und unsere Handlungen damit oft suboptimal sind. Es ist deshalb notwendig, soviel Daten (Erfahrungen) wie möglich zu sammeln, um zu optimalen Ergebnissen zu gelangen (nicht zuletzt, weil eine vergrößerte Datenbasis auch zu völlig unterschiedlichen Ergebnissen führen kann). Das Dilemma der Vernunft (predicament of reason) besteht darin, daß Rationalität von uns verlangt, das zu tun, was die scheinbar beste Lösung ist, wir
Internal Realism, Rationality and Dynamic Semantics
167
jedoch wissen, daß diese keinesfalls wirklich die beste sein muß. “The fact is that the rationally appropriate resolution of a problem on the basis of one body of evidence or experience can always become unstuck when that body of evidence or experience is not actually revised but merely enlarged.”15 Rationalität erweist sich damit als “Kunst des Möglichen”. Jede Problemlösung ist eher davon abhängig, wie wir die Situation beurteilen, weniger davon, wie es sich “in Wirklichkeit” verhält. Hier kann auch die Kritik an der rationalen Spiel- und Entscheidungstheorie ansetzen, denn hätten wir jeweils “vollständige Information” und wüßten wir genau um die Folgen unserer Handlungen, dann wären die Spiel- und Entscheidungstheorie geeignete Instrumente. In “dieser Welt” müssen wir jedoch im Lichte unvollständiger Information entscheiden, planen und handeln. Eine ideale Rationalität käme zu rational angemessenen Lösungen, da sie alle relevanten Daten berücksichtigen könnte. Diese Vorstellung eines völlig rational Handelnden ist freilich nicht mehr als ein regulatives Ideal. Eine praktikable Rationalität muß sich an den Entscheidungssituationen des normalen Lebens, an scheinbaren Optima im Lichte unvollständiger Information orientieren. “It is a trite fact which nevertheless has enormously farreaching implications that the development of intelligence or incomplete information may well yield inappropriate solutions. When one combines this with the consideration that we humans virtually always labour in circumstances of incomplete information, we see that rationality is a resource of inherently limited utility.”16 Das “Dilemma der Vernunft” heißt also auch, daß - obwohl die Rationalitätsziele nur unter idealen Bedingungen erreichbar sind - dennoch auf dem Niveau lokaler und unvollkommener Bedingungen gehandelt werden muß. (c) Evaluative Rationalität. Im Eintreten für Normen und Werte wird dem “Zweck-Mittel-Denken” (bzw. den v.a. von Informationen abhängigen kognitiven Überlegungen) eine evaluative Rationalität entgegengestellt. Gegen Humes Skeptizismus, Nietzsches Nihilismus, Webers Wertfreiheitspostulat und Herbert Simons Instrumentalismus läßt sich, so Rescher, zeigen, daß evaluative Vernunft ebenso auf gute Gründe rekurrieren kann wie kognitive und praktische Vernunft. Eine evaluative Rationalität, die gewisse Präferenzen (die gegen
168 unsere Natur verstoßen, unsere Existenz gefährden oder unsere Möglichkeiten einschränken) als absurd erweist, liegt glücklicherweise im Bereich der menschlichen Möglichkeiten. “The crucial fact is that there is not only inferential (‘logical’) reason but also evaluative (‘axiological’) reason. Just as the rational man only believes what is belief-worthy for someone in his circumstances, so he only values what is value-worthy - deserving of being valued. And the determination of value-worthiness requires the sensible application of appropriate standards - in short, reasoning.”17 Die Rationalität der Werte und Zwecke bedarf einer besonderen Legitimation: Zwecke ohne die nötigen Mittel sind frustrierend, Mittel ohne brauchbare Zwecke dagegen unproduktiv und witzlos. Auf der einen Seite stehen Kosten-Nutzen-Überlegungen, die auf eine Gesamt-“Ökonomie” abzielen, in die auch Werte eingefaßt werden müssen, um Harmonie und Optimierung zu erreichen; auf der anderen Seite kann man nicht rational sein, ohne die Wünschbarkeit dessen, was man wünscht, zu berücksichtigen. Daß Werte rational kritisierbar sind, steht für Rescher außer Frage, denn sonst käme es zu keiner Unterscheidung von angemessenen und unangemessenen Werten. Was sind nun aber die “wirklichen” bzw. “besten” Interessen einer Person? Zum Teil sind es die Bedürfnisse, die alle Menschen gleichermaßen haben: Gesundheit, normales Funktionieren von Körper und Geist, angemessene Ressourcen, menschliches Miteinander und Zuneigung usw. Zum andern kann es sich um Rollen handeln, die das Individuum gerade einnimmt. Und teilweise handelt es sich einfach darum, was man gerade will (z.B. etwas zu essen, weil man hungrig ist). Aber diese an Wünschen orientierten Interessen sind nur durch ihre Beziehung zu universalen Interessen gültig. “Any valid specific interest must fall within the scope of an appropriate, universal covering principle of interest legitimation. (...) A specific (concrete, particular) interest of a person is valid as such only if it can be subordinated to a universal interest.”18 Mein Interesse, eine bestimmte Frau heiraten zu wollen, wird erst dadurch zu einem rationalen, daß es von dem universalen (allgemein akzeptablen) Wunsch abgedeckt wird, “eine Person zu heiraten, die man innigst liebt”. Letztendlich geht es darum, für unsere Wünsche universal angemessene Werte zu finden. Nur eine solche, sub ratione boni erfolgreiche Legitimation kann eine Bewertung
Internal Realism, Rationality and Dynamic Semantics
169
oder eine Entscheidung oder eine Präferenz, die aus ihr folgt, zu einer rationalen machen. Dieses Messen der eigenen Wünsche an höherwertigen kann auch dadurch erfolgen, daß man sich überlegt, was ein vernünftiger (unparteiischer, wohlinformierter, wohlmeinender, verständnisvoller) Zuschauer als “in meinem besten Interesse” annähme, und welche Wünsche und Präferenzen für diesen akzeptabel wären. Rationalität ist also nicht nur pragmatisch, situativ etc. zu interpretieren. Ohne eine kategorische (universale) Form von Rationalität erwiesen sich die Prinzipien relativer Rationalität als nicht ausreichend. Rationalität von Zielen und Zwecken ist für Rationalität als solche entscheidend. Die “rationale Übereinstimmung” unserer Handlungen, Überzeugungen und Werte mit irgendetwas ist nur dann sinnvoll, wenn das, woraufhin wir den Vergleich anstellen, von vornherein rational ist. Und kategorische, substantielle oder universale Rationalitätsprinzipien ergeben sich nicht einfach aus intellektuellen Überlegungen. “The universally appropriate ends at issue in our human condition are not somehow freely chosen by us; they are fixed by the (for us) inescapable ontological circumstance that - like it or not - we find ourselves to exist as human beings, and thus as free rational agents. Their ultimate inherence in (generic) human needs determines the appropriateness of our particular, individual ends.”19 Praktische Rationalität wird ohne rationale Evaluation unbrauchbar, was für Rationalität als ganze, bedenkt man die systemische Einheit der Vernunft, fatale Konsequenzen hätte. (d) Die systemische Einheit der Vernunft. Die Rationalitätsformel hatte schon zum Ausdruck gebracht, daß die drei Rationalitätsbereiche untrennbar miteinander verwoben sind. - Praxis ist auf Kognition und Evaluation verwiesen, da rationales Handeln nicht einfach effizientes Verwirklichen von Zwecken ist, sondern intelligentes Einsetzen der richtigen Mittel für angemessene Zwecke und mit guten Gründen. Und für die Zwecke selbst gilt: Wenn unsere praktischen Entscheidungen auf “unpassende” Zwecke gerichtet sind, üben wir unser Geschäft des praktischen Überlegens nicht auf die “korrekte Weise” aus. Kognitive Rationalität, um den zweiten Bereich zu nennen, weist sowohl
170 praktische als auch evaluative Aspekte auf. Rationale Überzeugungen können nur über praktische Untersuchungen, Forschungen, effektive Untersuchungsmethodologien, also nach den Regeln praktischer Rationalität, zustandekommen. Um von unseren (immer unvollständigen) Informationen aus Erkenntnisse gewinnen zu können, benötigen wir so etwas wie einen praktischen Schluß20, der den Übergang von subjektiv-empirischen “Anzeichen” zu objektiven Tatsachen zu bewerkstelligen hätte. “We have no alternative but to proceed to cross the evidential gap from experience to objective factual claims by what is, to all intents and purposes, a strictly practical inference whose ultimate foundation lies not in the sphere of information but in that of practical policy.”21 Kognitive Rationalität ist damit per se praktisch, denn auch das Akzeptieren einer These oder die Bildung einer Überzeugung ist eine Art von Praxis. Ebenso ist kognitive Vernunft auch evaluativ, da für jede Schlußfolgerung bereits eine Vorauswahl der Daten getroffen sein muß und wir oft einen Anfang aufgrund “bloßer Anzeichen”, also mittels eines “act of acceptance”, machen müssen. Schließlich sind auch evaluative Aussagen (wie “Stehlen ist falsch”) nicht schlechthin gültig, sondern nur in Bezug auf eine konkrete Situation. Um von (1) Stehlen ist falsch zu (2) X hat etwas Falsches getan zu gelangen, benötigen wir konkrete Informationen (die kognitiv verarbeitet werden). In diesem Falle: X hat etwas genommen, was ihm nicht gehört. Und evaluative Rationalität ist auch auf Praxis angewiesen, da die Verwertung von Fakten nur durch einen Sprung von subjektiver Evidenz zu objektiven Schlußfolgerungen gelingen kann. “Systemische Einheit der Vernunft” heißt also (u.a.), daß unsere Handlungen, Überzeugungen und Bewertungen sinnvoll sein sollten, daß das gesamte “Gewebe” der Rationalität “nahtlos” sein muß, bzw. daß Kognition, Evaluation und Handlung eine untrennbare Einheit bilden müssen. “Our factual judgements (beliefs) and our evaluative judgements (appraisals) are both validated by rational processes whose fundamental structure is one and the same - and on both sides ultimately rest on considerations of praxis.”22 Eine Dichotomie zwischen Werten und Fakten lehnt Rescher ab, da sie nicht berücksichtigt, daß es sowohl deskriptiv-informative als auch normativevaluative Fakten gibt. Bei Informationen geht es um die Akzetabilität der
171
Internal Realism, Rationality and Dynamic Semantics
Daten, bei Werten um die Präferierbarkeit der jeweiligen Ziele und Zwecke, in beiden Fällen also um die Zustimmung zu Tatsachen. (e) Rationalität und Normativität. Die Einheit von Rationalität und Normativität ist damit zumindest von einem Ansatzpunkt aus erwiesen: Wenn Rationalität immer nur als “Ganze” zu haben ist, dann kann es auch keine “wertfreien” Überlegungen und Handlungen geben. Ein weiterer Aspekt von Normativität wurde bereits angesprochen, nämlich der, daß (ähnlich wie bei Habermas) jeder rational Handelnde immer dazu aufgefordert werden kann, gute Gründe zu nennen. Diese guten (gültigen, zwingenden) Gründe sind solche, die die jeweilige Handlung als optimal für die Erreichung angemessener Ziele, und unter den jeweiligen Umständen, erweisen. Gute Gründe sind immer auch mit Interessen verknüpft, aber nicht mit irgendwelchen (bzw. bloßen Handlungsmotiven), sondern mit “wahren Interessen” (real oder best interests), wenn es für die Annahme, daß die Handlungen wirklichen Nutzen bringen, zwingende Gründe gibt. Wer seine “best interests” verwirklichen will, strebt nach einem vollen und erfüllten Leben, - versucht, sich zu einer glücklicheren und besseren Person auszubilden, - handelt zum Nutzen jener, die für ihn wichtig sind (Familie, Gemeinschaft, Zeitgenossen), - kümmert sich um die Entwicklung individueller und öffentlicher Werte - und handelt dabei (mehr oder
weniger
“automatisch”)
rational.
Ein
Mißbrauch,
eine
bloße
Rationalisierung wäre es, wenn wir Gründe für das, was wir wollen, an die Stelle von Gründen für das, was wir tun sollten, setzten. Dennoch verlangt auch Rationalität nichts Übermenschliches: Wir sollen lediglich (“realistic”) effizient und effektiv unsere Handlungsziele im Rahmen unserer Möglichkeiten verfolgen. - Damit kommen wir zu einem dritten Aspekt des Verhältnisses von Rationalität und Normativität, nämlich einem heuristischen bzw. methodologischen Gesichtspunkt. Für Rescher ist Rationalität zentraler Bestandteil unseres Selbstverständnisses. Andere Fähigkeiten wie Vorstellungskraft, Weitblick, Zweifel, Hoffnung etc. sind alle entweder Bestandteile von Rationalität oder in ihren Operationen auf sie angewiesen. Rationalität ist der Kreuzungspunkt all dieser Fähigkeiten. Wenn wir also unsere menschlichen Fähigkeiten verwirklichen wollen, sollten wir uns der Rationalität bedienen. Ebenso steht es
172 mit der Realisierung höchster ethischer Werte. Es ist durchaus sinnvoll, solche Werte zu pflegen und zu verfolgen, auch wenn man sie niemals verwirklichen wird. Auch für den “ethischen Idealismus”23 und seine hochgesteckten Universalisierungen gilt, daß der Weg das Ziel ist. Wissen, Wahrheit, Rationalität und dergleichen Konzepte enthalten immer ein Moment von Idealisierung, das über unsere auf die Realität bezogenen Fähigkeiten hinausgeht. “The machinery of cognition that is at our disposal we owe to evolution. But the conceptual mechanisms that we make use of in cognitive contexts concepts that, like knowledge, truth, certainty, simplicity, comprehensiveness, system, and science orient our thought about the issues of this domain - are in large measure idealizations, intellectual constructs in whose construction idealization plays a crucial role.”24 Konzeptuelle Mechanismen müssen sich nicht an der Realität orientieren. Sie werden vor dem Hintergrund einer hypothetischen Idealordnung entworfen, in der die Grenzen des Faktischen hypothetisch überschritten werden. Kognitive Idealisierungen geben einen Leitfaden ab, um sich leicht und mit guten Ergebnissen im Reich des Denkens orientieren zu können. Damit vertritt Rescher auch in der Rationalitätstheorie einen (methodischen) Relativismus. Völlig rationale Handlungen wären nur möglich unter einer Hegelschen Voraussetzung “absoluten Wissens”, während unsere Wahrheitsund Rationalitätsansprüche in der tatsächlichen Welt immer von unvollständiger Evidenz und ungenügender Information bestimmt sind. III. Auch Herbert Schnädelbach vertritt die These einer Einheit von Rationalität und Normativität. Während Handlungen, Entscheidungen oder institutionelle Regelungen die Eigenschaft haben, rational zu sein, muß man Personen eine dementsprechende Disposition25 zuschreiben. In bestimmten Umständen kann man von jemandem ein gewisses (rationales) Verhalten erwarten. Darüber hinaus gehen wir (mit Chomsky) auch davon aus, daß eine rationale Person kompetent in der Lage ist, Regeln zu verfolgen und über Regeln zu verfügen. Rationalität ist für Schnädelbach wesentlich ein “Kompetenzbegriff”; sie gilt als Inbegriff sprachlicher Kompetenzen im weitesten Sinne, und um kompetent
Internal Realism, Rationality and Dynamic Semantics
173
Sprache zu benutzen, ist es nötig, Regeln auf die richtige Weise (normativer Aspekt) zu verwenden. “Rationalität” kann also von Anbeginn nicht “wertfrei” interpretiert werden. Die Frage ist nur, wie man die normativen Aspekte argumentativ begründen kann. In “Rationalität und Normativität”26 wird diese Frage im Sinne des “methodischen Nominalismus” so formuliert: “Ist ‘rational’ ein normatives Prädikat?” Drei Zugangsweisen liegen hier nahe. 1) Bei der Verwendung von “rational” beziehen wir uns immer auf eine Norm - und Rationalität ist diese Norm. Normen finden vielfältige Verwendung. So gibt es Normen für Gegenstände: Normalnormen (daß etwas normalerweise der Fall ist), Standards (etwa Papiergrößen nach DIN-Norm) oder Idealnormen (etwa “die freiheitliche Demokratie”). Und für Handlungen lassen sich auch drei Bereiche unterscheiden. Regulative Normen legen fest, was man tun muß, um Handlungen einer bestimmten Art auszuführen (Regeln des Schachspiels etwa). Direktiven Normen entnehmen wir, was wir tun müssen, um ein bestimmtes Ziel zu erreichen oder bestimmten Anforderungen zu entsprechen (Gebrauchsanweisungen etwa). Präskriptive Normen beziehen sich direkt auf Handlungen und benutzen die deontischen Modalitäten “erlaubt”, “geboten”, “verboten” (etwa der kategorische Imperativ). Rationalität ist nach dieser Interpretation ohne Zweifel ein normativ gehaltvoller Begriff. Allerdings ist er noch viel zu weit gefaßt, da z.B. Normalnormen und Standards nichts mit der philosophisch erst interessanten Version von Normativität zu tun haben, nämlich der Maßstäblichkeit im Sinne des Guten und Verbindlichen. 2) Es stellt sich also die Frage, worin der normative Gebrauch von Ausdrücken besteht und wie man ihn charakterisieren könnte, bzw. was es mit der “normativen Rede” auf sich hat. Mit Paul W. Taylor differenziert Schnädelbach (a) in normative und deskriptive Rede, wobei sich (b) die normative Rede noch einmal aufspaltet in einen evaluativen (“richtige” Verwendung von Regeln, “gute” Ausführung von Standards) und einen präskriptiven (du sollst, jedermann sollte) Bereich. Evaluationen und Präskriptionen folgen dabei durchweg den gleichen Regeln, so daß man hier von einer Einheit der normativen Rede auf einer Metaebene sprechen kann. Da es Schnädelbach nun aber darum geht, als “normative Rede”
174 nur eine solche zu akzeptieren, die in einem normativen Kontext einem Referenzobjekt Rationalität zuspricht, verringert er den Bereich der möglichen Kandidaten noch einmal. Präskriptionen wie “sei rational!” oder Verschriften wie “Philosophische Debatten sind rational zu führen!” gehören für ihn nicht zum expliziten Gebrauch des Prädikats “rational”, da hier ja gerade keine Prädizierung vorgenommen wird. Es müßte also folgen, daß “rational” nur evaluativ verwendet werden kann. Diesem Normativismus in der Rationalitätstheorie widerspricht Schnädelbach jedoch. Es ist die Bestimmung des Menschen als animal rationale, die einerseits deskriptiv ist (es wird eine differentia specifica, ein bloßes Klassifikationsmerkmal angegeben), andererseits aber gerade das Prädikat “rational” verwendet. “Die Frage, ob ‘rational’ ein normatives Prädikat ist, kann also so beantwortet werden: Ja, dies ist der Fall, wenn man unter ‘normatives Prädikat’ die Möglichkeit versteht, von diesem Prädikat einen normativen Gebrauch zu machen, wobei wir aber auch deskriptive Gebrauchsweisen als möglich einräumen müssen.”27 3) Es gibt auch einen normativen Gebrauch des Prädikats “rational” neben anderen Gebrauchsweisen. Ein normativer Gebrauch von “rational” liegt dann vor, wenn in normativen Kontexten ein assertiver (Searle) bzw. konstativer (Habermas) Gebrauch von “rational” gemacht wird. Die Frage ist nun, da Deskriptionen und Präskriptionen nur sehr begrenzt als Träger für normative Rationalität taugen, in welchen Fällen “rational” evaluativ verwendet wird. Schnädelbach unterscheidet zwischen Rationalität in einem weiteren (= rational1) und in einem engeren (= rational2) Sinne. Jemand ist im weiteren Sinne rational, wenn er nicht vernunftlos ist, d.h. wenn es möglich ist, ihn unter Rationalitätsgesichtspunkten zu betrachten. Personen, Handlungen und soziale Institutionen können in diesem Sinne rational sein; hier liegt aber noch kein evaluativer Gebrauch von “rational” vor. Dieser spielt erst bei Rationalität im engeren Sinne eine entscheidende Rolle. Jemand ist rational im engeren Sinne, wenn er Rationalität als normatives Kriterium beurteilend verwendet, wenn er sich mit diesem Kriterium identifiziert bzw. es zu seiner eigenen Sache macht wenn er also nicht vernunftfeindlich ist, und dem entspricht, was wir normalerweise als vernünftig ansehen. “Von Evaluation sollte man nur dann
Internal Realism, Rationality and Dynamic Semantics
175
sprechen, wenn sich der Beurteilende mit den Kriterien identifiziert, d.h. wenn er im Zweifelsfalle nicht nur seine Beurteilungen, sondern auch die Beurteilungsstandards selbst argumentativ zu vertreten bereit ist”.28 Es geht also darum, daß normative Beurteilungen (“der Wein ist nach xyStandards gut”) selbst noch einmal normativ beurteilt werden (“der Wein ist mir für dieses Essen zu gut”), daß erst die Identifikation des Beurteilenden mit den Standards Beurteilungen zu Evaluationen (bzw. normativen Beurteilungen) macht. Die Beurteilung von Standards erfolgt normalerweise durch zuverlässiges Wissen bzw. durch materiale Rationalitätskriterien wie Wahrheit, Richtigkeit, Wirksamkeit, Gültigkeit, Begründbarkeit. Diese sind für Schnädelbach aber nicht geeignet, um den Bereich des Rationalen richtig zu begrenzen, da auch Irrtum und unvernünftige Handlungen nicht von vornherein aus dem Rationalitätsbereich ausgeschlossen werden dürfen. Denn es ist immerhin noch möglich, den Sinn von Irrtümern oder unvernünftigen Handlungen zu verstehen. Rationalität in einem formalen Sinn (= rational1) entspricht deshalb, so Schnädelbach, dem Kriterium der Verständlichkeit. Diese gilt als die konstitutive Bedingung von Rationalität im engeren Sinne. “Nur was wir verstehen können, vermögen wir im Hinblick auf Rationalität (im engeren Sinne), d.h. auf Wahrheit, Wirksamkeit, Richtigkeit etc. zu beurteilen.”29 Personen sind geradezu definiert durch die prinzipielle Verständlichkeit ihrer Äußerungen und Handlungen. Als Bedingungen der Verständlichkeit, die jede Evaluation erst möglich machen, gelten Grammatikalität und logische Konsistenz bei Äußerungen, Kontextadäquatheit und Kontrollierbarkeit bei Handlungen sowie linguistische und kommunikative Kompetenz bei Personen. Diese Regeln bzw. regulativen Normen ergeben zusammen den Typus der kommunikativen Rationalität, die damit die Basis aller anderen Rationalitätsformen abgeben soll, freilich in einem anderen Sinne als bei Habermas. Denn Rationalität im weiteren Sinne bzw. als Verständlichkeit ist für Schnädelbach kein (normativ besetzter) Geltungsanspruch, sondern lediglich eine Präsupposition. Der Fehler des (Apelschen und Habermasschen) “Normativismus” bestehe darin, eine unzulässige “normativistische Umdeutung” des Präsupponierten vorzunehmen, oder, anders ausgedrückt, den engeren und den
176 weiteren Sinn von “rational” nicht zu unterscheiden. Rationalität als Verständlichkeit (= rational1) konstituiert erst den Bereich kommunikativen Handelns und der diskursiv einlösbaren Geltungsansprüche (= rational2). “Kommunikation selber ist nur möglich auf der Basis allseitiger prinzipieller Rationalitäts- oder Verständlichkeitsunterstellungen, die sich auf die Beteiligten ebenso beziehen wie auf ihre Äußerungen und Handlungen.”30 Philosophie, als allgemeine Theorie der Rationalität, ist ebensowenig wie das Prädikat “rational” per se schon normativ (im Sinne einer kritischen Theorie). Vielmehr bedarf es bestimmter Entscheidungen, damit Rationalität normativ bzw. Philosophie kritisch wird. Für Schnädelbach ist es letztlich die Präferenz einer bestimmten Lebensform, die uns zu einer bestimmten Entscheidung bringt. Emotionen und Willensregungen, Entscheidungen und Präferenzen sind Bestandteile normativ-rationalen Handelns. Sie ermöglichen auch eine deutliche Grenzziehung zur “funktionalistischen Neutralisierung” der Vernunft, wie sie etwa in der Luhmannschen Systemtheorie stattfindet. IV. Die Ansätze von N. Rescher und H. Schnädelbach enthalten einige wichtige Vorschläge. So möchte ich vor allem dem pragmatischen Zugriff Reschers auf die Rationalitätsproblematik zustimmen. Überzeugungen, Handlungen und Evaluationen sind rational nur relativ auf die jeweiligen Umstände (die verfügbaren Informationen, die jeweilige Lebenserfahrung, die kognitiven Fähigkeiten). Rationalität ist immer komplex und vielseitig, und es reicht nicht aus, lediglich einen bestimmten Standpunkt einzunehmen, etwa den des rationalen Entscheiders, des homo oeconomicus oder des Logikers. Vielmehr sind in jeder Handlung im allgemeinen alle verschiedenen Aspekte präsent. Hier drängen sich jedoch zwei Fragen auf. (1) Ist Reschers Rationalitätstypologie richtig und vollständig? (2) Wenn in jeder Handlung alle (drei, wie hier angenommen) Aspekte eine Rolle spielen, gibt es dann nicht Probleme der Gewichtung? Die erste Frage ähnelt der nach der Vollständigkeit der Kantischen Kategorientafel, und ist wohl ähnlich unbeantwortbar. Jedenfalls finden sich bei allen aktuellen Rationalitätstheoretikern unterschiedliche Typologien. Apel etwa spricht auch von Verständigungs-, Diskurs-, Logos- oder
Internal Realism, Rationality and Dynamic Semantics
177
hermeneutischer Rationalität. Habermas spricht dem kommunikativen Handeln eine eigene Rationalität zu, wie er auch zu den (prinzipiell rationalen) Geltungsansprüchen der menschlichen Rede Wahrhaftigkeit zählt, womit ästhetisches bzw. expressiv-dramaturgisches Handeln als potentiell rational ausgewiesen wird. Bei Rescher muß man sich eine solche ästhetische Rationalität, da sie nicht eigens erörtert wird, im Bereich der Evaluation vorstellen. Da Evaluation bei Rescher aber auch Präskriptionen enthält, wird sie zu einem etwas unscharfen Begriff. Eine Differenzierung der evaluativen Rationalität wäre sicherlich angebracht. Dies beträfe dann auch die Frage der Gewichtung (2), denn bislang sieht es so aus, als ob das “intelligente Verfolgen der eigenen, angemessenen Ziele” vor allem von der (evaluativen) Angemessenheit der Ziele und Zwecke dominiert wird. Darauf deutet auch Reschers Gedanke hin, daß jedes einzelne Interesse nur dann rational ist, wenn es sich einem universell angemessenen Wert zuordnen läßt. Die Normativität in Reschers Rationalitätstheorie verdankt sich hier einer handfesten Ontologie, einer “ontologischen Verpflichtung” zu rationalem Handeln.31 Eine solche Ontologie ist aber kritisierbar, da es für jede Handlung die verschiedensten “obersten Zwecke” geben kann. Wirklich attraktiv hingegen scheint mir der von Rescher vertretene kriteriologische (methodologische, konzeptuelle, heuristische) Idealismus. Die Orientierung an obersten Werten (“ethical idealism”), an Gedankenkonzepten wie Wissen, Wahrheit, Rationalität (“conceptual idealism”), an methodologisch-epistemischen Untersuchungsmodellen (“pragmatic idealism”) ist sinnvoll und unentbehrlich - auch wenn diese Orientierungspunkte nie vollkommen erreicht werden. In diesem Sinne wäre “Rationalität” aus methodologischen Gründen bereits ein normatives Konzept: Wenn wir unsere Ziele intelligent verwirklichen wollen, ist es geboten, wie folgt zu handeln ... Das Problem der Einheit der Vernunft schließlich kann für Rescher als gelöst gelten. Da jeder Rationalitätstyp die anderen beiden in nuce mitenthält, muß die Einheit nicht erst mühsam hergestellt werden, sie ist vielmehr immer schon gewährleistet. - Auch viele der Vorschläge von Schnädelbach lassen sich sicherlich in eine umfassende Theorie der Rationalität einbauen. Wichtig ist Schnädelbachs Bemühen, den Rationalitätsbegriff “eng” zu halten, ihn zu begrenzen auf das Verhalten von Personen, womit die
178 “metaphorische” Verwendung im Bereich des Funktionalismus oder der (sozialwissenschaftlichen) Systemtheorie vermieden wird. Diese Engführung bewährt sich (in anderer Hinsicht) auch bei der Problematik von Normativität und Rationalität. Die Differenzierung der normativen Rede in einen evaluativen, einen präskriptiven und einen deskriptiven Bereich ermöglicht erst die Distanzierung zum Normativismus (etwa bei Apel und Habermas) oder auch zu substantialistischen Konzepten wie bei Rescher. Die Unterscheidung allerdings eines engeren und eines weiteren Sinnes von Rationalität scheint mir hinterfragbar zu sein. Um eine Handlung als “rational” bezeichnen zu können, müssen mehrere Bedingungen erfüllt sein. Dazu gehören materiale Rationalitätskriterien wie akzeptable Ziele, angemessene Mittel, korrekte Schlußfolgerungen, ausgewiesene Methodologien - aber auch das grundlegende Kriterium der Verständlichkeit. Es ist m.E. nicht möglich (und auch nicht notwendig), diese Bereich noch einmal zu differenzieren, da sie untrennbar miteinander verbunden sind. Eine Handlung, deren Sinn und Zweck ich nicht verstehe, kann für mich auch nicht rational sein. Kommunikative Handlungen sollten verständlich sein, um ihren Zweck zu erfüllen, und sie sollten zugleich die materialen Rationalitätsforderungen erfüllen. Ob man Verständlichkeit als Geltungsanspruch oder als Präsupposition interpretiert, scheint mir nicht entscheidend zu sein (da beide Begriffe dasselbe bezeichnen können). Wichtiger ist aber die Frage, ob Verständlichkeit nicht doch eine legitime Forderung an unsere Sprechhandlungen darstellt, und damit auch Rationalität “im weiteren Sinne” normativ ist. Dem Normativismus, der von den (formalen) “diskursiv einlösbaren Geltungsansprüchen” (alias “Diskurspräsuppositionen”) sogleich zu einer (materialen) Ethik des Diskurses gelangen möchte, muß man deswegen ja noch nicht zustimmen. Anmerkungen 1 J. Habermas, “Zwecktätigkeit und Verständigung. Ein pragmatischer Begriff der Rationalität”, in: H. Stachowiak (Hg.), Pragmatik. Handbuch pragmatischen Denkens, Bd. III, Hamburg 1989, S. 32. 2 K.-O. Apel, “Rationalitätskriterien und Rationalitätstypen. Versuch einer transzendentalpragmatischen Rekonstruktion des Unterschiedes zwischen Verstand und Vernunft”; in: A. Wüstehube (Hg.), Pragmatische Rationalitätstheorien, Würzburg 1995. 3 Stefan Gosepath, Aufgeklärtes Eigeninteresse. Eine Theorie theoretischer und praktischer Rationalität. Frankfurt/M. 1992. 4 Ebd. S. 95.
Internal Realism, Rationality and Dynamic Semantics
179
5 Ebd. S. 198. 6 Ebd. S. 247. 7 Robert Nozick, The Nature of Rationality, Princeton NJ (Princeton University Press) 1993. 8 Ebd. S. 170 f. 9 Nur Nozick glaubt, die Entscheidungstheorie in allen relevanten Bereichen gleichermaßen anwenden zu können, wodurch es auch nicht scharf voneinander getrennter “Rationalitätstypen” bedarf. Gosepath versucht, die vier genannten Typen auf zwei zu reduzieren, nämlich relative theoretische und relative praktische Rationalität, und auch deren strukturelle Gleichheit zu erweisen. 10 N. Rescher, Rationality. A Philosophical Inquiry into the Nature and the Rationale of Reason, Oxford 1988. Dt. Übers. vom Verf. Rationalität, Würzburg 1993. 11 Ebd. S. 1. Eine andere Formulierung lautet: “The crucial point is that rationality as such is something complex and manysided - though all of its parts are embraced within the one, overall generic formula that rationality consists in the intelligent conduct of one’s affairs.” (Ebd. S. 8 f.) 12 Ebd. S. 51. 13 Ebd. S. 91. “Cognitive rationality as such does not involve an absolute, unswerving commitment to consistency at any cost. Consistency is a prime desideratum of rationality, but not an absolutely indispensable requisite for it. It should be viewed not as a present demand, but as an ultimate ideal.” 14 N. Rescher, A System of Pragmatic Idealism, Vol. I, Princeton NJ (Princeton university Press), S. 7. 15 N. Rescher, Rationality, a.a.O., S. 22. 16 Ebd. S. 29. 17 Ebd. S. 97. 18 Ebd. S. 101. 19 Ebd. S. 105. 20 Reschers praktischer Schluß verläuft nach folgendem Muster: 1.
Nach den vorhandenen Anzeichen, P.
2.
Unter den vorliegenden Umständen können wir (epistemisch) nichts besseres tun, als uns nach den vorhandenen Anzeichen zu richten.
3.
Das Akzeptieren von P ist (unter den vorliegenden Umständen) die bestmögliche Wahl (aus 1 und 2).
4.
Nehmen wir die bestmögliche Wahl an (eine Sache “praktischen Verfahrens”).
5.
Akzeptieren wir P (aus 3 und 4).
6.
P (aus 5). Ebd. S. 123.
21 Ebd. S. 123. 22 Ebd. S. 127. 23 N. Rescher, Ethical Idealism. An Inquiry into the Nature and Function of Ideals, Berkeley/Los Angeles 1987. 24 N. Rescher, A System of Pragmatic Idealism, Vol. I: Human Knowledge in Idealistic Perspective, Princeton N.J. 1992, S. 45. 25 H. Schnädelbach / E. Martens (Hg.), Philosophie. Ein Grundkurs, Reinbek 1985, S. 110 ff. 26 H. Schnädelbach, “Rationalität und Normativität”, in: Ders., Zur Rehabilitierung des “animal rationale”, Frankfurt/M. 1992, S. 79 ff. 27 Ebd. S. 93. 28 Ebd. S. 95.
180 29 Ebd. S. 97 f. 30 Ebd. S. 101. 31 Vgl. hierzu N. Rescher, Moral Absolutes, New York 1989, Ch. 1, 2, 4. Rescher spricht hier ausdrücklich von einer ontologischen Verpflichtung als der Quelle der deontischen Kraft von Moralität. “The most promising prospect [um die Frage “Why be moral?” zu lösen, A.W.] is to look to the ontological duty of selfrealization which appertains to any rational agent whatsoever - the fundamental obligation of endeavoring to make the most of one’s opportunities for realizing oneself as fully as possible, a duty which, insofar as one “owes” it to anyone at all, one owes no less to the world at large than to oneself.” (S. 90).
Three Aspects of Rational Explanation
181
RATIONAL EXPLANATION, REASONING AND JUSTIFICATION
Philip Pettit Three Aspects of Rational Explanation1
abstract Rational explanation, as I understand it here, is the sort of explanation we practise when we try to make intentional sense of a person’s attitudes and actions. We may postulate various obstacles to rationality in the course of offering such explanations but the point of the exercise is generally to present the individual as a more or less rational subject: as a subject who, within the constraints of the obstacles postulated and they can be quite severe - displays a rational pattern of attitude - formation and decision-making. In this paper I want to draw attention to three distinct, and progressively more specific, aspects of such rational explanation. I do so, because I believe that they are not always prised apart sufficiently. The first aspect of rational explanation is that it is a programming variety of explanation, in a phrase that Frank Jackson and I introduced some years ago (Jackson and Pettit 1988). The second is, in another neologism (Pettit 1986), that it is a normalising kind of explanation. And the third is that it is a variety of interpretation: if you like, it is a hermeneutic form of explanation.
1. Rational explanation as programming explanation Rational explanation of action involves the attempt to explain an agent’s speech or behaviour by reference to distinctive psychological states: roughly, by reference to states that reflect the information to which the agent gives countenance and the inclination that moves him; by reference, as the stock
182 phrase has it, to beliefs and desires. The first thing to be said in characterisation of such explanation is that it invokes higher-level causal factors, not factors that operate at the most basic level there is. A similar point holds for the rational explanation of attitudes, of course - the explanation of why an agent comes to think or feel something, for example - but we can take the explanation of action as our main point of reference. A level is characterised by the causally relevant properties that figure there: the physical level by physical properties, the biological by biological, and so on. Such levels will be distinguished from one another, roughly, by the fact that the properties at any level join forces with one another in a way in which they do not join forces with properties from other levels. And such levels will be designated as higher and lower, depending on which are thought to be causally more basic. Consider these two properties of a rod: first, its malleability, second, its particular molecular structure. Those properties may each be relevant, by whatever test of relevance, to the rod’s bending under a certain pressure. But they are not relevant in the sense of each playing a part in the same process; neither appears earlier than the other in the same process and neither combines with the other, in the way in which the presence of the oxygen combines with the striking of the match to produce combustion. They do not get together in those ways - that they do not join forces, as we might put it - in the production of the event to which, nonetheless, they are each causally relevant. They are causally relevant to the event at different levels. If the malleability of a rod and its molecular structure are properties of different levels, which level is lower, which higher? The judgment will be driven by our assumptions as to whether the causal relevance of the molecular structure mediates the causal relevance of the malleability, or the other way around. Is the malleability relevant to the rod bending in virtue of the fact that it is the molecular structure of the rod which accounts, in context, for the bending? Or the other way around? Clearly, by this test, the molecular structure is causally the more basic level. To be malleable is to have such a molecular structure as will allow bending under such and such a pressure; if the
Three Aspects of Rational Explanation
183
malleability is causally relevant to the bending, its relevance is mediated by the relevance of the structure. I claimed that the first thing that characterises rational explanation is that the psychological factors it invokes as causally relevant are higher-level. The factors involved are intentional properties, properties of belief and desire, and they represent a different level from that represented, for example, by the properties identified in neurophysiology; they do not join forces with such properties in producing behaviour and yet both sorts of properties are causally relevant, so we judge, to behaviour. As between the psychological and the neurophysiological families of behaviour-relevant properties, which represents the more basic level? If we are to avoid positing special Cartesian forces, then we must say that the neurophysiological level is the more basic. If mother nature has designed us to be such that our psychological states are causally relevant to our doing this or that, if it has designed us to be psychologically organised systems, then it has done so through ensuring that the neurophysiological connections to behaviour sustain the psychological connections: it has done so through designing our neurophysiology to sustain the causal relevance of psychological states in something like the way that the molecular structure of the rod sustains the causal relevance of its malleability. Let us agree that the psychological properties introduced in rational explanation are higher-level, in particular that they are of a higher level than neurophysiological properties. But how can properties at different levels both be causally relevant to one and the same thing? How can they collaborate causally, as it were, given that they do not join forces: given that they do not collaborate in the familiar diachronic or synchronic fashion? Reflection on this problem leads us to see that rational explanation is a form of programming explanation (see Jackson and Pettit 1988, 1990a, 1990b and Pettit 1993). The programming model focuses on the way causal and explanatory relevance, however paraphrased, may be reproduced across different levels. It applies to the intentional and neurophysiological levels but it also applies in many other cases. It helps us to make sense, not just of how beliefs and desires can be causally relevant to something that is produced by neurophysiological antecedents, but also of how malleability can be causally relevant to the
184 bending that is produced, under appropriate pressure, by the molecular structure of the rod; and so on in other cases. Suppose that there is no doubt about the causal relevance of properties at a given level L to the occurrence of an event E, of a given type. Suppose that we are interested in how a property, P, at a higher level can be simultaneously relevant to E. According to the program model, P will be causally relevant to E just in case three conditions are fulfilled. 1. The instantiation of P non-causally involves the instantiation of certain properties-perhaps these, perhaps those-at the lower level L: typically, the instantiation of the L-properties will ‘realise’ P, as it is said, given the context. 2. L-properties of the sort associated with instantiations of P, or at least most of them, are such as generally to be causally relevant - in the circumstances - to the occurrence of an E-type event. 3. The L-properties associated with the actual instantiation of P are causally relevant to the occurrence of E. These conditions are readily illustrated. Intuitively, the malleability of this rod is causally relevant to its bending, and relevant simultaneously with the exact molecular structure. How so? Because the program model applies. The instantiation of the malleability involves the instantiation of certain molecularstructural properties; the sorts of properties associated with instantiations of malleability are such as generally to be causally relevant to the sort of bending effect in question; and the molecular-structural properties associated with the actual instantiation of malleability are causally relevant to the bending. A computer program ensures that things are organised in the machine language of the computer-may be in this fashion may be in that-so that certain results reliably follow on certain inputs. In cases where the program model applies, even in a simple case like that of the malleable rod, the higher-level property can be cast as programming in a parallel manner for the appearance of a certain effect. The presence of the malleability ensures, non-causally, that things are organised at the molecular level-the level corresponding to the machine language-so that the rod will bend under suitable pressure. Where the
Three Aspects of Rational Explanation
185
molecular structure is described as producing the bending, the malleability can be thought of as programming for the effect produced. Other examples of the program model become salient as we recognise suitably corresponding relations across levels in different cases. In every case the relation must be such that the instantiation of the higher-level property ensures or at least probabilifies-in a non-causal way-that there are causally relevant properties present at the lower level. But there may be quite different reasons applicable in the different cases as to why that relation obtains; each case will require its own annotation. The squareness of the peg probabilifies the sort of molecular contact which blocks the peg going through the round hole; the (boiling) temperature of the water in the closed flask probabilifies the presence of a molecule of the right position and momentum to break a molecular bond in the surface and crack the flask; the rise in unemployment probabilifies a shift in motives and opportunities that is likely to increase aggregate crime; and so on across a great variety of possible cases. The probabilification holds for different reasons in the different cases. But the fact that it obtains shows how the program model may apply in any of the examples, making sense of how the higher-level property can be causally relevant to something which is also traceable to the lower-level properties. As the program model applies to these sorts of cases, so it applies too to the way in which intentional and neurophysiological properties produce behaviour. How is a particular psychological set causally relevant to an agent’s doing something? In particular, how is it relevant, given that the action is produced without remainder-without leaving anything to be explained-by a certain complex of neurophysiological states? The program model suggests that the psychological set will be causally relevant so far as its realisation in an agent of that kind makes it more probable than it would otherwise have been-it may make it more or less certain-that there will be a neurophysiological configuration of properties present-may be this, may be that-which is sufficient to produce the required behaviour. The psychological set may not produce the behaviour in the same way in which the neurophysiological complex does. But it is nonetheless causally relevant to the appearance of that behaviour. It
186 programs for the behaviour to the extent that its realisation means, more or less certainly, that there will be a suitable neurophysiological producer present. I hope that these remarks will help to make vivid the idea that rational explanation is a sort of programming explanation. I have presented arguments elsewhere in defence of that idea. Here I will only say that it is not clear how a higher-level, rational explanation can introduce causally relevant properties unless the program model applies. There are no alternatives in the literature that would make comparable sense of the way in which properties at higher and lower levels can be simultaneously relevant to a certain effect (see Pettit 1993). If not this, what? 2. Rational explanation as normalizing explanation Whenever the program model applies, whenever there are higher-level properties which exercise causal relevance, we will find lawlike regularities in place. I have in mind regularities like that which binds the malleability of the rod to its bending under such and such pressure, or the squareness of the peg to its being blocked from going through a suitably corresponding round hole. Program explanation will amount to what I have described as normalizing explanation just in case the relevant regularities, or at least some of the relevant regularities, have the status of norms. Otherwise it will be a sort of regularizing explanation (Pettit 1986). All of the non-intentional examples of program explanation that were given in the last section involve non-normative regularities and so the explanation in question is of the regularizing kind. Consider the regularities linking malleability and bending, the squareness of the peg and the blocking, the (boiling) temperature of the water and the cracking, the rise in unemployment and the increase in crime. None of these regularities represents a norm for the behaviour of a system, in any plausible sense of ‘norm’. Things are different, however, in other cases. Suppose that we have designed a computer to add any numbers presented to it and to display the sum: we have designed it to function as an adding device. If we have designed the computer properly, then whenever a set of numbers is registered, the computer will
Three Aspects of Rational Explanation
187
respond by giving us their sum. The presentation of the numbers will be causally relevant to that response, even though the response is produced at a lower level by the machine features of the computer. The presentation of the numbers will program for the appropriate response, ensuring the presence of a machine profile that produces it. The program model will apply. This case resembles the other instances of the program model fairly closely, with one difference. This is that the sort of regularity involved in any of the adding machine’s responses will have the status of a norm. Given that we know or assume that this is meant to be an adding device, we can deduce that if it is given the numbers seven and four as input, then it will display eleven as output. It is a hypothetical imperative for any system that if it is to count as an adder then for input seven and four, it should produce output eleven. Thus, assuming that the system is an adder, we can say that it is a norm for the system that for that input, it should produce that output. There is no mystery in how a regularity, in particular a programmed regularity, can have the status of a norm. As we have imagined this happening with an artificially designed system, so we can envisage it coming about with any system that is the product of design or selection. A regularity will count as a norm for a system just in case the satisfaction of that regularity is required for the system to succeed in the role for which it has been designed or selected. An example from the realm of natural selection will help to make the point. We assume that the temperature-control system in the human body has been selected-or the associated genetic profile has been selected-for the effect it has in maintaining a certain temperature within the body. That being so, we must see the regularity whereby it produces perspiration in a sauna as a norm for the system and, more generally, the organism. The regularity isn’t just something that happens to obtain. It is something that more or less has to obtain if the system is to be successful in the role for which it has been shaped. That a programmed regularity is a norm is not of ontological significance. It means that the system in question is the product of design or selection, it is true, but it does not entail any further difference between that system and other less normatively directed organisms. Normatively organised systems, in the
188 sense introduced here, are as much a part of the natural world, and are just as subject to the regime of natural laws, as any rock or cloud or mountain. But if the normative status of programmed regularities is not of ontological significance, it may be very important from a heuristic point of view. The reason should be clear. We can have evidence that a system is designed or selected to fit a certain sort of role, and we may be able to work out the regularities that should be normative for such a system, independently of identifying empirically the regularities that it actually satisfies in its behaviour. Knowledge of the designer responsible, or of the designer’s purposes, or just a little experience of the system itself, may convince us that this device is meant to add. And that being so, we are in a position to predict a whole range of responses, at least when the system does not go on the blink. We can occupy a vantage point on the performance of the system that is going to be difficult to attain with any agent that is not normatively directed in this way. The normative status of certain programmed regularities may be not just heuristically significant-not just significant in the generation of knowledge-but also significant from an explanatory point of view. To get an explanation of the kind that is relevant here is always, I take it, to get information on the causal history of the event or condition explained (see Lewis 1986, Essay 22; Pettit 1993, Chapter 5). To know that a certain antecedent not only programs for a result, but programs for it normatively, is to acquire a distinctive sort of information on the genesis of the event. It is to learn that the antecedent programmer gave rise in context to the result, as in any other case, but it is also to learn that consistently with the system’s satisfying the role for which it is designed or selected-consistently, for example, with its being an adding device-that antecedent condition was required in that context to give rise to that result; it could have failed to do so only through malfunction. The normalizing explanation not only tells us what any program explanation tells us, in other words; it also directs us to a certain sort of modal or counterfactual information about the genesis of the matter explained. It lets us see that in any possible world where the system is to satisfy its role-subject perhaps to certain constraints-things will have to be such that, absent malfunction, the antecedent state gives rise to the result in question. Not only
Three Aspects of Rational Explanation
189
are things organised in this world so that the realisation of the programming state more or less ensures that there will be a lower-level state available to produce the result. Things have to be organised in that way in any world where the system satisfies the role for which it is designed or selected. So much on normalizing explanation in general. What I now suggest is that rational explanation is not just a form of programming explanation, it is also a form of normalizing explanation. In dealing with one another, we put in place an assumption that, absent malfunction and other ills, we are creatures who satisfy the role of rational agents: we are more or less rational in our responses to evidence and more or less rational in moving from what we believe and value to what we do (see Cherniak 1986). The regularities that govern our adjustments in these respects are norms of rationality: they are regularities that any rational creature will have to respect, as the principles of addition are regularities that any adding machine will have to honour. We may believe that we satisfy the role of rational creatures as a result of natural selection, or cultural influence, or divine design, or a mix of these influences. The grounding does not matter. The important thing is that we expect one another-and, if we are to relate as human beings, we probably must expect one another-to conform to that role and to the associated regularities. The expectation of rationality-strictly, rationality-absent-malfunction-ordisturbance-or...-enables us to generate predictions of another agent’s behaviour that would otherwise be difficult to generate. This is the heuristic aspect of our seeing intentional regularities as norms. Furthermore, the expectation means that we each find a special explanatory significance, a significance lacking in regularizing explanation, in the fact of being able to trace another’s response to an intentional, programming antecedent; we see the response as one that is required in any rational agent who displays the antecedent state. This is the explanatory significance of our representing the regularities as norms. As I have not formally argued that rational explanation is a form of programming explanation, so I will not repeat my arguments here for holding that it is a form of normalizing explanation (see Pettit 1986). Suffice it to mention that the picture of rational explanation as normalizing fits with a variety of views current in philosophy; it is not based in any particularly
190 sectarian commitment. A range of views emphasise the extent to which rational explanation is directed and driven by the attempt to represent the behaviour or attitudes explained, given background and context, as in some way normatively appropriate responses. Any such view would give us reason for being hospitable to the thought that in rational explanation, we not only trace an agent’s responses to certain, programming antecedents, we often trace it to antecedents whose realisation means that the responses were required or expected of the agent. 3. Rational explanation as hermeneutic explanation Is every sort of normalizing explanation going to count as hermeneutic or interpretative? Of course not. The explanations which we invoke for the adding machine’s responses need not count as interpretations. And certainly the explanations which we give for the responses of the human body in a sauna or in a cold shower will not count as interpetative. But is an intentional, normalizing explanation of a human being’s responses bound to count as interpretation? Again, and surprisingly, no. Consider a human being to whom we apply, successfully, the apparatus of Bayesian decision theory. We find a pattern in the person’s responses which allows us to assign a probability function-this determines degrees of belief-and a utility function-this determines degrees of desire-and to see everything he does, and indeed every revision of probability he undergoes, as rational in Bayesian terms. The utility function gives a utility figure to every prospect and the probability function offers us suitably corresponding measures of probability; different versions of Bayesian theory require different measures (Pettit 1991). We find that in every thing the person does, he maximises expected utility: the utility of the option chosen, computed as the sum of the utilities of its probabilistically weighted possible outcomes, is always greater than the utility of any alternative. If we were able to make decision-theoretic sense of an agent in this way, then we would surely have programming and normalizing explanations of his reponses. We would be able to subsume those responses under regularities that count as norms for a decision-theoretically rational subject. We would be able
Three Aspects of Rational Explanation
191
to see each of the responses as being programmed for by the state of the agent’s utility and probability functions and we would be able to see the sort of programming involved as normatively required in any suitably rational agent. But though we would be in a position to offer a programming and normalizing explanation of the person’s responses, there is still an important sense in which we might fail to provide anything worthy of being called a hermeneutic explanation. Consistently with displaying the patterns that invite the decision-theoretic explanations, the agent could be a creature which does not go through any conscious ratiocination. He might be a sort of automaton who enjoys such a superb design that, exposed to appropriate evidence, he revises his degrees of belief in the rational way and, presented with any range of options, he forms degrees of desire, and chooses according to strength of desire, in the rational way. He might never have to think about the import of the new evidence put before him, weighing its significance in the balance with more familiar facts. And he might never have to deliberate about the options which he faces, trying to determine their relative attractions and trying to establish which is the most desirable. His revisions of belief, and his decisions about what to do, might just happen, without any consciousness or control on his part. Decision-theoretic explanation, as this shows, can be entirely silent on how things present themselves within the forum of the agent’s attention. The explanation of a change of belief or a choice of action does not suggest, on any plausible reading, that the agent thinks explicitly in terms of his own probabilities and utilities; it is not clear how he would even know what these are, given the detail involved (Harman 1986, Chapter 9; Pettit 1991). And the explanation leaves it entirely dark as to how the agent reasons otherwise. Suppose that his degrees of belief that p and that q lead him, rationally, to form a certain degree of belief that r. Or suppose that those degrees of belief combine with certain degrees of desire that s and that t to lead him, rationally, to form a certain degree of desire that u. How is the agent supposed to think as he reasons his way, however implicitly, to the conclusion that leaves him with the appropriate degree of belief that r or degree of desire that u? Presumably the agent holds the objects of his grounding beliefs-‘p’ and ‘q’-before his mind. But
192 how does he register the partiality of his beliefs in these objects? Presumably, again, he holds the objects of his grounding desires-‘s’ and ‘t’-before his mind. But how does he register the fact that he desires those propositions rather than believing them? We are left entirely in the dark. The pattern of decision-theoretic explanation which we have been discussing is certainly a programming and normalizing form of explanation, then, but it hardly deserves the name of interpretation. The point becomes compelling when we recognise that there is a more common-or-garden sort of rational explanation that is not silent in the decision-theoretic manner on the way a person thinks and reasons. Not only does it seek to subsume our responses under appropriate norms, it also points us to how things present themselves from the agent’s point of view (Pettit and Smith 1990). Consider a case where an agent walks up to a beggar by the roadside and puts some money in his cap. The decision-theoretic mode of explanation would direct us to the agent’s utilities for the different possible outcomes-probabilistically weighted-of that option and would present the option as superior in such terms to the alternatives. But it would not give us any idea as to how the agent is thinking; indeed, as have seen, it would be compatible with the complete absence of thought. The more regular sort of intentional explanation would score over the decision-theoretic story in this regard. It might say, for example, that the agent took pity on the beggar and gave him the first coin that came to hand; or that the agent was following the principle of always giving beggars a certain amount; or that the agent conceived it to be his duty to help a beggar a day and this was the lucky one; or whatever. But in any case, it would draw attention to the sorts of things that imposed themselves, more or less consciously, on the agent’s attention. It would give us an entree to his cast of mind. This common-or-garden variety of rational explanation, then, is quite distinct from the austere, decision-theoretic kind. It invokes psychological states that program and normalise the responses explained, as decision-theoretic explanation does. But it also lets us see the structure of the subject’s thought, as we might put it. The human subject is not just an arena within which degrees of belief and desire relative to certain contents rationally come and go and
Three Aspects of Rational Explanation
193
rationally congeal, as occasion requires, in the formation of decisions. The human subject makes judgments about those contents, in particular judgments about their degrees of probability and desirability, and may make efforts to ensure that he conforms to the requirements of such self-represented probabilites and desirabilities in the attitudes he forms and the actions he takes. The common-or-garden variety of explanation focuses on this process of reasoning in making sense of how a person thinks and acts. The austere decision-theoretic variety ignores the process; it treats the human subject as a black box. When rational explanation assumes a hermeneutic form, and not just a programming and normalising one, then it casts the person not just as a rational system, not just as a system whose responses display a causally relevant pattern of rationality, but also as a reasoning or ratiocinative subject. The rational system - the ideal subject of decision theory - may realise its rationality on the basis of a purely sub-personal mode of organisation and attunement; it need not have what we would describe as a mental life. The ratiocinative system - the sort of system that our species implicitly or explicitly typifies - may be a more or less rational system in this sense but it is also something else besides; it is a rational system which attains rationality, to the extent that it does, on the basis of distinctive efforts or habits of attention, reflection and reasoning. Rational explanation goes hermeneutic when it characterises such a mental life in the person whose attitudes and actions it explains. Rational explanation, qua programming, directs us to regularities in the way in which certain higher-level factors occasion thoughts and actions. Rational explanation, qua normalising, represents those regularities as norms for the subject in question: ideals that it has to satisfy, though perhaps only within certain constraints and up to certain limits, on pain of not counting as a rational system. And rational explanation, qua hermeneutic, represents those norms as ideals which the subject aspires and tries to fulfill, in the manner of a reasoning agent; it offers an insight into how the subject achieves whatever rationality he displays.
194 Notes 1 This paper is a recasting, in many places a recycling, of material in Pettit 1994. It draws heavily on the picture of the human subject in Pettit 1993. REFERENCES Cherniak, Christopher (1986) Minimal Rationality, M.I.T. Press, Cambridge, Mass.. Harman, Gilbert (1986) Change in View, M.I.T. Press, Cambridge, Mass.. Jackson, Frank and Philip Pettit (1988) ‘Functionalism and Broad Content’ Mind, 97, 1988, 381-400. Jackson, Frank and Philip Pettit (1990a) ‘Program Explanation: A General Perspective’, Analysis, 50, 107-17. Jackson, Frank and Philip Pettit (1990b) ‘Causation in the Philosophy of Mind’, Philosophy and Phenomenological Research, 50, 1990, 195-214. Lewis, David (1986) Philosophical Papers, Vol 2, Oxford University Press, New York. Pettit, Philip (1986) ‘Broad-minded Explanation and Psychology’, in Philip Pettit and John McDowell, eds, Subject, Thought, and Context, Oxford University Press, Oxford, 17-58. Pettit, Philip (1991) ‘Decision Theory and Folk Psychology’, in Michael Bacharach and Susan Hurley, eds, Foundations of Decision Theory, Blackwell, Oxford. Pettit, Philip (1993) The Common Mind: An Essay on Psychology, Society and Politics, Oxford University Press, New York. Pettit, Philip (1994) ‘Towards Interpretation’, Philosophia, Vol 23, pp. 157-70 Pettit, Philip and Michael Smith (1990) ‘Backgrounding Desire’, Philosophical Review, 99, 565-92.
Rationality and Trustworthiness
195
Keith Lehrer Rationality and Trustworthiness
abstract Our rationality depends on the reasons we have for accepting and preferring what we do. But where do reasons come from? What makes what I accept a reason for a conclusion or what I prefer a reason for action? We can explain where reasons come from without postulation or regress. The explanation rests on our trustworthiness combined with our acceptance of it and our preference for it. The explanation reveals that theoretical and practical reason are intertwined in a loop of trustworthiness in what we accept, what we prefer and how we reason. The loop is the keystone of our rationality. Our rationality depends on the reasons we have for accepting and preferring what we do. But where do reasons come from? Let me put that another way. What makes what I accept a reason for a conclusion or what I prefer a reason for action? Some philosophers are inclined to say that some things that I accept just are reasons for conclusions and some things that I prefer just are reasons for action, and that is all that you can say about it. These things are a kind of surd of reason. You cannot explain why they are reasons; they just are. It might appear that the surd of reason is inescapable or we will fall into a regress of explanation and justification. But we can escape the surd of reason. We can explain where reasons come from without the surd of reason or the absurd of regress. The explanation rests on our acceptance of our trustworthiness and our preference for it. Our quest for the explanation will reveal that theoretical and practical reason are intertwined in a referential loop which is the keystone loop of rationality. The first step to answering our question involves the recognition of metamental ascent beyond the first level of belief and desire to the next level of acceptance and preference. Beliefs and desires often arise in us without reflection and sometimes contrary to our interests. We have, however, the capacity to evaluate our first order beliefs and desires and, in this way, rise
196 above them. The positive evaluation of a belief results in the acceptance of what we believe, and the positive evaluation of desire results in a preference for what we desire. Negative evaluation involves the rejection of a belief or the repudiation of a desire. Acceptance may, in addition, result from the positive evaluation of something considered but not believed, just as preference may, in addition, result from the positive evaluation of something considered but not desired, but acceptance is typically based on what we believe as preference is typically based on what we desire. Acceptance and preference are functional states of a higher order mind, what I have called a metamind,1 resulting from metamental evaluation of the contents of first order states of belief, desire or consideration. The distinction between levels is here conceived as a relative notion. What is accepted or preferred may be evaluated again by metamental ascent and higher order acceptance and preference. The importance of the distinction between first order states and the metamental states of acceptance and preference resides in the fact that these states constitute our best efforts to attain our goals and objectives in the light of the information we possess. The objective of acceptance is to accept what is worth accepting and not to accept what is not measured in terms of our theoretical interests, most saliently, the interests of obtaining truth and avoiding error. The objective of preference is to prefer what is worth preferring and to not prefer what is not worth preferring measured in terms of our practical interests, most saliently, of obtaining value and avoiding disvalue. So, acceptance and preference represent our best efforts. But are our best efforts good enough to yield reasons? What converts our best efforts into reasons? Let us begin with acceptance. What converts what we accept into reasons? One way to find the answer to the question is to confront a skeptic. Suppose a skeptic challenges us to show her that we have reasons for what we accept. How are we to meet her challenge? We cannot avoid appealing to what we accept to meet the challenge. A skeptic who insists that we show her that we have reasons for what we accept without appealing to anything we accept must be ignored for we can have nothing to show her. To meet the challenge, we must assume that we are trustworthy in what we accept. It was Thomas Reid who first saw the importance of this principle.2 For, as he said, if a skeptic does
Rationality and Trustworthiness
197
not allow that I am trustworthy in what I accept, then rather than dispute with her, I must put my hand over my mouth in silence. If, on the other hand, it is allowed that I am trustworthy in what I accept, then I can proceed to show her that what I accept is reasonable. Of course, to assume that I am trustworthy in what I accept is not to claim infallibility. I do accept things that are false and not worth accepting, however avidly I seek to avoid doing so. Though I am fallible, I am, nonetheless, trustworthy. As an analogy, I might hire a guide to help me explore an unfamiliar terrain, and, though she is fallible, for even the best of guides lose their way now and then, she may be someone who is, nonetheless, trustworthy, and it is reasonable for me to follow where she leads. Suppose, then, that I accept the following principle derived from Reid: A. I am trustworthy in what I accept. I may, then, use this principle to show the skeptic that what I accept is reasonable. Suppose I accept that p. My argument that it is reasonable for me to accept that p runs as follows: 1. I accept that p. 2. I am trustworthy in what I accept. 3. I am trustworthy in accepting that p. (1,2) 4. Accepting that p is more worthy of my trust than not accepting that p. 5. It is more reasonable for me to accept that p than not to accept that p. 6. It is reasonable for me to accept that p. 7. It is reasonable for me to accept a conclusion I reach by reasoning from p. 8. Thus, p is a reason for a conclusion I reach by reasoning from p. Each line is inferred from the one directly preceding it except 3 which is inferred from the two preceding lines. This argument shows us where reasons come from. They come from what I accept combined with the assumption of my trustworthiness in what I accept. What is there to be said in defense of the argument? The inference from 1 and 2 to 3 depends on the interpretation of 2. I will have more to say about 2 below as it is the key premise, and, I suggest, a keystone premise. The inference from 3 to 4 depends on the assumption that if I am trustworthy in accepting something, then accepting it is more worthy of my trust than not accepting it.
198 In defense of this inference, suppose I confront the issue of whether to accept or not to accept that p. Suppose I accept that p. If I am trustworthy in what I do, then acceptance must be more worthy of my trust than nonacceptance. The inference from 4 to 5 depends on the objective of accepting what is worth accepting. If that is my objective, and, in terms of that objective, acceptance is more worthy of my trust than nonacceptance, than acceptance is more reasonable than nonacceptance too. Whether it is reasonable to accept something depends on your objectives, and if, as I assume here, my objective is to accept what is worth accepting, then if acceptance is more worthy of my trust for attaining that objective, then it is more reasonable for me for attaining that objective as well. The inference from 5 to 6 is, hopefully, noncontroversial once 5 and 6 are properly understood and distinguished from other claims. It is important to notice the distinction between 5 and the weaker claim X. It is more reasonable for me to accept that p than to accept that not p. Premise X is weaker in that it allows for the possibility that it is more reasonable to suspend judgement, to accept neither p nor not p, than to accept either. Thus, the inference from X to 6 would be invalid because X allows for the possibility that the reasonable course is to accept neither p nor not p. But 5 is the stronger claim, not to be confused with X, that accepting p is more reasonable than not accepting it and, therefore, excludes the possibility that suspension is the reasonable course. On the other hand, premise 6 is a weaker premise than some that it might suggest, for example, O. Every reasonable person ought to accept that p. Premise O is stronger than 6 because the latter says something about what it is reasonable for one person to accept and allows that others, having different evidence perhaps, might be reasonable to accept something else. The inferences of 7 from 6 and 8 from 7 rest on the reasonableness of my reasoning. That needs some defense which I will later undertake. Let us assume for now the reasonableness of my reasoning. What I reason to as a conclusion from what it is reasonable for me to accept is also something it is reasonable for me to accept. So 7 follows from 6. In that case, however, what I reason from is a reason for my accepting the conclusion. Thus, 6 leads to 8 in this way. Some
Rationality and Trustworthiness
199
may, however, find the inference from 6 to 8 more compelling without the mediation of 7, and they may omit the intermediate step to 7. A short version of the argument might be put as follows: 1. I accept that p. 2. I am trustworthy in what I accept. 3. I am trustworthy in accepting that p. (1,2) 6. It is reasonable for me to accept that p. One possible refinement of this would be to combine premises 1 and 2 into a single premise which connects my acceptance of p with my trustworthiness in a more direct way. A premise implying that my acceptance of p is the result my trustworthiness is as follows: 1,2C. I accept that p because I am trustworthy in what I accept. This premise might replace the first two premises of the argument and strengthen the intermediate conclusion 3. The intended meaning of the combined premise is that my acceptance of p is explained by my being trustworthy in what I accept. The substitution of that premise for 1 and 2 would defend the inference to 3 against some objections. Premise 1 of the argument is a given in the discussion with a skeptic. I am not assuming that I have infallible knowledge concerning what I accept. I could, in fact, be wrong about whether I accept something just as I could be wrong about whether what I accept is true. The premise is a given in the sense that it is a starting point. I accept something and then raise the question of whether it is reasonable to accept it, whether I am justified in accepting it and so forth. If I do not accept anything, then these questions do not arise. Some radical materialists, if I understand them, may have doubted whether anybody ever accepts anything, which is a more general worry than the localized concern about whether I accept any specific thing. What I would say to them is that they too start with what they accept because there is no place else to start. An eliminative materialist may begin by accepting the claims of science rather than those of common sense, but they begin with what they accept. There are those who, for spiritual considerations, have alleged to avoid accepting anything. I do not know whether they succeed, but if they do, I can only wish them well at
200 the same time that I doubt that they will succeed. The life of reason is not for everybody. The crucial premise is premise 2. What reason do we have for accepting premise 2? We have assumed it on the grounds that otherwise we are reduced to silence. Does that mean that it is just a surd of reason? Must we say, when asked why it is a reason for concluding anything, that it is a reason because it just is? Fortunately, as Reid again noticed, the situation is not so desperate because 2 has a peculiarity, namely, that when we accept 2 it vouches for ist own truth in just the way that it vouches for the truth of everything else that we accept. Reid says that evidence is like light it this respect. Just as light reveals itself in revealing the illuminated object, so evidence vouches for itself in vouching for some other conclusion.3 We can take this insight from metaphor to argument by noting that premise 2, or principle A, which is the same, is itself something that I accept and, therefore, the argument outlined above yields the conclusion that it is reasonable to accept A when A replaces the variable p. The argument for the reasonableness of accepting A runs as follows: 1. I accept that A. 2. I am trustworthy in what I accept. 3. I am trustworthy in accepting that A. (1,2) 6. It is reasonable for me to accept that A. Premise 3, when expanded, says that I am trustworthy in accepting that I am trustworthy in what I accept, and 6, the conclusion, is that it is reasonable for me to accept that I am trustworthy in what I accept. So, we may say this on behalf of A, premise 2 of the argument, that it vouches ist own truth. If we accept it as a premise in the argument, then the argument shows that it is reasonable for us to accept it, and, therefore, that it is a reason for what we conclude from it. Moreover, principle A explains why we are reasonable to accept it. We are reasonable because we accept it and are trustworthy in what we accept. Objections proliferate, however. Are we not just arguing in a circle? And, if so, will not principle A once again become the surd of reason when we end our dialectical cycling around A? Principle A, the principle of the
Rationality and Trustworthiness
201
trustworthiness of acceptance, does refer to acceptance of itself in a loop of selfreference. But the inclusion of the principle among the things I accept plays a special role which escapes the surd of reason. When asked why it is reasonable to accept the principle, we are not reduced to answering that it just is. The principle explains the reasonableness of what we accept, including itself. The explanation is that acceptance of A converts it into a reason for accepting itself as well as the other things that we accept because we are trustworthy in accepting A as well as the other things we accept. This explanation rests on truth of A as well as our acceptance of it. If we are incorrect in accepting A, that is, if we are not trustworthy in what we accept, then the explanation of the reasonableness of accepting A is also incorrect. But is A true? One might doubt the truth of A on the grounds that we are trustworthy in some of the things we accept but untrustworthy in the acceptance of others. There are two ways of replying to this objection. The first is to note that the principle might be relativized to specific domains, to perception, memory, and so forth, without sacrificing the advantages just considered so long as one of the domains about which I am trustworthy is my own trustworthiness in what I accept. If, as the objection proposes, we are not trustworthy about some of the things we accept, but we can tell whether or not we are trustworthy, then we will be trustworthy about our trustworthiness. Thus, in place of A, I might accept some domain specific principle affirming that I am trustworthy in what I accept in certain domains d1, d2, and in the domain of what I accept about my trustworthiness. For example, consider the following principle: AD. I am trustworthy in what I accept in domains d1, d2 and so forth including the domain of my trustworthiness in what I accept. Some such modification AD of A will have the advantages of A. It will lead to the result that what we accept in the specified domains is reasonable and, included, is the domain of trustworthiness in what we accept. Therefore, the modified principle again explains why it is reasonable to accept it and to employ it as a reason for drawing further conclusions. From AD and my acceptance of it we may conclude that I am trustworthy in accepting AD and the consequences that follow from this conclusion outlined above.
202 I prefer, however, to defend the original principle A. First of all recall that the goal of acceptance is to accept that p if and only if p is worth accepting. For my acceptance to be trustworthy at all it must serve this goal. Consequently, if I think that I am not trustworthy in some domain, for example, in matters of what the income tax law says, then I should not accept things within that domain without the advice of an expert I consider to be trustworthy. In domains where I cannot tell whether something is worth accepting, whether it is true or false, for example, I should not accept anything. Thus, acceptance itself is influenced by my accepting that I am not trustworthy about certain matters. In respect to those matters, I should withhold my acceptance. Put another way, though I agree that there are domains in which I would not be trustworthy were I to accept claims about those domains, I am, in fact, trustworthy in what I accept because I withhold my acceptance in those domains. Secondly, I do not need to be perfect in order to be trustworthy. Premise A should not be treated as the following universal generalization: UGA. For any p, if I accept that p, then I am trustworthy in accepting that p. My imperfection, which is simple human fallibility, implies that I will sometimes accept something when I am not trustworthy in accepting it. Even given my seeking not to accept something in a domain in which I am not trustworthy, it remains possible that, being fallible and imperfect, I might think that I am trustworthy about the domain when I am not and, therefore, accept something when I am not trustworthy in accepting it. Thus, the proper interpretation of A is not UGA but rather a statement of capacity which might be formulated as follows: AC. I accept what I do out of my general capacity to be trustworthy in what I accept. Given that my capacity is fallible, the inference from premises 1 and 2 to 3 is not deductive but inductive. My inference from 1 and 2 to 3 or, even more clearly from 1,2C. I accept that p because I am trustworthy in what I accept to
Rationality and Trustworthiness
203
3. I am trustworthy in accepting that p is an inference like the inference from the premise that a fragile glass is dropped to the conclusion that it has broken. The reasoning, though not deductively valid is, nevertheless, itself reasonable. We will later seek the source of the reasonableness of reasoning and find it in the trustworthiness of reasoning. Let us now turn to the reasonableness of preference. Remember our distinction between preference and desire. Preferences are, for the most part, favorably evaluated desires, though, in fact, we can favorably evaluate a course of action which we consider but do not desire at all, for example, an action which we consider to be the fulfilling of an unpleasant obligation. Thus, preferences represent the results of evaluation. It is assumed in the philosophical and scientific literature that it is reasonable to do what you prefer to do. Expected utility theory assumes this, for example, whether applied to practical matters to yield preference or theoretical matters to yield acceptance. But this conclusion rests on the implicit acceptance of the trustworthiness of what you prefer. For, to take the instance of expected utility maximization, a person might have a coherent probability assignment and a coherent utility assignment yielding expected utility expectations, but his or her assignments might be completely ridiculous. It would not be reasonable for such an agent to act on his or her preferences. The practical syllogism in which one reasons from what one believes to be the best means to a desired end raises the same point. It is natural to suppose that the conclusion of such reasoning is reasonable, but, if the belief or desire is unreasonable, the conclusion may be so as well. The assumption that the conclusion is reasonable rests once again on the assumption that one is trustworthy in accepting what one believes and preferring what one desires. The reasonableness of preference rests, as does the reasonableness of acceptance, on the assumption of trustworthiness, in this case on the trustworthiness of what the person prefers. It is the acceptance of that trustworthiness that converts mere preference into reasons for action. The argument parallels the one given above and is as follows: 1. I prefer x.
204 2. I am trustworthy in what I prefer. 3. I am trustworthy in preferring x. (1,2) 4. Preferring x is more worthy of by trust than not preferring x. 5. It is more reasonable for me to prefer x than not to prefer x. 6. It is reasonable for me to prefer x. 7. It is reasonable for me to prefer a preference I reason to from my preference for x. 8. Thus, my preference for x is a reason for me to prefer a preference I reason to from it. The argument for the inference from 1 and 2 to 3 is as well as the arguments for the inferences from 3 to 4 and from 4 to 5 parallel the arguments pertaining to acceptance closely. If I am trustworthy in evaluating what will fulfill my practical objectives and, hence, trustworthy in what I prefer, then preferring what I do is more worthy of my trust than not preferring it. So 4 follows from 3. Again if my preferring something is more worthy of my trust than not preferring it, then reason favors my preferring it to my not preferring it, and it is more reasonable for me to prefer it than not to prefer it. Thus, 5 follows from 4. The argument for the inference from 5 to 6 again parallels the earlier one concerning acceptance. The inference from 6 to 7 involves assumptions about the reasonableness of my reasoning which I will subsequently defend. Again let us assume the reasonableness of my reasoning at this point. If it is reasonable for me to prefer something, and I reason from that preference to prefer something further, then that further preference is also reasonable. Hence the inference from 6 to 7. Moreover, the preference from which I reason is itself a reason for the further preference. Thus, in the practical case as in the theoretical one, the reasonableness of the premise, whether something I accept or prefer, converts it into a reason for further conclusions reached from it by reasoning. The two arguments concerning acceptance and preference are, therefore, very similar. There is, however, a disanalogy between the two arguments concerning acceptance and preference pertaining to the principles of trustworthiness. The principle used here as premise 2, namely, P. I am trustworthy in what I prefer
Rationality and Trustworthiness
205
is one I defend as reasonable by my acceptance of it and the trustworthiness of acceptance discussed above. This suggests that the theoretical reason of acceptance is more fundamental than the practical reason of preference, but, in fact, I suggest that this illusory. Just as my acceptance of the truth of A and P, the principles of the trustworthiness of acceptance and preference respectively, supplies a premise which enables me convert acceptance and preference into reasons, so my preference for the truth of A and P is required for the conversion to succeed. Let us consider why. Consider the following four principles in a loop of reason: AA. I accept that A
AP. I accept that P
PA. I prefer that A
PP. I prefer that P
Remember that A is the principle affirming that I am trustworthy in what I accept while P is the principle affirming that I am trustworthy in what I prefer. The role of acceptance of A and P, that is, AA and AP, in converting acceptance and preference into reasons for acceptance and preference is clear. Their role is the acceptance of a key premise. What is the role of PA and PP, preference for A and P? Consider the preference for A, that is, the preference for being trustworthy in what one accepts. If a person lacks preference PA for being trustworthy in what she accepts, then the person has grounds for doubt that she will be trustworthy in what she accepts which will undermine her trustworthiness in the acceptance of A. Consequently, premise A will be false and the argument to convert acceptances into reasons will fail. Moreover, and perhaps most profoundly, if a person lacks preference PP for being trustworthy in what she prefers, then the person lacks a reason for accepting that she will be trustworthy in what she prefers. Her lack of preference for being trustworthy in what she prefers provides grounds for doubt that she will be trustworthy in what she prefers which will undermine the trustworthiness of her preferences. Consequently, premise P will be false and the argument to convert preferences into reasons will fail. Finally, it is important to notice that since the acceptance of A and P depend on the preference PA, if the preference PP is lacking, there are grounds for doubting that preferences are trustworthy, namely, the lack of motivation to make them
206 trustworthy. Since she lacks the motivation to make her preferences trustworthy, she lacks something essential to being trustworthy in what she prefers. Consequently, there are grounds for doubting the trustworthiness of preference PA on which the acceptance of A and P depend. Thus, all the components in the loop of reason play a necessary role in the conversion of acceptances and preferences into reasons. Acceptance of the trustworthiness of acceptance and preference supplies the principal premises in the arguments for such conversion. But preference for being trustworthy in acceptances and preferences is essential to the truth of the premises supplied. Theoretical reason supports practical reason because our acceptance of our trustworthiness converts acceptance and preferences into reasons for thought and action. But practical reason supports theoretical reason because our preference for our trustworthiness in acceptance and preference is essential to our trustworthiness. All of the components of the loop of reason are essential to conversion of acceptances and preferences into reasons. None are cornerstones. Instead, they are parts, arcs, of a keystone loop. The metaphor of a keystone is important to the argument. Consider an arch with a keystone in the top of it. The keystone supports the other stones which would fall inward and collapse without it, and, at the same time, the other stones support the keystone. My trustworthiness in what I accept is a keystone in the arch of acceptance as my trustworthiness in what I prefer is a keystone in the arch of preference. But my acceptance of and preference for my trustworthiness in acceptance and preference connect these keystones into a greater loop. Think of the arches as arches in a dome with a circular keystone at the top supporting the arches as they support it. That is the way to think of keystones of our trustworthiness and our acceptances and preferences regarding it. There is an arch missing in the dome of rationality, however, to which we must now turn. All the arguments assume, however implicitly, the reasonableness of how we reason. Whatever the merits of the premises in all the arguments, they will be useless unless we reason in a reasonable way. We might reasonablely accept and prefer what we do, but for what we accept and prefer to constitute reasons we must be able to reason in a reasonable way from them. What is the source
Rationality and Trustworthiness
207
of the reasonableness of reasoning itself? The answer requires that we note a distinction between the inferences we make at the first level and the positive evaluation of them in metamental ascent. Just as I have distinguished between belief and acceptance, desire and preference, so I now distinguish between inference and reasoning. Reasoning, like acceptance and preference, ascends beyond the first level to an evaluation of it. Some inferences we evaluate negatively, others positively. The positive evaluation of inference, whether an inference actually drawn or only considered, is what I will call reasoning. Reasoning represents our best effort to proceed in a way that is valid and cogent. Are our best efforts good enough to conclude that they are reasonable? We require something more to conclude that our reasoning is reasonable for even our best efforts my go awry. What more is needed? The answer should be apparent. We need to assume that we are trustworthy in how we reason. Thus, consider the following principle: R. I am trustworthy in how I reason. We can use this principle to reach the conclusion that we are reasonable in how we reason. The argument runs as follows: 1. I reason that p. 2. I am trustworthy in how I reason. 3. I am trustworthy in my reasoning that p. 4. Reasoning that p is more worthy of my trust than not reasoning that p. 5. It is more reasonable for me to reason that p than not to reason that p. 6. It is reasonable for me to reason that p. This argument need proceed no further. Reasoning supplies us with further premises for reasoning, of course, but these are things we accept or prefer as a result of the reasoning in a reasonable way. The expansion of the keystone loop to include principle R used as premise 2 in the argument clarifies the nature of the loop. To use the argument above, I must accept the premises of this argument. But that is not enough. I must be reasonable in accepting them. To reason to that conclusion, I will need the premise that I am trustworthy in what I accept and, as we have seen, the preference for my being trustworthy in what I accept, and, ultimately, in what I prefer as well.
208 I reason that I am trustworthy in how I reason in the argument just formulated when the variable p is replaced by R itself. I reasoned that I am trustworthy in what I accept and prefer as well in the early arguments. I must accept and prefer that I am trustworthy in how I reason to sustain the argument above. Thus, the keystone loop expands to include the following: AA. I accept that A AP. I accept that P. AR. I accept that R PA. I prefer that A PP. I prefer that P PR. I prefer that P RA. I reason that A RP. I reason that P RR. I reason that R The keystone loop is the principle that I am trustworthy in what I accept, in what I prefer, and how I reason including my acceptance of, preference for, and reasoning to the principle itself. Where do reasons come from? They come from the keystone loop of my trustworthiness. My trustworthiness is not infallibility. How often must I succeed in order to be trustworthy? I must succeed a trustworthy amount of the time. There is no naturalistic exit from the keystone loop of trustworthiness. The dome of rationality is supported by the arches supported by the keystone loop of our trustworthiness. With the keystone in place, the dome stands solid against the assault of irrationality. But it all depends on our trustworthiness. Moreover, a dynamic component is important to our trustworthiness. To be trustworthy a person must be trustworthy in the way she changes what she accepts, prefers and how she reasons. The dynanics of change bring in a social aspect. Changes in what a person accepts, prefers and how she reasons require the evaluation of the trustworthiness of others. No one is an island of trustworthiness unto herself. We become trustworthy by our evaluations of the trustworthiness of others and the aggregation of those evaluations. This, however, is another subject for another time. This paper ends with a keystone loop of the individual supporting the arched dome of her rationality.
References Alston, William. (1985). “Thomas Reid on Epistemic Principles.” History of Philosophy Quarterly 2: 435-452. Alston, William. (1986). “Epistemic Circularity.” Philosophy and Phenomenological Research 47: 1-30.
Rationality and Trustworthiness
209
Audi, Robert. (1988). Belief, Justification and Knowledge. Belmont, CA: Wadsworth. Baier, Annette. (1992). “Trust” In The Tanner Lectures on Human Values, Grethe Peterson (ed.). Salt Lake City: The University of Utah Press. Bartlett, Steven (ed.). (1992). Reflexivity: A Source-Book in Self-Reference. New York: Elsevier Science. Black, Max. (1958). “Self-Supporting Inductive Arguments.” Journal of Philosophy 55: 718-725. Chisholm, Roderick. (1989). Theory of Knowledge. 3rd ed. Englewood Cliffs, NJ : Prentice-Hall. Cohen, Jonathan L. (1977). The Provable and the Probable. Oxford, Clarendon Press. Feigl, Herbert. (1961). “On the Vindication of Induction.” Philosophy of Science 28: 212-216. Hofstadter, Douglas. (1979). Godel, Escher, Bach: An Eternal Golden Braid. New York: Basic Books. Holton, Richard. (1994). “Deciding to Trust, Coming to Believe.” Australiasian Journal of Philosophy 72: 63-76. Kordig, Carl. (1983). “Self Reference and Philosophy.” American Philosophical Quarterly 20: 207-216. Lehrer, Keith. (1989). Thomas Reid. New York: Routledge. Mele, Alfred. (1986). “Incontinent Believing.” Philosophical Quarterly 36: 212-222. Reichenbach, Hans. (1940). “On the Justification of Induction.” Journal of Philosophy 37: 97-103. Suber, Peter. (1987). “A Bibliography of Works on Reflexivity.” In Self-Reference, Peter Suber (ed.). Dordrecht:Nijhoff. Van Cleve, James. (1979). “Foundationalism, Epistemic Principles and the Cartesian Circle.” The Philosophical Review 88: 55-91. Notes 1 Keith Lehrer, Metamind, (Oxford, 1990). 2 Thomas Reid, The Works of Thomas Reid, D. D., Eighth Edition, Sir William Hamilton, ed.,(Edinburgh, 1895), Vol I. p. 448. 3 Ibid.
210 Alexander Ulfig Stufen der Rechtfertigung
abstract For the last 30 years there have been debates in philosophy about the concept of rationality. In anglo-american circles they have been primary characterized as discussions about “justified beliefs.” By contrast, the debate in Germany among discourse-theorists (Habermas, Apel) has been linked to the problem of justification of communicative speech-acts (within the concept of the entire communicative situation). Herbert Schnädelbach has modified the discours-theoretical account. His concept can be regarded along a number of dimensions. He has developed a linguistic analysis of the validity claims made in various speech-act situations (following Paul Taylor). In Schnädelbach’s view, normative characterizations of speech acts can be used descriptively, too. Furthermore, the hierarchy of justifications ends on the level of rational choice. My starting point here is: there is a fundamental distinction between justifications in everyday-life and a theoretical level of justification (discoursive justifications). Thus, I discuss the hierarchy of justifications developed by Schnädelbach. Furthermore, I evaluate Schnädelbach’s concept in a semantic perspective. I will show that Schnädelbach’s pragmatical account requires a semantic analysis. Without recourse to such analysis, we cannot understand the universe of normative language. In den letzten 30 Jahren gibt es in der Philosophie Debatten über Rationalität, die im angelsächsischen Bereich als Diskussionen über “justified beliefs” charakterisiert werden können. Der Rationalitätsbegriff wurde hier weitgehend epistemologisch bestimmt. In der diskurstheoretischen Debatte in Deutschland (Habermas, Apel) wird die Explikation der Rationalität hingegen an die Rechtfertigungsproblematik von kommunikativen Sprechhandlungen gebunden. Herbert Schnädelbach hat 1977 die Arbeit “Reflexion und Diskurs” veröffentlicht, in der er den diskurstheoretischen Ansatz in wesentlichen Punkten fortentwickelt hat und auf die sich seine späteren Überlegungen zum Begriff der Rationalität zum Teil stützen. Die Schnädelbachsche Konzeption des normativen Diskurses liefert eine linguistische Analyse der Geltungsansprüche von Sprechhandlungen. Eine weitere These von Schnädelbach besagt, daß auch von normativen Charakterisierungen ein deskriptiver Gebrauch
Stufen der Rechtfertigung
211
gemacht werden kann. Die Stufen der Justifikation finden ihre Grenzen in der rationalen Wahl einer Lebensform. Schnädelbachs Vorschläge, insbesondere seine sprachanalytische, linguistische Transformation der transzendentalen Geltungsreflexion und damit die linguistische Charakterisierung der Geltungsansprüche, wurden weder von Habermas noch von Apel aufgenommen. Ich gehe davon aus, daß es sich bei Rechtfertigungen auf allen im folgenden dargelegten Stufen primär um Antworten auf Geltungsfragen handelt. Daher ist es in einem ersten Schritt angebracht, die Rede von “Geltung” und “geltungstheoretisch” zu präzisieren. Eine semantische Analyse von normativen Redemitteln betrachte ich als grundlegend gegenüber einer rein sprachpragmatischen - hier liegt mein Hauptkritikpunkt an Schnädelbach. Zweitens sollen die einzelnen Rechtfertigungsstufen im Sinne einer Hierarchie dargestellt werden, wobei die Unterscheidung von alltagskommunikativen und diskursiven Rechtfertigungen maßgebend ist. Der Weg durch die einzelnen Rechtfertigungsstufen führt uns zu einem Begriff der rationalen Wahl, der sowohl für kommunikations- als auch für handlungstheoretische Zusammenhänge von Bedeutung ist. Es empfiehlt sich, “Geltung” als Thema der Verhandlung von geltungstheoretischen Prädikationen zu behandeln. Die Geltungsdimensionen der Rede können mittels geltungstheoretischer Charakterisierungen eingeführt werden. Hierzu verwendet Schnädelbach das Konzept der “normativen Rede”. Ziel einer solchen Analyse im Kontext der Diskurstheorie ist es, normative Gesichtspunkte für die Thematisierung und Validierung von Geltungsansprüchen aufzuzeigen. Die Geltungsdimensionen betreffen erstens das sprachliche Alltagshandeln (das primär-kommunikative Handeln), zweitens die Thematisierung und Validierung der Alltagskommunikation im Diskurs, drittens - in einem weiteren rekonstruktiven Schritt bzw. auf einer höheren rekonstruktiven Ebene - die Thematisierung und Validierung der Geltungsdimensionen der diskursiven Rede. Um die Geltungsbasis der Rede zugänglich zu machen, bedarf es linguistischer Charakterisierungen. Um argumentative Rede als einen Kommunikationsmodus im Zusammenhang mit der Sprachverwendung der normativen Rede zu rekonstruieren - denn hier, in der normativen Rede,
212 werden Geltungsansprüche thematisiert -, soll nach Schnädelbach das Prädikat “geltungstheoretisch” durch den Ausdruck “in normativer Rede” ersetzt werden. Es muß hier hervorgehoben werden, daß es sich hier nicht um “faktische Geltung” (“faktische Anerkennung oder faktische Problematisierung von Geltendem in bezug auf seinen Geltungsanspruch”), also um empirisches Anerkanntsein von Sätzen handelt, sondern um “normative Geltung”, d.h. um Geltung, die nur in normativer Rede thematisiert und problematisiert werden kann.1
Diese
Unterscheidung,
die
ihren
philosophiegeschichtlichen
Entstehungsort in der kantischen Philosophie hat (vgl. die kantische Frage “quid iuris?”), taucht in unterschiedlichen Kontexten in der modernen Philosophie auf. “Faktische Geltung” kann sowohl deskriptiv (z.B. als ein sozialer Tatbestand) als auch hermeneutisch (im Prozeß des Sinnverstehens) thematisiert werden. Geltungstheoretische Charakterisierungen unterscheiden sich von deskriptiven und hermeneutischen dadurch, daß sie (a) faktisch Geltendes im Hinblick auf seinen “normativen Sinn” und (b) diesen Sinn im Hinblick auf eine mögliche (nicht faktische) Anerkennung durch den Charakterisierenden explizieren. Geltung soll nicht ontologisch durch Rekurs auf einen ontischen Gültigkeits- oder Normenbereich, sondern mit Hilfe “linguistischer Charakterisierungen normativer Rede” problematisiert werden. Mittels der linguistischen Charakterisierungen soll die argumentative Rede, in der Geltungsansprüche thematisiert werden, sprachanalytisch rekonstruiert werden. Von besonderer Bedeutung für die Charakterisitk der normativen Rede ist die terminologische Unterscheidung von Geltung und Gültigkeit. Unter “Geltung” ist hier nur die Dimension zu verstehen, in der bestimmte Ansprüche und Bedingungen charakterisiert werden, ohne daß sie gerechtfertigt, eingelöst oder erfüllt wären. “Gültigkeit” soll hingegen diejenige Dimension anzeigen, in der “Legitimität von Geltungsansprüchen” und das “Erfülltsein von Geltungsbedingungen” bereits bestehen.2 Von “Geltung” spricht man dort, wo ein Anspruch erhoben, gegebenenfalls problematisiert und verhandelt wird, wo etwas gelten soll, von “Gültigkeit” dort, wo ein Anspruch bereits eingelöst ist, wo etwas bereits besteht, “gilt”.
Stufen der Rechtfertigung
213
Die entscheidende Frage in diesem Zusammenhang lautet: Was kann Geltung beanspruchen, bzw. was kann gültig sein? Nach Schnädelbach sind drei Gültigkeitsbereiche zu unterscheiden: (a) Dinge, Sachverhalte und Ereignisse: Geltungsansprüche (Ansprüche auf Legalität, Legitimität und Regelgerechtheit) werden hier “von uns” in bezug auf Gegenstände, Sachverhalte und Ereignisse erhoben; Schnädelbach spricht von “normierten Sachverhalten” (Geltung 1). (b) Regeln, Normen, Gesetze, Vorschriften können gültig oder ungültig sein; diese “Sachverhalte” erheben “uns gegenüber” normative Geltung man spricht hier von “normativen Sachverhalten” (Geltung 2); Sachverhalte selbst erheben hier Geltung (nicht nur die Formulierung der Sachverhalte beansprucht Geltung). (c) Redegegenstände normativer Diskurse, die die Sprechakte als Handlungen und den propositionalen Gehalt thematisieren (Geltung 3).3 Geltung 1 und Geltung 2 betreffen Redegegenstände des alltagskommunikativen Gebrauchs normativer Rede, Geltung 3 betrifft die Redegegenstände normativer Diskurse. In der Alltagskommunikation werden normative Prädikate (“gut”, “richtig”, “geboten”) auf Sachverhalte bezogen; diese Sachverhalte bestehen oder bestehen nicht, gelten oder gelten nicht; sie können jedoch weder wahr noch falsch sein. Daher ist es angebracht, normative Aussagen (evaluative und präskriptive) der Alltagskommunikation von diskursiv-normativen Aussagen, die sich auf deskriptive und normative Aussagen der Alltagskommunikation selbst beziehen, zu unterscheiden. Dies hat Folgen für die Hierarchisierung der Rechtfertigungsstufen; ich werde im folgenden auf die Unterscheidung zwischen alltagskommunikativen und diskursiven Rechtfertigungen einen großen Wert legen.4 Schnädelbach analysiert nicht die Semantik der “normativen Sprache”, sondern geht davon aus, daß der explikative Diskurs im Sinne einer Pragmatik der Erläuterung die Verwendung der Redemittel zu klären vermag. Diese zunächst plausible Darstellung setzt sich dem Einwand eines pragmatischen Fehlschlusses aus. Auch eine Pragmatik der Erläuterung muß sich auf eine semantische Analyse der in ihm verwendeten Ausdrücke stützen müssen, da die Erläuterung der entsprechenden linguistischen Mittel in verschiedenen Verwendungssituationen nicht semantisch leer sein soll. Dies betrifft alle
214 Redemittel
des
normativen
Diskurses
und
die
sprachlichen
Referenzgegenstände. Schnädelbach geht davon aus, daß der explikative Diskurs eine Sache der Übersetzung ist, d.h. ein Explanandum Ei wird in einen anderen Kontext übertragen, da der vorherige dieses Explanandum unverständlich ließ. Daraus ziehe ich die Folgerung, daß wir einer semantischen Analyse bedürfen, um den Gebrauch der normativen Redemittel zu bestimmen. Diese Analyse sollte nicht auf der Basis des Regelbegriffs, sondern der einer kognitiven Semantik erfolgen.5 Die Semantik der normativen Sprache (Sprache als System von Ausdrücken) betrifft 1. semantische Eigenschaften der Wörter, mit denen wir normative Kennzeichnungen äußern, 2. semantische Eigenschaften der Wörter, mit denen wir Gründe für oder gegen normative Charakterisierungen abgeben; das Denken in diesem Kanon (1-2) heißt, die normative Sprache verwenden zu können. Ein Vorschlag für eine semantische Analyse soll unten anhand der Rechtfertigungsstufe der Verifikation gemacht werden. Ich möchte von einer Charakterisitk normativer Rede im Zusammenhang der Alltagskommunikation ausgehen. Charakterisierungen in normativer Rede, die dem alltagskommunikativen Handeln eigen sind, werden von Schnädelbach normative Charakterisierungen im Gegensatz zu diskursiv-normativen Charakterisierungen genannt; in normativen Charakterisierungen werden normative Ausdrücke prädizierend den Redegegenständen (Dingen, Personen, Ereignissen, Handlungen, Eigenschaften) zugesprochen. Die meist - aber nicht ausschließlich - objektsprachlich gebrauchten Ausdrücke der Alltagskommunikation können im Hinblick auf ihren Gebrauch untersucht werden (es ist möglich, auch objektsprachlich über Ausdrücke zu reden). Zu den Referenzobjekten dieser Rede gehören dann Dinge, Sachverhalte usw., aber auch “Sprachliches als Ding, Sachverhalt oder Ereignis (Hervorhebung d.V.)”.6 Zunächst müssen allerdings diese Gegenstände als Referenzobjekte normativer Prädikationen identifiziert werden; um diesen Gegenständen Prädikate zuzusprechen, müssen sie als für die normative Rede geeignete Gegenstände fungieren und zum Referenzbereich einer normativen Prädikatenklasse gehören (bei G. Ryle heißt eine solche Prädikatenklasse “normative Kategorie”). Die Identifikation von Gegenständen normativer Rede wird in der identifizierenden Kennzeichnung vom Typus “Dies ist ein ...”, “Der ...” usw. vollzogen,
Stufen der Rechtfertigung
215
die als Bestandteil der normativen Charakterisierung aufzufassen ist. Zur normativen Charakterisierung gehört neben ihr die prädizierte Beurteilung; im Falle der “prädizierenden Beurteilung” werden den Redegegenständen normative Prädikate vom Typus “... ist gut”, “... ist richtig”, “... sollte der Fall sein” zu- oder abgesprochen, die sich in evaluative und präskriptive aufteilen lassen. “Evaluative Basisterme” sind “gut” und “richtig”, der “präskriptive Basisterm” heißt “sollte”. Beide Gebrauchsweisen gehören zur normativen Beurteilung.7 Können normative Kennzeichnungen und normative Beurteilungen der Alltagskommunikation auch im normativen Diskurs vorkommen? Die diskursiv-normativen Charakterisierungen sollen nach Schnädelbach als normative Charakterisierungen von normativen und deskriptiven Charakterisierungen begriffen werden; er spricht hier von normativen Charakterisierungen zweiter Stufe, die selbst wiederum normative Kennzeichnungen und Beurteilungen beinhalten; normative Charakterisierungen zweiter Stufe sind geltungstheoretische Charakterisierungen der Geltungsansprüche im Sinne von Geltung 3. Schnädelbach schlägt an dieser Stelle folgendes Modell normativer Charakterisierungen vor: Die Behauptung “a
0
S” soll als Einsetzungsfall von
“xn1 0 Pn1" auftreten; “x” steht für Gegenstände aller Art (Dinge, Ereignisse, Personen, Handlungen, Eigenschaften), “P” steht für Prädikate, der Index n1 zeigt an, daß x und P zu einer bestimmten normativen Kategorie Kn1 gehören. Explizit wird in “a 0 S” behauptet, daß dem Gegenstand a die Eigenschaft P zugesprochen wird. Implizit lassen sich jedoch folgende Unterstellungen formulieren: (a) “a ist ein Wert von xn1", (b) “S gehört zur Prädikatorenklasse Pn1", (c) “Es trifft zu, daß a 0 S”. Gültigkeit dieser Unterstellungen beansprucht man, wenn “a 0 S” behauptet wird. Die normative Charakterisierung erster Stufe “a 0 S” darf somit selbst normativ charakterisiert werden, und das bedeutet, daß man den Sinn von “a 0 S” in normativer Hinsicht kennzeichnet.8 In der normativen Kennzeichnung kann der Sinn eines Sprechaktes als Gegenstand einer normativen Charakterisierung in die diskursive Rede eingeführt und das “Woraufhin” dieses Sinnes festgelegt werden. Dabei müssen die kennzeichnenden Ausdrücke (“Es wurde gesagt, daß ..., und damit unterstellt, daß ...usf.”) selbst zur Kategorie der normativen Sprache gehören, wenn das, was sie kennzeichnen, als Gegenstand einer möglichen normativen
216 Beurteilung eingeführt werden soll; Schnädelbach spricht in diesem Fall von diskursiv-normativen Kennzeichnungen. Indem die in alltagssprachlichen Charakterisierungen beanspruchten Redemittel als Gegenstände möglicher normativer Beurteilung in die diskursive Rede eingeführt werden, legt man den normativen Sinn aus, d.h. die Geltungsansprüche der Redemittel als Gegenstände einer möglichen normativen Beurteilung. In der normativen Beurteilung - sie ist die normative Charakterisierung der durch die diskursivnormative Kennzeichnung bereitgestellten Redegegenstände - werden Prädikate wie “korrekt gebildet”, “richtig angewandt”, “vernünftig”, “gültig”, “wahr” verwendet; Schnädelbach nennt dies die diskursiv-normative Beurteilung. Den alltagskommunikativen Geltungsanspruch erhebt man nicht im normativen Diskurs,
weil
durch
den
“Wechsel
der
normativen
Hinsicht
der
Charakterisierung beim Übergang zum Diskurs” andere Geltungsansprüche erhoben werden - Geltungsansprüche der diskursiv-normativen Charakterisierung, die man selber thematisieren und virtualisieren kann. Von besonderer Relevanz ist der Umstand, daß der normative Diskurs (also die diskursiv-normative Charakterisierung zweiter Stufe) nicht nur normative Charakterisierungen erster Stufe der Alltagskommunikation, sondern auch deskriptive Charakterisierungen zum Thema macht; dies wird mit Hilfe der folgenden Prädikate vollzogen: “logisch konsistent”, “grammatisch richtig gebildet”, “verständlich”, “wahr”. Dies führt uns zu der These, daß der normative Diskurs Geltungsansprüche verschiedenster Art problematisiert, d.h. alle Aspekte des alltagskommunikativen Handelns berücksichtigt, die für eine normative Charakterisierung geeignet sind. Die Wahl dieser Aspekte hängt von den jeweiligen normativen Gesichtspunkten
ab.
Die
diskursiv-normativen
Charakterisierungen
unterscheiden sich von den normativen Charakterisierungen des alltagskommunikativen Handelns dadurch, daß (a) “ihr Gegenstandsbereich nur die Redemittel des primär-kommunikativen Handelns umfaßt, sofern deren Sinn Gegenstand einer möglichen normativen Charakterisierung ist; (b) in ihnen kommen nur solche normativen Prädikate vor, die sich sinnvollerweise auf den Sinn jener Redemittel beziehen lassen”.9 Zu solchen Prädikaten - neben den schon erwähnten -, die nicht den Vollzug, sondern den “Sinn” eines Sprechaktes betreffen, gehören: “Es ist wahr: ...”, “Es ist richtig: ...”, “Es ist beweisbar: ...”
Stufen der Rechtfertigung
217
oder “...ist gerechtfertigt”. Beurteilungen von Sprechakten sind Gegenstände der diskursiven Rede, nicht die Sprechakte als solche. Diskursive Beurteilungen von z.B. Aufforderungen enthalten selbst keine Aufforderungen. Eine Beurteilung des Sprechakts “Ich fordere Dich auf, x zu tun” hätte z.B. die Form “Der Sprechakt ‘Ich fordere Dich auf, x zu tun` ist sinnvoll” oder “Der Sprechakt ‘Ich fordere Dich auf, x zu tun` ist berechtigt”. Auch diskursiv-normative Charakterisierungen
können
zum
Gegenstand
diskursiv-normativer
Charakterisierungen werden; in diesem Fall untersucht man sie Schnädelbach zufolge so wie die Charakterisierungen des alltagskommunikativen Handelns. War bisher von der Thematisierung von Geltungsansprüchen mittels der normativen Charakterisierung die Rede, so soll im folgenden die Eigenart von Überprüfung und Rechtfertigung von Geltungsansprüchen gegenüber ihrer bloßen Thematisierung der Gegenstand der Untersuchung sein. Im ersten Schritt empfiehlt es sich, den “überprüfenden und rechtfertigenden Gebrauch von normativen Charakterisierungen” in der Alltagskommunikation zu behandeln (normative Überprüfung bzw. Rechtfertigung). Die normative Überprüfung wird eingeleitet mit der Frage: “Trifft es zu, daß p?”. Für “p” steht kein Ding, keine Person oder Handlung, sondern ein Sachverhalt, der durch eine normative Charakterisierung in die Rede eingeführt werden soll, um einer normativen Überprüfung zugänglich zu sein; erstens erfolgt also die normative Charakterisierung, erst daraufhin können Sachverhalte normativ überprüft werden.
Mögliche
Gegenstände
der
normativen
Überprüfung
im
alltagskommunikativen Handeln sind demnach die durch normative Charakterisierung in die Rede eingeführten normativ-relevanten Sachverhalte. Die überprüfende Verwendung normativer Charakterisierungen wird also mittels der Frage “Trifft es zu, daß p?” in Gang gesetzt; anhand dieser Frage will man nicht erfahren, welche normative Eigenschaft dem Redegegenstand von “p” zu- oder abgesprochen wird, sondern ob der Gegenstand, dem eine Eigenschaft bereits zu- oder abgesprochen ist, diese Eigenschaft wirklich besitzt. Die Antwort auf die Frage “Trifft es zu, daß p?” kann eine affirmative modale Beurteilung sein: “Ja, wirklich p!”. Der Umstand, daß einem Redegegenstand eine normativ-relevante Eigenschaft in der normativen Charakterisierung zuoder abgesprochen wird, liegt der Überprüfung von Sachverhalten voraus.
218 Deshalb kann zwischen einer Überprüfung von Sachverhalten und der normativen Charakterisierung von Gegenständen differenziert werden. Unter Rechtfertigung ist zunächst ein “Verwendungstypus normativer Charakterisierungen” zu verstehen. Alle Rechtfertigungen haben gemeinsam, daß sie nicht als Präskriptionen auftreten können, obwohl sie sich auf evaluative und präskriptive Sätze beziehen - Präskriptionen können nicht zur Rechtfertigung von Präskriptionen verwendet werden. Um die positiven Vorstellungen, die mit dem Begriff “Rechtfertigung” assoziiert werden, zu vermeiden, schlägt Schnädelbach vor, den Ausdruck “Justifikation” zu verwenden. Er soll dasjenige bezeichnen, das als Antwort auf normative Überprüfung zu verstehen ist - Beispielsweise die Antwort auf die Frage “Trifft es zu, daß p”. Im alltagskommunikativen Handeln beziehen sich Justifikationen auf normativ-relevante Sachverhalte: “die Existenz von a (als Wert von xn);... daß a die Eigenschaft (als Wert von Pn) besitzt; das Ereignis En; die Handlungen etc.” Diese Sachverhalte sind justifiziert, wenn gezeigt wird, daß sie dem normativen Anspruch genügen, der durch den Index n angezeigt ist.10 Zwei Arten der Justifikation können in der Alltagskommunikation genannt werden: (a) Justifikation “... daß ...” und (b) “... weil ...”. Im Falle von (a) ist ein Sachverhalt pn gerechtfertigt, wenn p der durch n angezeigten Norm entspricht; diese Norm zeigt man modal auf: “... ist wirklich ...” (konstative Justifikation). Im Falle (b) ist ein Sachverhalt pn gerechtfertigt, wenn er zu einer Gruppe von Sachverhalten gehört, in der alle Sachverhalte bereits gerechtfertigt sind (Justifikation durch Ableitung - argumentative Justifikation).
Dabei sind
allerdings nicht nur logische Ableitungen, sondern auch z.B. pragmatische Rechtfertigungen gemeint. Argumentative Justifikationen haben die Form: “‘p` ist wahr, weil ‘q` wahr ist”; die Gültigkeit einer Behauptung wird von der Gültigkeit einer anderen Behauptung abhängig gemacht, wobei die Gültigkeit der anderen Behauptung unterstellt wird. Im Falle von pragmatischen Rechtfertigungen hat die argumentative Justifikation die Form: “pn weil qn” (pn ist durch qn gerechtfertigt, weil qn selbst schon gerechtfertigt ist). Die konstative Justifikation und die empirische Verifikation haben die Konstatierung gemeinsam; der Unterschied liegt in dem, was sie konstatieren; im Falle der
Stufen der Rechtfertigung
219
konstativen Justifikation ist es das “Gerechtfertigtsein eines Sachverhalts”, im Falle der empirischen Verifikation das “Bestehen eines Sachverhalts”. An dieser Stelle möchte ich eine semantische Analyse der Rechtfertigungsstufe Verifikation vorschlagen, und zwar der Verifikation von elementaren Wahrnehmungsaussagen “a ist F”, in denen einem Gegenstand ein Prädikat oder mehreren Gegenständen ein mehrstelliges Prädikat zugesprochen wird. Der Gegenstand wird über die Bedeutung der in der Aussage verwendeten singulären Termini wie Eigennamen, Kennzeichnungen und deiktischen Ausdrücken festgelegt. Wenn auf den festgelegten Gegenstand ein Prädikat “zutrifft”, ist die Aussage wahr. Die Verifikation von elementaren Wahrnehmungsaussagen knüpft an die Bedeutung der einzelnen Teile der Aussage an. Insofern kann die Rechtfertigungsstufe der Verifikation mittels einer semantischen Analyse der singulären Termini und der Prädikate geklärt werden. Eine solche Analyse wird u.a. von Tugendhat durchgeführt. Die Verifikation des Prädikats “F” wird durch die Verwendung des Satzes “dies ist F (bzw. nicht F)” in verschiedenen Verifikationssituationen erklärt (das Wort “dies” steht jeweils für einen verschiedenen Gegenstand, jedoch immer für einen Wahrnehmungsgegenstand).11 Man muß zunächst eine oder mehrere passende Situationen für “dies ist a” überprüfen, um in der allgemeinen Verifikationssituation für “dies ist F” mit Recht sagen zu können “dies ist a”. Wie kann aber die allgemeine Verwendungsregel der allgemeinen Verwendung von “F” in “a ist F” bestimmt werden? Die Verwendungsregel kann hier nicht durch die Verwendungssituation festgelegt werden. Die Verifikationsregel des Prädikats zu erklären heißt, zu zeigen, wie bei einem beliebigen Gegenstand festgestellt werden kann, ob das Prädikat zutrifft. Im Normalfall wird das Prädikat mit einem beliebigen singulären Terminus “a” verbunden (“a” steht für einen Gegenstand, der nicht in der Wahrnehmungssituation gegeben zu sein braucht). Somit kann das Prädikat “F” in Verbindung mit einem singulären Terminus “a” verwendet werden; das Prädikat “F” trifft auf den mit “a” gemeinten Gegenstand zu. Daraus folgt die Angabe der Wahrheitsbedingung einer prädikativen Behauptung “a ist F”: “Die Behauptung, daß a F ist, ist wahr, wenn man den Satz ‘dies ist F’ in der Situation, in der man das Wort ‘dies’ für
220 ‘a’ ersetzen kann (sagen kann ‘a ist dies’), richtig verwenden kann, ‘richtig’ gemäß der vorausgesetzten Erklärung der Verifikationsregel von ‘F’.”12 Was die argumentative Justifikationen angeht, so nennt man sie oft Begründungen. Im alltagskommunikativen Handeln figurieren Begründungen als Antworten auf “epistemische Warum-Fragen”, z.B. “Warum ist das Wetter heute so schlecht”?; Antwort: “Der Grund ist: Weil die Temperatur gefallen ist”. Von dieser Begründungsform sind zu unterscheiden Antworten auf Fragen “nach Intentionen und Handlungszielen”: “Warum hast Du das getan?”; Antwort: “Der Grund für mich war ...”; und Begründungen als Antworten auf Fragen nach der “Berechtigung, etwas zu tun”: “Wie kommst Du eigentlich dazu, dies zu tun?”; Antwort: “Dies mußte aus den und den Gründen getan werden”. Die ersten zwei Begründungsformen nennt Schnädelbach “explanatorisch”, die dritte “justifikatorisch”. Im alltagskommunikativen Handeln beziehen sich die Justifikationen “nur implizit” auf normative Charakterisierungen; “implizit” bedeutet hier, daß sie affirmativ oder negativ auf die durch die normativen Charakterisierungen in die Rede eingeführten Sachverhalte Bezug nehmen. In Diskursen dagegen sind normative Charakterisierungen selbst Gegenstände der Justifikation.13 In Anlehnung an P.W. Taylor unterscheidet Schnädelbach vier Stufen der Justifikation: (a) Verifikation - primäre Justifikation (siehe oben). (b) Validation - die Rechtfertigung der Gültigkeit oder Angemessenheit der Regeln und Standards für den konkreten Fall einer Evaluation oder Präskription. Durch die Validation wird die Anwendung der Regeln und Standards gerechtfertigt. Die Rechtfertigung von normativen Charakterisierungen ist erst dann vollständig, wenn sie die Validation umfaßt. (c) Vindikation - die Rechtfertigung des Akzeptierens eines normativen Gesichtspunktes und die pragmatische Rechtfertigung der Wahl eines normativen Gesichtspunktes. (d) Rationale Wahl - sie verweist auf Minimalbedingungen der Rationalität der Wahl normativer Gesichtspunkt.14 Lassen sich diese vier Typen von Justifikationen nur innerhalb des alltagskommunikativen Handelns finden oder überschreiten sie den Bereich der Alltagskommunikation und werden dadurch diskursiv?
Stufen der Rechtfertigung
221
Nach Schnädelbach bleiben die Justifikationen auf den Stufen von Validation, Vindikation und rationaler Wahl von Sachverhalten, die durch normative Charakterisierung in die Rede eingeführt werden, innerhalb der Alltagskommunikation, weil sie sich, wie dargestellt wurde, auf Sachverhalte beziehen und nicht wie Diskurse auf normative Charakterisierungen von Sachverhalten. Die diskursiv-normative Justifikation ist die normative Rechtfertigung der Geltungsansprüche der normativen und deskriptiven Charakterisierungen von Sachverhalten. Die vier Justifikationsstufen tauchen in diskursiven Kontexten auf als Justifikationen des Geltungsanspruchs normativer und deskriptiver Charakterisierungen selber. Die diskursiv-normativen Überprüfungen und diskursiven Justifikationen beziehen sich nicht nur auf die deskriptiven und normativen Charakterisierungen des alltagskommunikativen Handelns, sondern auch auf den gesamten Justifikationszusammenhang, also auf die alltagskommunikative Validation, Vindikation und rationale Wahl. Die rationale Wahl einer Lebensform bestimmt die Vindikation der Standards und Regeln und die Auswahl der normativen Gesichtspunkte. Die Vindikation betrifft die Rechtfertigung der Akzeptanz von normativen Gesichtspunkten. Davon hängt qualitativ und strukturell der ganze Evaluations- und Justifikationszusammenhang ab. Es kann jedoch verschiedene Wert-Systeme geben, zwischen denen ich mich im Konfliktfall entscheiden muß; hierdurch wird die Vindikation nochmals bewertet (Vindikation der Vindikation); wir brauchen hier die Rechtfertigungsstufe der rationalen Wahl. Die Hierarchie der Rechtfertigungen findet ihr Ende in der rationalen Wahl einer Lebensform. Die rationale Wahl soll dann gerechtfertigt sein, wenn sie rational ist; zwischen beiden Prädikaten besteht nach Taylor Bedeutungsgleichheit. Rationale Wahl wäre dann auch in diesem Sinne gerechtfertigte Wahl. Wodurch wird sie aber gerechtfertigt? Laut Schnädelbach kann eine solche Rechtfertigung nicht argumentativer Art, das Prädikat “rational” kein Gegenstand der argumentativen Justifikation sein. Es kann nur in einem explikativen Diskurs aufgezeigt werden.15 Die Justifikationen finden ihr Ende in einer Explikation des Prädikats “rational”, die nur noch akzeptiert oder zurückgewiesen werden kann. In der diskurstheoretischen Rationalitätskonzeption von J. Habermas finden wir keinen Platz für eine solche entscheidungstheoretische Komponente. Natürlich
222 ist “rationale Wahl” kein rein semantischer Begriff; er betrifft einerseits die kognitive Basis in Bezug auf die Entscheidungsfähigkeit von Personen, andererseits die Selektion von möglichen Orientierungen im handlungstheoretischen Kontext. Zu den Bedingungen der rationalen Wahl gehören: 1. der Wählender darf nicht unter äußeren oder inneren Zwängen stehen; 2. er muß auf der Basis seiner eigenen Überlegungen zu der Entscheidung kommen; 3. der Lebensweg muß für ihn durch Exemplifizierungen
weitgehend
durchsichtig sein; 4. es gibt keine absolute rationale Wahl; das Konzept der rationalen Wahl impliziert eine Pluralität von Lebensformen und privilegiert keinen einzigen “richtigen” Lebensweg. Diese Bedingungen können nicht angeben, für was für einen Lebensweg ich mich entscheide. Dies kann nur durch einen Wechsel der Betrachtungsperspektive geschehen. Es bedarf einer evolutionären Perspektive, in der die Selektion der zur Disposition stehenden Lebenswege vorgenommen wird. Eine solche Perspektive ermöglicht auch einen interkulturellen Vergleich von Lebensformen.
Anmerkungen 1 H. Schnädelbach, Reflexion und Diskurs. Fragen einer Logik der Philosophie, Frankfurt am Main 1977, S. 223. 2 Ebd., S. 226. 3 Ebd., S. 228. 4 A. Ulfig, Lebenswelt, Reflexion und Sprache. Zur Thematisierung der Lebenswelt in Phänomenologie, Existenzialontologie und Diskurstheorie, Würzburg 1997. 5 vgl. zu einer kognitiven Semantik: G. Preyer, “Sprachbedeutung ohne Regelbefolgung”, erscheint 1997. 6 H. Schnädelbach, op. cit. 1977, S. 183. 7 Ebd., S. 234. 8 Ebd., S. 236. 9 Ebd., S. 241. 10 Ebd., S. 246. 11 E. Tugendhat, Vorlesungen zur Einführung in die sprachanalytische Philosophie, Frankfurt/M 1976, S. 335f. 12 Ebd., S. 336. 13 H. Schnädelbach, op. cit. 1977, S. 249. 14 Vgl. P.W. Taylor, Normative Discourse, Englewood Cliffs 1961. 15 H. Schnädelbach, op. cit. 1977, S. 276.
Stufen der Rechtfertigung
223
1 I acknowledge that the account of rationality I am using probably is inadequate as a way of fully capturing individual practical rationality. What is important for my purposes, however, is, as Jordan Sobel writes in “Utility Maximizers in Iterated Prisoner’s Dilemmas,” Dialogue (March, 1976) p. 38-53: ...whether or not and if so how utility maximization is inadequate as a conception of individual rationality cannot presently be settled by showing how it is inadequate in what, on the face of it, is a quite different and possibly unrelated way, namely, as a basis for communal life. 2 Fred Feldman, “On the Advantages of Cooperativeness,” Midwest Studies in Philosophy, Volume XIII, (1988) p. 309. 3 Ibid. p. 309. 4 Robert Axelrod, The Evolution of Cooperation ( New York, 1984) 5 Peter Danielson, “The Moral Significance of Tit For Tat, “ Dialogue 25 (1986) p. 449-470. 6 Peter A. French, Responsibility Matters (Lawrence, KS, 1992) Chapter 2. 7 Peter Danielson, Artificial Morality (London, 1992) p. 46. 8 David Gauthier, Morals By Agreement (Oxford, 1986). 9 Ibid. 10 Danielson, Artificial Morality (London, 1992) p. 89. 11 Danielson provides tables to show how the tournament tests will come out. See, Ibid. p. 99. 12 Of course, in the bellicose moments that precede the game both participants threaten not veering and proclaim with loud assurance that the other will chicken out as the fateful moment approaches. 13 Danielson, Artificial Morality, Chapter 9. 14 Ibid. p. 196. 15 Feldman, p. 321.
224 16 see Peter A. French, Corporate Ethics (Fort Worth, 1995) p. 85-87. 17 Hilary Putnam, Meaning and the Moral Sciences (London, 1978) p. 63. 18 Peter A. French, The Scope of Morality (Minneapolis, 1979) p. 151-153. 19 Immanuel Kant, The Doctrine of Virtue, trans. by M.J. Gregor (Philadelphia, 1964) p. 23
1 Wenn McCulloch (1995) in seiner Einleitung behauptet, eine Form des cartesischen Internalismus bilde die Hauptströmung innerhalb der Philosophy of Mind, kann er sich damit nur auf alle Positionen beziehen, die nicht seine ‘ontologische’ Variante des Externalismus vertreten. Vgl. u. im Text. 2 Solche Gegenüberstellungen haben natürlich immer etwas Künstliches an sich, können nie ganz trennscharf sein und nicht alle Teilnehmer der Debatte lassen sich zweifelsfrei zuordnen. Trotzdem erscheinen sie mir hilfreich, will man die Motivation der verschiedenen Externalismus-Konzepte verstehen, zumal nichtrepräsentationalistische Theorien per definitionem externalistisch sind, läßt man eliminative und rein syntaktische Theorien außer acht. 3 Der Ausdruck ‘intentionalistisch’ wird hier im wesentlichen bedeutungsgleich mit ‘repräsentationalistisch’ verwendet, wenn es auf das Mentale Bezug nimmt. Die Bezeichnung ‘individualistisch’ wird von Sterelny, nach dem Vorbild Burges, gleichbedeutend mit ‘internalistisch’ verwendet. 4 Auf das Problem, mit dem Sterelny zu kämpfen hat, ist schon häufig hingewiesen worden: Letztlich kann jedes System jede funktionalistische Beschreibung erhalten. 5 Das Gegensatzpaar ‘wide content’ vs. ‘narrow content’ bezeichnet zwei Arten repräsentationalen Gehalts eines mentalen Zustandes und ist vor allem von Fodor in zahlreichen Arbeiten thematisiert worden. ‘Wide content’ ist dabei der nach externalistischer Theorie zugeschriebene Gehalt, ‘narrow content’ ist der mentale Gehalt, den ein Erdenbewohner und sein Zwilling auf Zwillingserde teilen können. ‘Wide content’ ergibt sich als ‘Funktionswert’ aus ‘narrow content’ und der jeweilig verschiedenen Umwelt. 6 Semantik ist dann atomistisch, wenn die Bedeutung einer Repräsentation nicht von den Bedeutungen anderer Repräsentationen abhängig ist, d.h. wenn sie nicht holistisch ist.
Stufen der Rechtfertigung
225
722Diese Fregedeutung liegtvgl. in FN Fodors Eine psychologisierende These, die eigene Probleme aufwirft, 16. spezifischem Ansatz begründet. Da auch Fodor gerne Schwierigkeiten von ‘Propositionen’ spricht, wäre es Autorität allerdingsresultieren wünschenswert, er würde deren Status 23 Bilgramis mit erstpersönlicher allerdings in stärkerem Maße näher erörtern. aus dem - an Davidson orientierten - strikt drittpersönlichen Ansatz, den er verfolgt, als aus seinem 8Externalismus. Vgl. hierzu Kap. 5 in Jerry A. Fodor: A Theory of Content. And Other Essays, Cambridge, Massachusetts & London 24 Donald Davidson: “A1992. Nice Derangement of Epitaphs”, in: Ernest Lepore (Hg.): Truth and 9 Daß eine solche, philosophisch letztlich nicht befriedigende, Problems für einiges Interpretation. Perspectives on the Philosophy of Donald Umgehung Davidson, des Oxford & Cambridge, Mißfallen sorgt,1986. kannDaß nicht Siehe McCulloch (1995), S. 182,Aufsatz FN 3, wo er Fodors Massachusetts dieüberraschen. Kombination mitetwa den Ausführungen in diesem sinnvoll und Position alsist, “uncharacteristically bezeichnet. intendiert betont Davidson desperate” selbst in: “Reply to Bernhard Thöle”, in: Ralf Stoecker (Hg.): Reflecting Davidson. Donald DavidsonistResponding to an International Forum of Philosophers, 10 Mit ‘historischer Externalismus’ hier eine Theorie nach Art Millikans gemeint: Die Berlin einem & New York 1993, S. 248-250. jetzigen internen Zustand vorangehenden externen Zustände eines Subjektes und deren Ursachen
bestimmen dessen mentalen Gehalte; identische Subjekte“First-Person mit verschiedener Geschichte 25 Eine derartige Kritik findet sichzwei z.B.intern in: Kirk A. Ludwig: Knowledge and können verschiedene mentale Gehalte haben. Siehe & hierzu v.a. Ruth Millikan: Thought, Authority”, in: Gerhard Preyer, Frank Siebelt Alexander Ulfig (Hg.):Language, Language, Mind and Other Biological Categories, CambridgePhilosophy, 1984. Epistemology. On Donald Davidson’s Dordrecht, Boston & London 1994, S. 367-398. Vgl. auch Dretske: meine diesbezügliche Zeitschrift philosophische Forschung 49 (1995), S. 63611 Fred Explaining Rezension Behavior. in: Reasons in afürWorld of Causes, 3. Aufl., Cambridge, 642. Massachusetts & London 1992. 26 Davidson: Mythos des Subjektiven. Philosophische übers. hg. v. Joachim 12 Donald Daniel C. Dennett:Der “Real Patterns”, The Journal of PhilosophyEssays, 89 (1991), S. & 27-51. Vgl. auch: Schulte, [Reclam-Universal-Bibliothek Nr.in: 8845] Michael Stuttgart Quante: 1993. “Rationalität Zement des Geistes?2, Axel Wüstehube (Hg.): Pragmatische
Rationalitätstheorien. StudiesRichtung in Pragmatism, and Philosophy of Mind, Würzburg S. 27 Eine Kritik in diese bietet: Idealism, Eva Picardi: “First-Person Authority and 1995, Radical 223-268. Interpretation”, in: Ralf Stoecker (Hg.): Reflecting Davidson. Donald Davidson Responding to an International Forum of Philosophers, Berlin &sei New 1993, S. 197-209. Inbesonders seiner Antwort auf 13 Zum Problem mentaler Verursachung aufYork die empfehlenswerte, an dieser Picardi zeigt Davidson sich übrigens sehr unsicher, ob ihmvon eineKim Klärung erstpersönlicher Schwierigkeit orientierteselbst Einführung in die Philosophie des Geistes hingewiesen: Jaegwon Autorität gelungen ist. Boulder, Colorado & Oxford 1996. Vgl. auch: Michael Quante: “Mentale Kim: Philosophy of Mind,
Verursachung. Die Krisis des nicht-reduktiven Physikalismus”, Zeitschrift für philosophische hier Davidson eine Ausnahme. Seine Position ist sicherlich zwiespältig.Forschung Er selber 28 Vielleicht bildet 47 (1993),wie S. 615-629. Eineseinem weitere, nicht nur in dieser Hinsicht aufschlußreiche Einführung schient, gesagt, mit Klärungsversuch nicht recht zufrieden. Johannes Brandl: bietet: “How Samuel Guttenplan: “An Essay on Mind”, ders. (Hg.): Companion to the Philosophy of Mind, Relational Are Davidson’s Beliefs?” in: Ralfin: Stoecker (Hg.):AReflecting Davidson. Donald Davidson Oxford & Cambridge, Massachusetts S. 1-107. Responding to an International Forum1994, of Philosophers, Berlin & New York 1993, S. 175-193 z.B. rekonstruiert 14 Vgl. FN 2. Davidsons Position als explizite Ablehnung des üblichen Begriffs erstpersönlicher Autorität. 15 Für eine Auseinandersetzung mit McDowells Ansatz siehe: Marcus Willaschek: “Die Für Verbesserungsvorschläge zu früheren Fassungen des Textes danke ich Michael Quante und Wiederentdeckung der Welt als Gegenstand der Erfahrung. Bemerkungen zu John McDowells ‘Mind Andreas Vieth. and World’”, Allgemeine Zeitschrift für Philosophie 21 (1996), S. 163-174. 16 Der Begriff ‘Phänomenologie’ wird von McCulloch nicht im Sinne Husserls verwendet. Er bedeutet bei ihm vielmehr das, was unserem alltagspsychologischen Vorgehen und Empfinden immanent ist. 17 Zuletzt in: John Searle: The Redsicovery of the Mind, Cambridge, Massachusetts & London 1992. 18 Wie oben dargelegt gilt dies natürlich auch für die Theorie McDowells. Dieser bietet aber zumindest einen Hinweis auf eine mögliche Lösung, indem er auf das Konzept der ‘zweiten Natur’ bei Aristoteles und die menschliche Fähigkeit der Spontaneität verweist. 19 Siehe z.B. Jerry A. Fodor & Ernest Lepore: Holism. A Shopper’s Guide, Cambridge, Massachusetts & Oxford 1992. 20 Es scheint eine berechtigte Frage, wie dieser dann allgemein zugänglich sein kann. 21 Steve Edwards: Externalism in the Philosophy of Mind, Aldershot, Brookfield u.a. 1994, FN 16, S. 27. Das Buch bietet im übrigen eine enorm hilfreiche Einführung in die Problematik und verschiedenen Motivationen von Externalismus und Internalismus. Edwards selber ist vor allem am Problem mentaler Verursachung interessiert und vertritt, in Anlehnung an C. Macdonald, eine typenexternalistische Theorie psychologischer Zustände in Verbindung mit einer tokenphysikalistischen Identitätstheorie.
226
CONCEPTS OF PRACTICAL RATIONALITY
Peter French Rationality and Ethics
abstract The “Why be moral?” problem has been one of the more persistent problems of ethics. The problem is typically posed as a conflict between what is straightforwardly maximal for a person to do in specific circumstances and what is recommended by the principles or rules of ethics, usually what is communally optimal, in those circumstances. Typically ethicists try to convince us that both collectively and individually we will be better off in the long run if we each adopt cooperative strategies despite the temptations of immediate profit offered by straightforward maximization policies. After reworking the notion of “straightforward maximizer” such that it makes sense to say that I may sometimes have rationally good reasons to perform actions that do not in the circumstances, taken individually, maximize my utility just so long as the best-for-me accessible-to-me possible world is realized, I am able to show why it is the case that in social interactions that mirror iterated Prisoner’s Dilemmas the constraints of ethics on straighforward maximization are redundant. The policy of straighforward maximization that I defend is more flexible that one of cooperation. It reaps the benefits of cooperation when they are to be had and avoids the disasters of cooperation that lurk in every meeting one has with potentially treacherous strangers. Where the policy of straightforward maximization departs from the ethical choice, I argue, it does so because making that choice would be scrificial, supererogatory, even from the moral point of view. Acting ethically by constraining one’s straighforward maximinzation therefore cannot be rationally justified. 1. One of the more persistent problems of ethics has been the one framed by the question “Why be moral?”. The problem is typically posed as a conflict between what is straightforwardly maximal for a person to do in specific
Rationality and Ethics
227
circumstances and what is recommended by the principles or rules of ethics, usually what is communally optimal, in those circumstances. A considerable amount of ink has been expended on trying to provide reasons why one should generally adopt the moral point of view, act in a cooperative manner, even when it appears not, within the foreseeable future, to have self-maximizing payoffs. Typically ethicists try to convince us that both collectively and individually we will be better off in the long run if we each adopt cooperative strategies despite the temptations of immediate profit offered by straightforward maximization policies. Suppose that I have a neighbor with whom I am engaged in an Iterated Prisoner’s Dilemma situation. It is not important to spell out the specifics of the situation. Suffice it to say that each of us has two choices, (1) to cooperate and (2) to not cooperate, every time we meet. Thankfully, we do not meet often. Each time we meet the moves and associated payoffs for each of us are as follows: If we cooperate, we can achieve a Pareto optimal outcome in which we both gain something. If we both chose not to cooperate, we will both lose an equal amount, but each of our loses will be less than will be suffered by one who decides to cooperate when the other decides not to cooperate. In such a case the noncooperator will gain much more than what he can get from the joint cooperative action and the cooperator will lose more than he will lose if both do not cooperate. The number of meetings we have does not alter the payoffs for each of us on each meeting. They remain the same on the tenth meeting as they were on the first. Suppose further that you are my good friend and that you want the best for me. I ask for your counsel as to what sort of policy to adopt regarding my choices when I confront my neighbor, and I assure you that I will abide by your advice. What policy do you urge me to adopt, one of straightforward maximization or cooperation? “Why be moral?” is supposed to arise because the action endorsements of a policy of straightforward maximization and those of cooperation are not thought to coincide in a significant number of circumstances. If, or rather when, they diverge, the cooperative policy seems not to be sufficiently selfrecommending to override the motivation of maximization. Some further persuasion to do the cooperative thing is apparently needed and rational
228 persuasion must be ruled out by the very statement of the problem in the first place. After all, if one could be rationally persuaded to always be cooperative, the “why be moral?” problem would evaporate. Non-rational persuasions, however, tend to be coercive and that, many will tell us, is not in itself morally justifiable. In fact, on some accounts, Kant’s famously, if one has to be coerced into being moral, one gets no credit for the cooperative deeds one performs. Truly good people are those whose goodness flows from a good will. Kant, of course, thought that there was a rational basis for morality and so the problem was for him, in the end, a pseudo one. For most of the rest of us the conflict between a personal policy of straightforward maximization and one of cooperative adherence in a number of situations seems to have no satisfactory resolution that moralists will sanction. 1 The policy of straight-forward maximization usually is formulated in a way that enjoins a person to perform an action if and only if no alternative has a higher utility for that person in the circumstances. As Fred Feldman has noted2, such a policy runs into difficulty when it is applied to complex actions. A complex course of action considered as a whole may satisfy the policy, while elements of that course, specific individual actions considered seriatim, may not maximize utility for the person. If you recommend a straight-forward maximization policy to me, and my Iterated Prisoner’s Dilemma relationship with my neighbor is seen as a complex action in which a certain course will yield maximization but individual actions in the course will not, what should I do? Should I disdain the course by not performing the individual nonmaximizing actions, or should I accept the shortfalls on the specific actions and stay the course for overall maximization? You might recommend a general rule favoring maximization over the long haul, shifting the evaluation of the individual cases to the evaluation of the course of action or the practice. (This would be comparable to the move made by rule utilitarians to avoid a similar problem with act-utilitarianism.) One thing seems, however, clear: your recommendation to me to adopt a policy of straightforward maximization generates no clear endorsement for me if I rightly perceive myself to be in a complex action situation. You could, however, reformulate the policy of straightforward maximization for me and alleviate the problem.
Rationality and Ethics
229
Suppose you offered me something like Feldman’s version of the policy of straightforward maximization. He writes: I prefer to think that, at each moment of choice, there are several possible worlds “accessible” to the agent...Instead of judging actions by appeal to the values of their outcomes, I prefer to judge them by appeal to the values of the accessible possible worlds in which they are performed.3 The idea is that I am to imagine the possible worlds accessible to me at any time as the maximal courses of action open to me at that time. If I perform all of the actions in one of those courses of action, that possible world will be actualized for me. Each of these worlds may be evaluated on the basis of my “welfare-level” (Feldman’s term) in that world. If I am to be a straight-forward maximizer, I will always behave as I do in the best-for-me of the accessible-tome worlds. Another way of putting this is to say that this version of the policy tells me that there is a rationally good reason for me to do y, if y is a part of a course of action that, if all of the actions in that course are performed by me, the possible world that is best for me will be actualized. I will have a rationally good reason to do y if I have determined which possible worlds are accessible to me and, on evaluating them, have identified the course of action that includes y as the bestfor-me course of action. So, as a straightforward maximizer, I may sometimes have rationally good reasons to perform actions that do not in the circumstances, taken individually, maximize my utility just so long as the best-for-me accessible-to-me possible world is realized.
2. Acting ethically, on a number of well-known accounts, essentially involves accepting constraints on the straightforward maximizing of one’s own interests in social interactions when such maximizing will not produce Pareto optimal outcomes, that is, when cooperation and mutual benefit will not otherwise occur. In its basic form, to be ethical is not to use persons as mere means to one’s gains even when that appears to be what the policy of straight-forward maximization counsels in the circumstances. My acting cooperatively, however, can be rationally justified only if producing a Pareto optimal outcome between
230 me and my neighbor is a part of a course of action that maximizes my utility or is incidental to such a maximization. Remember that the situation in which I find myself with my neighbor is of the type generally referred to as an Iterated Prisoner’s Dilemma. The standard argument, following the work of Robert Axelrod4, has been that if Prisoner’s Dilemma is played over and over by the same players, a strategy that is not apparently straightforwardly maximizing will recommend itself to the person who has adopted the policy of straightforward maximization. That strategy is Tit For Tat. A Tit For Tatter in Iterated Prisoner’s Dilemma cooperates on the first move and then plays whatever the other player has played on the previous move. So, if the Tit For Tatter’s opponent does not cooperate in response to a cooperative move, on the next move the Tit For Tatter will not cooperate and will continue not cooperating until the other player responds with a cooperative move. Peter Danielson once praised Tit For Tat as a basic ethical principle,5 and I agreed with him.6 It certainly seems to be “an impartial, mutually beneficial principle.” At least it has that effect in Iterated Prisoner’s Dilemma. But all is not as it appears. Consider again Feldman’s reworking of the notion of straightforward maximization in terms of the accessible-to-me possible worlds in Iterated Prisoners Dilemma. The Tit For Tat strategy seems to require me to make moves that, were they evaluated in isolation, would be judged irrational because they are not utility maximizing. Still, they are integral elements of a complex action that will maximize utility for me. The rationality of the actions (or plays) that are a part of the complex should be evaluated in terms of an appeal to the values of the accessible-to-me possible world to be actualized by my adopting the Tit For Tat strategy. A Tit For Tatter in Iterated Prisoner’s Dilemma is straightforwardly maximizing, because using that strategy, as tournament results purportedly demonstrate, actualizes the best-for-me world of the accessible-to-me worlds in the extended circumstances of iterated plays. Of course, it might be thought that Tit For Tat is also a basic ethical principle that happens to be the straightforward maximizer’s preferred strategy in Iterated Prisoner’s Dilemmas. The ethical person, it might be imagined,
Rationality and Ethics
231
chooses Tit For Tat because its choice flows from a good will. A nice idea, but if we look closely we will see that Tit For Tat fails to qualify as an ethical principle in the first place. It does not require me to constrain my attempt to maximize my utility. Its appeal to me will be that by adopting it I will stand a better chance of realizing the best-for-me accessible-to-me possible world in the circumstances of the extended game. That is hardly an appeal that will be confused with an ethical one. Danielson now concedes, “TFT [Tit For Tat] is not a moral principle because in Iterated Prisoner’s Dilemma it is straightforwardly in the agent’s interests.”7 You will recommend Tit For Tat to me because it has proven to be the most likely strategy to maximize my gain where the accessible-to-me possible worlds are limited by the context of the iterated game. With David Gauthier8, we should agree that Tit For Tat does not therefore really constrain the person who plays it. You will recommend it to me just because my adoption of it as a strategy in dealing with my neighbor will be beneficial to me. Assuming, of course, that my neighbor is not a saint who cooperates for its own sake, but is also motivated by rational self-interest, no other strategy offers me as good a likelihood of actualizing the best-for-me accessible-to-me outcome. You will counsel me to straightforwardly maximize and, that will mean, play Tit For Tat. The intriguing result of reexamining the Tit For Tat strategy in this light is that it exposes the fact that in social interactions that mirror Iterated Prisoner’s Dilemmas ethics is not needed to produce Pareto optimal (best-for-us) outcomes of the accessible-to-us possible worlds. Straightforward maximizing by the persons involved in those situations will produce the optimal results for all without the importation of ethical constraints and all of the accompanying moralizing. Straightforward maximizers choosing Tit For Tat will stabilizes into a cooperative relationship without the need of ethical enticements. The constraints of ethics on straightforward maximization are redundant in these types of cases. The so-called ethical solution of Iterated Prisoner’s Dilemma is not really ethical at all. To achieve the ethically preferred outcome players do not have to impose on themselves consideration of the interests of others. If they just act on principles of maximizing their own interests, the cooperative
232 outcome will materialize. In these contexts, ethical egoism, despite what we have heard from some ethicists, is not self-defeating. You, who are looking out for my interests, will recommend it to me in my dealings with my neighbor. 3. Life, of course, is not filled only with social interactions that mirror Iterated Prisoner’s Dilemmas. Not infrequently, for example, we confront single play Prisoner’s Dilemmas. Suppose I find myself in such a situation with a stranger and again call upon you for advice. What is the best-for-me action in such circumstances? Should I cooperate or not cooperate? We are usually told, that an ethical person will cooperate while the straightforward maximizer will not. Of course, if the stranger is also a straightforward maximizer both of us will not do well in the interaction, though we will both individually do better than either would if he or she cooperated and the other did not. Still we will not achieve a Pareto optimal outcome as long as we both fail or either one of us fails to cooperate. So in single play Prisoner’s Dilemma there does seem to be a chasm between what straightforward maximization and what ethics recommends. After all, it hardly seems rational for me to commit to cooperating with the stranger when that just sets me up to be preyed upon by her. Can cooperation in a single play Prisoner’s Dilemma type interactive situation ever be the rational move for you to counsel me to make? You could argue that Gauthier’s principle of constrained maximization will preserve both the rational and the ethical element in such interactions.9 Were I to adhere to it, I would cooperate in single play Prisoner’s Dilemmas with those I believe are most likely to cooperate with me. How will this stranger act? I cannot base my estimate of the likelihood of her cooperating on previous experiences with her. She is, after all, a stranger. Danielson argues that Gauthier’s principle, which, with him, we can call “conditional cooperation,” does not fare as well rationally as the principle Danielson calls “reciprocal cooperation.” The principle of reciprocal cooperation tells us to “cooperate when and only when cooperation is necessary and sufficient for the other’s cooperation.”10 The difference between the two principles is that Gauthier’s principle is used to induce others to cooperate, while Danielson’s principle has player’s
Rationality and Ethics
233
constraining themselves when they must to get cooperation from others. Tournament results of playing these two strategies against each other and against those who always cooperate (unconditional cooperators) and those who never cooperate (unconditional noncooperators) seem to support Danielson’s claim. Reciprocal cooperators do better over all.11 There is a difference between reciprocal cooperation and straightforward maximization that warrants mention, though the recommendations of both diverge in a remarkably small number of cases. The reciprocal cooperator is a straightforward maximizer in all non-Prisoner’s Dilemma situations and in all Prisoner’s Dilemma situations in which the stranger will not make the cooperative move regardless of what the player does. In the case where it is perceived to be likely that the stranger will be cooperative, the reciprocal cooperator departs from straightforward maximization and cooperates. If you are counseling me, do you recommend I shift from being a straightforward maximizer to a reciprocal cooperator? If you have my best interests at heart, I do not think that you do. The reciprocal cooperator does not do better than the straightforward maximizer. As the two will be indistinguishable in all but the case where the stranger will cooperate if I do, that is the only type of case you need to consider. There seem to be two ways in which the stranger’s decision to cooperate might occur. In the first, the stranger has decided to act cooperatively but only if I do, and in the second the stranger will act cooperatively regardless of whether or not I do. In the first type of case, Pareto optimality will be achieved, if I cooperate, and straightforward maximization counsels cooperation because I cannot do better than I can by cooperating. In the second case, the stranger will cooperate regardless of what I do. In that case, you will recommend that I not cooperate, for I will then gain significantly at the stranger’s expense. But the reciprocal cooperator will cooperate in the second case and gain less than the straightforward maximizer. So I will gain more by being a straightforward maximizer in the only case in which the adopting of one or the other of the strategies will yield a different result. A further point: both the straight-forward maximizer and the reciprocal cooperator will exploit unconditional cooperators, by not cooperating with them because they do not have to cooperate to get them to do so. Gauthier’s
234 conditional cooperators will not exploit the unconditional cooperators. It looks as if conditional cooperation is at least more ethical than reciprocal cooperation and it is certainly more ethical than straightforward maximization. It should be recommended by you if you want me to do well while doing good. However, that is not your assignment. You are just to look after my interests. But it is worth considering. After all, if I can be good while not compromising many of my opportunities to do what is best for me, that may be a decided benefit to my sense of well-being. Conditional cooperators, however, are not so morally righteous, as may first appear. They will cooperate with reciprocal cooperators, so they will not protect the unconditional cooperators from the reciprocal cooperators. They will stand by when they are exploited. 4. Prisoner’s Dilemma situations (whether or not they are iterated), of course, do not exhaust social interactions that can be profitably mirrored in game theoretical models. The game of Chicken was played where I was a teenager by two guys driving cars on a narrow road directly at each other. The loser of the game was the one who first veered off the straight course. If neither veered, the two cars crashed. I admit to engaging in this entertainment on only one occasion. I still remember the surge of excitement and anxiety it produced. The whole business was made worse, or better, by the crowd that gathered to cheer the winner and scorn the loser. In my case, the event was declared a tie. Both my opponent and I simultaneously decided to veer off on our respective sides about 12 feet from a collision. The possible payoffs in Chicken-type interactions are different than those in Prisoner’s Dilemma. The major variation is that if neither player cooperates in Chicken, if both continue on the collision course, they both achieve the worst possible outcome in the game. Yet, if I do not veer and the other person does, I gain the best outcome available in the game. But the loss I take for veering is no where near as great as the one I suffer if neither of player veers.12 In social interactions involving threats, such as those modeled by the game of Chicken, Danielson maintains that a cooperative strategy that is less broad than reciprocal cooperation will be rational.13 The less broad cooperator will
Rationality and Ethics
235
concede only to unconditional noncooperators in Chicken-type interactions, while refusing to go along with the threats of any other ethically constrained players. My opponent and I both were convinced that the other was an unconditional noncooperator. But does less broad cooperation in Chicken-type encounters yield different results than would adoption of a Feldmanesque straightforward maximization policy? I think not. In fact, they yield identical results. Nonetheless Danielson writes: [I]nstrumental rational agents...must limit the class of agents with which they share co-operative benefits...depending on the context, they must be able at least to identify other co-operators, or similarly constrained players or, in Chicken, unreasoning threateners...[O]ne way to do this is by means of transparently public principles, which others can test and copy.14 5. Although I have no idea how the required transparency is to be anything more than superficially accomplished, suppose I am transparent to those with whom I interact in, at least, negotiable situations of a Prisoner’s Dilemma sort. I meet a stranger who is perceptive enough to see through me to my policy and who can therefore discern how I will act during our meeting. I will not be able to bluff, lead her on into thinking I will be cooperative, and then turn the tables at the propitious moment. If I adopt straightforward maximization, she will know that and can guard against my gaining the advantage on her by insuring that I get no opportunity to maximize at her cost. If I decide to be a cooperator (of whatever sort) she will discern that and can act accordingly. Gauthier seems to think that if the stranger knows I am guided by straightforward maximization, I will not be able to benefit from mutually advantageous cooperation with the stranger. She will just not cooperate. The best I could hope for is the mutually disadvantageous situation in which neither of us cooperate. If, however, the stranger recognizes me as a cooperator, she might very well choose also to cooperate and the Pareto optimal outcome will be achieved by us. It seems as if the transparency condition cries out for the adoption of a cooperative rather than a straightforward maximizing policy. But is that really the case?
236 Recall again that on the Feldmanesque interpretation straightforward maximization is understood in terms of the best-for-me of the accessible-to-me possible worlds. To determine what is the best-for me of the accessible-to-me possible worlds, you need to examine my situation vis a vis that of the stranger. First of all, you know that I am transparent, the stranger knows this and is able to discern my policies, but how will the stranger behave? The stranger might be disposed to cooperate if I do. Because I am transparent, I cannot exploit the cooperative move of the stranger, so the best-for-me possible world is the one in which I cooperate and the stranger responds in kind, having been disposed to do so if she ascertains that I am cooperative. So, in Feldman’s terms “it is wrong to suppose that people whose behavior is guided by straightforward maximization will not be able to enjoy the benefits of cooperation.” 15 The other possibility would be that the stranger is disposed to take advantage of me, that is, in the end to not cooperate despite feigning cooperation. As I am transparent, I cannot mislead the stranger as to my actual policy, so the best-for-me of the accessible-to-me possible worlds in the situation is to not cooperate and thereby avoid the greater loss. That is what straightforward maximization will recommend. That is what you should recommend to me. The policy of straightforward maximization is more flexible than one of cooperation. It reaps the benefits of cooperation when they are to be had and avoids the disasters of cooperation that lurk in every meeting I have with potentially treacherous strangers. You should not counsel me to be a cooperator even if I were transparent, despite the entreaties of those who write books and articles on moral motivation. But what would happen if both the stranger and I were transparent with respect to the policies that govern our choices of action? The simple answer is that we should both adopt Feldmanesgue straightforward maximization and we will cooperate, just as the ethicists would like us to behave. Of course, I think we will never have to confront the transparency conditions in ourselves or other humans, though it is possible and probably desirable that we design our institutions and corporations to be transparent.16 Hilary Putnam reminds us of the fantasy of the game theorist’s interest in transparent players. He writes:
Rationality and Ethics
237
Suppose our functional organization became transparent to us. Suppose we had a theory of it, and we could actually use this theory in a significant class of cases. What would happen to us?...Would it be possible to have friendships or hostilities? Would it be possible to even think of oneself as a person? I don’t know the answer to these questions, but it seems clear that the development of that sort of knowledge of ourselves and each other would modify our natures in ways that we cannot predict at all. Every institution we now have: art, politics, religion - even science would be changed beyond recognition. But a fact, however ‘empirical’, which underlies our entire history and which influences the character of every one of our institutions is not ‘mere’. The fact that we are partially opaque to ourselves, in the sense of not having the ability to understand one another as we understand hydrogen atoms, is such a fact, a constitutive fact.17 6. The point of all of this is that the “Why be moral?” question is much more difficult to answer than some have supposed. There are no good rational reasons to be moral, if being moral is defined in terms of steadfastly constraining straightforward maximization in favor of adopting cooperative policies for the sake of the cooperative outcomes to be realized. Not only do straightforward maximizers of the Feldmanesque variety do better than cooperators, they usually do what ethics would recommend. Where they depart from the ethical choice, they do so because making that choice, adopting that policy, would be sacrificial, supererogatory, even from the moral point of view. In the Scope of Morality I wrote: ...None of us individually may have a good prudential reason in specific cases to be either moral or kind that is better than the good reasons we have to be purely self-interested. In other words, if “reasonableness” is defined in terms of utility maximization (which does not seem prima facie objectionable), then any individual choosing to do the moral act, eschewing the prudential act, is usually doing an unreasonable thing...Although one may have a self-interested reason to do what there is a moral reason to do, from the point of view of rationality one cannot have only a moral reason to do what there is a moral reason to do that is better than the prudential reason one has to do something else in that instance...An unbridgeable gulf remains between what is reasonable (as
238 utility maximization) for the individual to do and what morality often demands...In no individual case would it seem that acting discordant with morality involves risks greater than ostracism. Indeed, the greater personal risks are run in acting morally.18 I am still convinced that the gulf is unbridgeable and that acting ethically by constraining one’s straightforward maximization cannot be rationally justified. Such acts are heroic and as such they cannot be morally obligatory. Perhaps the Feldmanesque straightforward maximizer in certain cases, in Kantian terms,19 lacks moral strength and even wants for some virtue, but he or she cannot be faulted from the point of view of rationality and you would not be meeting your obligation to me to look after my interests, were you to advise me to shun straightforward maximization and adopt a personally risky, even if morally admirable, cooperative policy.
Notes 1 I acknowledge that the account of rationality I am using probably is inadequate as a way of fully capturing individual practical rationality. What is important for my purposes, however, is, as Jordan Sobel writes in “Utility Maximizers in Iterated Prisoner’s Dilemmas,” Dialogue (March, 1976) p. 38-53: ...whether or not and if so how utility maximization is inadequate as a conception of individual rationality cannot presently be settled by showing how it is inadequate in what, on the face of it, is a quite different and possibly unrelated way, namely, as a basis for communal life. 2 Fred Feldman, “On the Advantages of Cooperativeness,” Midwest Studies in Philosophy, Volume XIII, (1988) p. 309. 3 Ibid. p. 309. 4 Robert Axelrod, The Evolution of Cooperation ( New York, 1984) 5 Peter Danielson, “The Moral Significance of Tit For Tat, “ Dialogue 25 (1986) p. 449-470. 6 Peter A. French, Responsibility Matters (Lawrence, KS, 1992) Chapter 2. 7 Peter Danielson, Artificial Morality (London, 1992) p. 46. 8 David Gauthier, Morals By Agreement (Oxford, 1986). 9 Ibid. 10 Danielson, Artificial Morality (London, 1992) p. 89. 11 Danielson provides tables to show how the tournament tests will come out. See, Ibid. p. 99. 12 Of course, in the bellicose moments that precede the game both participants threaten not veering and proclaim with loud assurance that the other will chicken out as the fateful moment approaches. 13 Danielson, Artificial Morality, Chapter 9. 14 Ibid. p. 196. 15 Feldman, p. 321.
Feeling and Coercion: Kant and the Deduction of Rights 16 see Peter A. French, Corporate Ethics (Fort Worth, 1995) p. 85-87. 17 Hilary Putnam, Meaning and the Moral Sciences (London, 1978) p. 63. 18 Peter A. French, The Scope of Morality (Minneapolis, 1979) p. 151-153. 19 Immanuel Kant, The Doctrine of Virtue, trans. by M.J. Gregor (Philadelphia, 1964) p. 23
239
240
Pierre Kerszberg Feeling and Coercion: Kant and the Deduction of Right
abstract Even though the concept of right is not empirical, Kant does not deduce right in a transcendental manner. If, in conformity with the rational principles of transcendental philosophy, we try to understand why this is so, the answer may be found in an analogy with aesthetic reflection. Indeed, aesthetic reflection might contain the transcendental ground of violence in civil society. Kant’s concept of right essentially consists in the law of external freedom, which defines a symmetrical order of coexistence for human beings living according to the spatial relations proper to each society. The law not only delimits the domain which one may reasonably consider one’s own and occupy as one sees fit, but it also authorizes one to defend one’s domain against encroachments and attacks from without. Indeed, according to Kant, right is analytically linked with the authorization of coercion: “there is connected with Right by the principle of contradiction an authorization to coerce someone who infringes upon it.”1 The authorization of constraint is thus the expression of one’s permission to defend domains of freedom which are universally compatible with one another.2 But we may nonetheless ask why Kant does not go on to deduce right, why right, though its concept is not empirical, does not in its universal principle admit of a transcendental demonstration, which would make it a necessary representation.3 The answer may be found in an analogy; it seems that an absolute distinction between the principle of right and the categorical imperative cannot be drawn, since both contain criteria of universalization that reason draws from itself. In both cases, the other is only postulated; I cannot represent the other’s freedom to myself. Each of the deductions of juridical concepts (possession, acquisition, occupation) is an analytic proof, while the juridical propositions to which these concepts contribute are synthetic because, a priori, “practical reason extends
Feeling and Coercion: Kant and the Deduction of Rights
241
itself without intuitions.”4 In this sense, the ensemble of these deductions is related to the initial impossibility of a transcendental deduction of right in its universal principle. But if the highest principle of practical reason is indeed a synthetic, a priori proposition, though one that can be only exhibited and not deduced,5 does the impossibility of a deduction in the case of the universal principle of right indicate that right is fundamentally free of any synthetic character? We are led to ask whether instead there might not be a synthetic element in right which, for reasons that remain to be seen, stands in the way of transcendental deduction. In order to establish the concept of coercion, Kant relies upon an analogy with mathematics and physics, just as he did in the case of objective knowledge. He writes: “The law of a reciprocal coercion ... is, as it were, the construction of that concept; that is, the presentation of it in pure intuition a priori, by analogy with presenting the possibility of bodies moving freely under the law of the equality of action and reaction.”6 It is perhaps the reference made to space instead of time which seems at first to justify the rejection of any a priori deduction. For example, one empirical condition to which Kant attributes an unavoidable character, a condition without which the possibility of a community of human beings would be unthinkable, is nothing else than the spherical shape of the earth; on this empirical spatial condition is based the non-empirical, juridical concept of original communal possession.7 More generally, Kant considers the state of nature that precedes the constitution of a common, public will (the social contract) as a mere idea, and not as a fact which one might assign a chronological origin in the time of history.8 Kant thus finds that though the concept of right itself cannot be presented in an intuition, this is not the case for the concept of coercion, which, however, we have just seen to be analytically linked to the concept of right. In other words, though right in its universal principle surely cannot be deduced transcendentally, there is no reason for the same to be true of coercion. While the works of Galileo and Newton were the dominant references in the analogical work leading to the transcendental constitution of knowledge, it does not seem an exaggeration to say that, in the case of right and politics, it is Hobbes who occupies this position. Is it not Hobbes who, in the modern era,
242 hopes to apply the mathematical method to political philosophy in order to transform it into rational knowledge? The problem Hobbes sought to resolve is the following: while pure mathematics never really stands in opposition to the pre-scientific lifeworld, since counting and calculating belong to both, an exact representation of the political relations between individuals, however, supposes the suppression of the everyday passions which constantly undermine them.9 For Hobbes, of course, it is a question of conceiving the passage from the state of nature to that of civil society in such a way that passions and natural opinions (essentially focused on the constant play of praise and blame) both lose their sway. In his doctrine of right, Kant presents himself as the champion of Hobbes’ doctrine: “The doctrine of Right wants to be sure that what belongs to each has been determined (with mathematical exactitude).”10 Here, the term “exactitude” refers to the delimitation of a space which admits of no exception, as would be the case in a doctrine of virtue. In fact, Kant’s reference to Hobbes is a constant throughout his work; it culminates in the 1793 text on the problematic relations at once conjoining and separating theory and practice, a text in which Kant develops a systematic critique of Hobbes. As early as the Critique of Pure Reason, Kant agrees with Hobbes that there is injustice and violence in the state of nature; the coercion of law is necessary so that the coexistence of my freedom with that of others may be a lasting one.11 Which is the determining factor which pushes human beings to accept the passage into civil society? For Hobbes, it is violence itself as an empirical fact. Of course, Hobbes does wish to rise above the most ordinary experience: as he puts it in the De Cive, this would only show that what everyone wants from society is only either utility or the strictly egotistical pleasure of glory. The fact of society does not in any way follow from these facts; at most, they can account for spontaneous assemblies of people. An extended and lasting society can have no other origin than the mutual fear human beings develop with regard to one another. Mutual fear is a higher type of experience, for it is an “inference, made from the Passions.”12 The human capacity for reasoning is thus “deduced” from this passion, since one sees it confirmed by examples which show human beings reflecting upon themselves: “...when taking a journey, he armes himselfe ... when going to sleep, he locks his dores; when even in his
Feeling and Coercion: Kant and the Deduction of Rights
243
house, he locks his chests.” Kant, however, does not allow himself to draw a concept from a passion or a feeling. The passage into civil society results instead from a conflict of feelings within the state of nature, a conflict which pushes man to move out of himself. In this regard, there is a remarkable congruence between the necessary condition for all knowledge and the properly human way of living in society; this congruence does not, however, indicate any historical evolution from one term to the other, but rather an inversion of their meaning. At the basis of all knowledge, according to critical philosophy, there lies reason’s polemic with itself, in which hypotheses can be admitted for the momentary needs of a good cause.13 For the needs for defense, we can even completely invent our weapons, which are so many opinions we leave aside once defense is secured.14 The transmutation of dogmatic into critical philosophy must go through an antinomical conflict, which is a polemic that still takes itself seriously, but which then, because of the critique, turns into a war in which one fights only with “leaden weapons.”15 It is also the evolution from barbarism to civilization which is founded on an original conflict, but the order of the terms is reversed. The distinctive character of the human condition which leads to civil society is “a certain disingenuousness” which is none other than “a disposition to conceal our real sentiments, and to make show of certain assumed sentiments which are regarded as good and creditable.” The search for an advantageous appearance (and thus for seriousness) has a civilizing effect because it keeps one from returning upon oneself; no one, in fact, can “see through the outward show of respectability, honesty, and modesty”16; I accept civil society because I take part in a game in which I seek to maintain an acceptable public appearance. Thus, as opposed to the case of knowledge, in public life falsehood wins out over truth. Without the play of feelings that pushes private conscience outside of the subject by cloaking it in the external signs of morality, individual freedom could never be recognized as the basis for a perfect reciprocal coercion attuned to the freedom of all following universal external laws; from the perspective of right, my freedom would remain a freedom in name only, for it could never receive the sanction of a public law. In the Metaphysics of Morals, Kant goes one step further. The emergence from the state of nature is a commandment of
244 reason, but one that would appear to have no basis other than the absolutely provisional acquisition of something external through occupation or contract. The civic state is comparable to the state of reflection accompanying action because it indicates “the conditions under which these laws are put into effect.”17 Though it is true that one cannot speak of a reciprocal and necessary relation between individuals before the establishment of a state of public legality, it is also true that one cannot speak of violence outside of civil society. It is as if it would be meaningless, from a transcendental perspective, to speak of violence reigning blindly in the state of nature. There, in accordance with an imperative of reason, all action always already moves in the expectation of the other’s opinion. From the perspective of right, the fact of violence cannot be ascertained through immediate experience, because it only exists once when civil society has managed to reconstruct a completely ideal meaning for it, outside the sensible mediation of the other’s opinion.18 Thus, the way is closed to a necessary deduction of right in its universal principle, because it cannot do otherwise than to transform its requisite condition (the fact of violence in the state of nature) into an undesirable consequence of the exercise of its power in civil law. The concept here conforms to the fact, which it thereby no longer understands; there is no “Copernican” perspective which could make sense of the fact in conformity to a concept. These considerations concerning the limits of a deduction of right converge with the fundamental themes of the Critique of Judgment. On the level of aesthetic experience, too, it is impossible to derive a concept from a solely private feeling. It is, of course, an imperative of reason that we leave the state of nature, but despite the absolute coercion this imperative places us under, its provisional foundation may yet waver. Such a precariousness of the absolute recalls the fundamental fragility of the aesthetic feeling, a fragility that is constantly covered over by the demand that the public necessarily assent to my private feeling. It is precisely only in the aesthetic feeling that one does not seek to exhibit feelings one does not have. It is perhaps the only kind of experience in which a priori conditions force us to live according to ideas. A reflection which aims at recovering the immediacy of contact with the singular is the inverse of the determining, temporalizing judgment because the latter already
Feeling and Coercion: Kant and the Deduction of Rights
245
possesses the universal (concept or law). In the aesthetic feeling, we encounter an expectation that is nonetheless no longer dependent on time. Someone who says “this thing is beautiful” does not simply “count on other people to agree with his judgment on the ground that he has repeatedly found them agreeing with him; rather, he demands that they agree. He reproaches them if they judge differently, and denies that they have taste, which he nevertheless demands of them, as something they ought to have.”19 In the aesthetic judgment, ignorant of the challenge that my pretension so often meets with, I attribute to all of humanity beforehand a feeling that is identical to my own; the walls separating the public from the private are razed in the moment of feeling. The work of reflection consists in transforming a feeling which at first seems private and incommunicable into something communicable, through which I take others into consideration by putting myself in their place. Even though I take the others’ points of view into consideration, it is only first to attribute to them my own feeling. I feel permitted to do violence to the other by encroaching on his judgment because through him I only ever address myself to all others, to the humanity which while it resides in him, also exceeds his person as well as mine. The other’s judgment, on which I base my own feeling, is not a real judgment, but a merely possible judgment, without which the experienced conflict between judgments would never yield to any communication.20 Doing violence to the other in this way (in the idea only, in the name of a humanity which is our common horizon) invariably results in a feeling of violence which must accompany every aesthetic feeling. There is in me a relationship to all of humanity, but it brings me no peace since it always exceeds me. Humanity serves as a universal (without which I could not judge at all), but one which is never initially guaranteed correspondence with the universal aimed at in reflection. This is because my aesthetic relationship with others is always only a possible relationship, not necessarily actual as in civil society. If it happens that there is even one person in the public who refutes my feeling, I undergo a shock that is all the more violent for the fact that I invest myself in my feeling, that I strive to live thereby in accordance with all of humanity. I thus find myself in direct conflict with morality, according to which I must seek to universalize the maxim of my action, in order to submit
246 to the causality of beings in the intelligible world of freedom. Do not the initial demand and the subsequent reproach proceed from the same feeling of repulsion (which is the starting point for blame), namely, the repulsion before the always only possible character of my relation to others in terms of feelings, that is, the radical incompleteness of aesthetic concern? This “always only possible” is experienced as such even in its actualization, since nothing in the challenge put to my feeling stops me from trying again. This is the strange, provisional basis (human nature) for the absolute, for a legally organized human society. Are not blame and denial, then, as the vectors of aesthetic concern, the transcendental condition for violence? If this is correct, we can explain how it is that a certain violence persists in us (whether latent or expressed) even after the laws of freedom governing the external relations of people among themselves have been promulgated. Let us now turn to the section from the 1793 text concerning theory and practice, which is presented as a systematic critique of Hobbes. Kant begins by rejecting the notion of the desire for happiness as the determinative principle of external right.21 There is no determinative end, in fact, no determination at all; we are indeed within a reflective judgment. No determination is prior to man’s capacity for reflection. This means that man is born adult; the time between the moment of his birth and the moment he reaches legally recognized maturity is of no consequence for right. Nothing about his birth makes him qualified to occupy a position of domination or to accept a servile condition.22 Kant rejects any identifiable moment of origination for the social contract, and makes the case for an “original contract, among men on which alone a civil constitution can be based, one that is thus completely compatible with right and by means of which a commonwealth can be established.”23 Such a contract is a product of the general, unified will of the people. But once again it is meaningful only on the level of mere possibility. Indifferent to the actualization of the possibility it contains, the original contract is presented as a sort of aesthetic judgment in which my feeling seems to have managed to protect itself a priori, as it were, against any challenge from others. In demanding the consent of others, I no longer indulge in the fantasy of “someone abandoned on some desolate island” who is not content “with an object unless he can feel his liking for it in a
Feeling and Coercion: Kant and the Deduction of Rights
247
community with others.”24 Not that this illusion is eradicated. Given the overwhelming task of living according to an idea of humanity which is never assured, the original contract allows one to experience the frustration that follows the repressed need for communication, that is to say, to suffer the paradox of solitude in the midst of society. Indeed, “if a public law is so formulated that an entire people could not possibly agree to it...it is not just; however, if only it is possible that a people could agree to it, it is a duty to regard that law as just.”25 Since it remains within the domain of the possible, the original contract unconditionally prohibits any physically violent rebellion against the supreme legislative power. Violent opposition to the ruler presupposes a deceptive confusion between foundation and result, condition and conditioned. While the foundation may be certain, the result of such an action is always uncertain. Violence consists in a sort of contamination of the certain by the uncertain, or of the condition by the conditioned, such that the foundations become suspended, as it were, and the original contract gets abrogated: “might [instead of right]...renders all lawful constitutions insecure.”26 The cooperative subject, Kant writes, “must be able to assume that his ruler does not want to harm him.”27 One who legitimately considers himself a victim of power should understand the ruler’s right to error and to ignorance of certain consequences of the laws. It is remarkable that Kant in no way considers the possibility of uncertainty concerning the intelligibility of the law itself. Why couldn’t a radical uncertainty be the basis of both action and judgment? After all, Kant himself admits that it is “somewhat difficult to determine what requirements a person must meet so that he can be his own master.”28 If the amount of property necessary for citizenship is left indefinite, then it seems reasonable to claim that, despite himself, Kant invests the grounds of public right with a radical uncertainty. Only a naive belief in the ruler’s benevolence (which belief is not reflective in the least and accepts the play of determination) is capable of conferring an image of stability, one that is too easily taken for a reflection of the supposed certainty of the grounds of law. As we might expect, what is at stake in the rejection of uncertainty with regard to the intelligibility of the laws is the overall consistency of the Kantian
248 project. If we pursue the question of uncertainty, however, we push the concept of right into another domain. Let us return for a moment to Hobbes’ conception of violence in the civil state. The mechanism of socialization is deduced from mutual fear, rather than from utility or egotism. This is essentially because fear is commutative and leads to the reciprocity of perspectives. This strict reciprocity, in its turn, leads “mechanically” to the explicit recognition of the general interest. Interest is distributed perfectly equally. But is this sufficient to eliminate all traces of uncertainty? Men’s equality was, in practice, already the essential characteristic of the state of nature. Hobbes deduces war, as a phenomenon proper to the condition in the state of nature, from the equality of abilities and our equal hope of attaining our ends.29 Thus, the passage into the civil state occurs without ever disturbing the principle of the equality of men. The transfer of power to the Leviathan can therefore have no other purpose than to make this passage visible. Since an individual is attributed rights and powers that place him infinitely above those who were his equals before the contract, there is no longer any cause for hostility between them and him, at least not for the hostility arising from the reciprocal presence of equal individuals. There can no longer be any question of natural violence between the sovereign and his subjects. But this system remains exposed to an entirely different kind of uncertainty, in connection with the function of visibility the sovereign fulfills. There is nothing to ensure the absence of another kind of violence: a political violence in the cases of abuse on the part of the head of state. One might then imagine another inference to be drawn from the passion for political violence; this inference would provide the basis for yet another contract designed to abrogate it, and so on. This infinite regress is based on a radical uncertainty, one which is never really affected by the social contract, but merely displaced. One might wonder why Hobbes insists that the fundamental passion which makes it possible to overcome the divergence and conflict of opinions is the fear of dying at the hands of others. Hobbes considers the object of deliberation in the contract is to remove any just reason for fear. But isn’t my life already vulnerable to a violent end in the state of nature? It seems that at the most basic level, the fear is a fear that man will stop nature from doing its work. A paradox ensues: in order to
Feeling and Coercion: Kant and the Deduction of Rights
249
face up to the expectation of death and to preserve his natural end, man gives himself over to civil society, in which an infinitely powerful Leviathan utterly supplants nature. The fear is not lessened; it is, so to speak, buried alive in homage to inalterably all-powerful nature. Mathematical rigor in the metaphysics of the passions has not really rid this power of its sacred aura. Made visible and ruled by an infinite power, civil society escapes the control of its individual subjects and takes the place of nature. This substitution is successful and even desirable, because my own death escapes me in the same way that an infinite power never really exists. In addition to allowing peace between men, the infinite power they invent is the condition of possibility for non-human nature to carry out its work. Of course, we might be reminded, with Pascal, that man authentically measures up to himself when his fear of death is fear out of danger, not in danger. But isn’t it also true, as Pascal goes on to argue, that nature makes do with the meagrest means to destroy him, for a vapour or a drop of water is enough to kill him? Kant seeks precisely to cut short any series of subordinations that stretches to infinity.30 The original contract, he writes, “[is] an infallible standard”31 for determining whether the legislator is consistent with the principle of right. Kant states that the principle of infinite regress invalidates itself: “It would be an obvious contradiction for the constitution to include a law ... giving the people the right to overthrow the existing constitution, from which all specific laws derive (even laws covering breach of contract), for it would then necessarily contain a publicly constituted opposing power.”32 Such a power would have its own leader, which would presuppose that at the origin of right one could postulate the existence of a lived contradiction between antagonistic parties who were always already there. If this were the case, then mutual coercion would have to exist before the recognition of finite domains for the exercise of freedom. The analytic principle of right, according to which coercion and finitude are simultaneous, would be ruined by this. To live within a contradiction is thus not at all the same thing as to judge according to its principle. Now, the notion of humanity in the state of nature has no transcendental significance, since a minimum of culture must be posited in advance.33 For the
250 peoples who experience a tendency towards legal society, there is always already an original difference between antagonistic parties, namely, a social difference between cultured and uncultured classes. Hence Kant’s definition of humanity as a “universal feeling of sympathy” between the classes, which shows that the difference in question is prejudicial to the possibility of conceiving a reciprocal communication between what is innermost (the private judgment) and what is most universal (the idea of humanity which permeates every judgment of this kind). This communication would thus occur in the mode of taste. This is not to say that through taste a dissociation between the orders of nature and of culture arises at a certain moment in the history of a people, as if they became aware one day of the illusion they were living under while attached to the quasi-immutable determinations of nature. Not only does the illusion remain once detected (for we constantly distance ourselves from the state of nature, precisely because this is unthinkable, resistant even to a retrospective determination), but it is also what allows us to open ourselves to the universal idea of humanity. Indeed, even when we become completely civilized, the work of reflection required to approach the idea will not be eliminated; as Kant points out, that pleasure which taste declares valid for mankind in general will remain. The indeterminable, original contradiction will always be with us, indefinitely repeated, to the same degree that taste cannot be enclosed in a concept and that its illusion cannot be mastered.34 Right reduces an original difference as much as possible. This is a difference that the movement of history, and not simply (as for Hobbes) the movement of atomic individuals in brutish nature, designates as increasingly intolerable. In an ideally civilized society, the aesthetic feeling will always provide us with a sort of supplement of humanity, a difference between humanity and itself, because this feeling directs us back to the real purpose of the violence animating all conflicts, all differences - the origin of these differences is no longer even identifiable, for it is shrouded in the depths of the past. We find a fine example in the difference between the warrior and the statesman, a difference which Kant considers universally valid, as much for the primitive as for the most civilized of men. It is not the statesman but rather the general who inspires the greater admiration in the aesthetic sense. He is a man who is undaunted, who
Feeling and Coercion: Kant and the Deduction of Rights
251
does not yield to danger, and whom one expects to “demonstrate all the virtues of peace,” because he knows no fear and does not give way to danger, but sets manfully to work with full deliberation.35 In other words, since for him living and judging are one, he is alone in being able to claim that his reflection could pass for a determination. Such is not the case for the sovereign, for whom the right to error or ignorance removes any reason for being from the prestige of visibility. Therefore, the sovereign’s function is rather to ensure the visibility of his subjects through the freedom of the public expression of opinions. This is why, in the final analysis, the only case in which rebellion is legitimate is one in which the freedom of expression has been abrogated.36 Does this imply that a knowledge (even if only ideal) of the universal bases of right allow any given public legality - provided it absolutely prohibits censorship - to avoid what Kant calls “a crime against human nature,” namely, the implementation of an immutable contract requiring mutual obligation among its members? It lies in human nature’s “proper destiny” to press the boundaries of knowledge ever further. Every age only ever lives in “expectation of a better [law].”37 Now, the condition of possibility for such progress in knowledge is nothing other than the polemical use of reason, which consists in recognizing and utilizing the power contained in inevitable illusions. The critique of pure reason begins by neutralizing the dogmatic use of hypotheses, such as one finds in the antinomical conflict of pure reason. As for the polemical use of these hypotheses, which follows the critical solution of the antinomies, it gives us to understand that in a battle of this kind, “both parties beat the air, and wrestle with their own shadows.”38 Nonetheless, there is once more something very serious lurking behind these battles which are no longer battles, behind the peace which is always yet to come because “the bloodless conquests” are an indefinitely renewable pleasure. In fact, “though a merely negative attitude toward the assertions of others may seem very modest and moderate,” that is, even if the polemical use of hypotheses is limited to a game, nonetheless “to proceed to represent the objections to an assertion as proofs of the counter-assertion is to make claims no less presumptuous and visionary than if the positive position and its affirmation had been adopted.”39 We recall that, at any place or time, showing oneself to be better than one is is an
252 essential component of civilization, because this pretension is the first way man becomes an authentically moral being. One might thus say that polemic is the way to indefinitely repeat the (indeterminable) act by which man first emerged from the barbaric state of nature. The harmless and apparently groundless games in which polemic is engaged recall the fragile nature of all pretensions (including that of knowledge), and thus of human nature in general. But doesn’t the modern era present us with the image of polemics that become deadly games, like the French Revolution and its struggle to provide itself with a new beginning to history, one which would now be conscious of itself? Kant’s ambiguity concerning this event is well-known. While he does consider violent revolutions to be wrong in every age, he cannot refrain from adopting a position which, as he puts it, “verges on enthusiasm.”40 This taking sides does not seem at all solid and secure; it gives one the impression of an aesthetic judgment unwilling to recognize itself as such. There is indeed a distance which keeps this position from taking the final step and admitting that it is simply aesthetic. Indeed, what gives the French Revolution its public significance is less the participants than the spectators who hail it without implicating themselves in it. In the case of this particular event, it is as if the judgment of the spectators was an aesthetic judgment which succeeded, as it were, precisely because it kept its distance from the place where history is made and unmade, that is, a place where I still have to fear being judged by others. Two senses of the transcendental condition of possibility follow from this connection between knowledge and right. In the critique of pure theoretical reason, we move from facts to a legitimating concept, from the original finitude of the given to the aim of dialectical reason: the infinite. In the metaphysical doctrine of right, we begin with freedom as a given infinity in order to deduce finitude: the coexistence of finite domains of freedom embodied in the sensible world. The aesthetic judgment is the underlying pivot of these two movements. As we have seen in the case of revolution, where coexistence is put into question once more, the transcendental condition of possibility of any rebellion, legitimate or not, is the aesthetic judgment, which is always at least potentially open to being abrogated (through the other’s challenge), and which is thus followed (at least ostensibly) by a rebellion against human nature.
Feeling and Coercion: Kant and the Deduction of Rights
253
Regarding the aesthetic judgment, we may say that it always verges on a “crime against human nature” as this nature is given to us; this judgment always moves in the direction of a supposedly definitive modification of this nature according to new conventions. Only the general, by reminding us of our original condition of unresolved contradiction, could succeed in converting the frustration of a failed rebellion into pure satisfaction. This exception aside (and independently of our own doubts about its accuracy), life in civil society, just as the object of an aesthetic judgment, is the outcome of a disappointed expectation.
Notes 1 Kant, The Metaphysics of Morals, tr. Mary Gregor (New York: Cambridge University Press, 1991), p.57 (Akademieausgabe vol. VI, 231). All references to the Akademie edition of Kant’s works will hereafter be given, with volume and page number, in parentheses after the English-language reference. 2 Ibid., p.69 (Ak.VI, p.247). 3 Ibid., pp.56-7 (Ak.VI, p.231). 4 Ibid., p.76 (Ak.VI, p.255). 5 Critique of Practical Reason, trans. Lewis White Beck (Chicago: University of Chicago Press, 1949), p.156 (Ak.V, p.46). 6 Metaphysics of Morals, op. cit., p.58 (Ak.VI, p.232). 7 Ibid., p.83 (Ak.VI, p.262). 8 “On the Proverb: That May be True in Theory, But Is of No Practical Use,” (hereafter “Theory and Practice”) in Perpetual Peace and Other Essays, trans. Ted Humphrey, (Indianapolis: Hackett, 1983), p.77 (Ak.VIII, p.297). 9 See L. Strauss, The Political Philosophy of Hobbes, (London: Oxford, 1936). 10 Metaphysics of Morals, op. cit., p.58 (Ak.VI, p.233). 11 Critique of Pure Reason, trans. Norman Kemp Smith (New York: St. Martin’s, 1965), p.601 (A752/B780). 12 Hobbes, Leviathan (London: Oxford University Press, 1909), I 13, p. 97. 13 Critique of Pure Reason, op. cit., p.617 (A776/B804). 14 Ibid., p.619 (A780/B808). One of these weapons is dream, though the imaginative dream is characterized elsewhere as nothing more than a sign of laziness (p.613, A770/B798). 15 Ibid., p.618 (A778/B806). 16 Ibid., p.599 (A748/B776). 17 Metaphysics of Morals, op. cit., p.124 (Ak.VI, pp.312-3). 18 Kant writes: “It is not experience from which we learn of men’s maxim of violence....On the contrary...before a public lawful condition is established, individual men...can never be secure against violence from one another, since each has its own right to do what seems right and good to [him] and not to be dependent upon another’s opinion about this” (Ibid.) 19 Kant, Critique of Judgment, trans. W.Pluhar (Indianapolis: Hackett, 1987), p.56 (Ak.V, pp.212-3).
254 20 Ibid., p.160 (Ak.V, pp. 293-4). 21 “Theory and Practice,” op. cit., p.70 (Ak.VIII, p.289). 22 Ibid., p.74 (Ak.VIII, p.293). See also “What is Enlightenment?”, in Foundations of the Metaphysics of Morals, transl. Lewis White Beck (New York: Macmillan, 1985), p.85 (Ak.VIII, p.35): “Laziness and cowardice are the reasons why so great a portion of mankind, after nature has long since discharged them from external direction (naturaliter maiorennes), nevertheless remains under lifelong tutelage.” Right cannot be grounded in the difference between tacit and explicit consent, in the sense of Locke, because this would amount to admit the prior role of ready-made determination in reflection. 23 “Theory and Practice,” op. cit., p.77 (Ak.VIII, p.297). 24 Critique of Judgment, op. cit., p.164 (Ak.V, p.297). 25 “Theory and Practice,” op. cit., ibid. 26 Ibid., p.84 (Ak.VIII, p.306). 27 Ibid., p.82 (Ak.VIII, p.304). 28 Ibid., p.76n. (Ak.VIII, p.295n). 29 Leviathan, op. cit., I 13, p. 95. 30 “Theory and Practice,” op. cit., p.73 (Ak.VIII, p.291). 31 Ibid., p.79 (Ak.VIII, p.299). 32 Ibid., p.82 (Ak.VIII, p.303). 33 Critique of Judgment, op. cit., pp.231-2 (Ak.V, pp.355-6). 34 In this connection, the reader will recall that Kant’s project for perpetual peace remains perfectly compatible with the existence of violent, bloody battles. 35 Critique of Judgment, op. cit., p.121 (Ak.V, p.262). 36 “What is Enlightenment?”, op. cit., pp.86ff (Ak.VIII, pp.36ff). 37 Ibid., p.88 (Ak.VIII, p.39). 38 Critique of Pure Reason, op. cit., p.604 (A756/B784). 39 Ibid., p.620 (A781/B809). 40 The Conflict of the Faculties, Ak.VII, p.85.
Can axiological statements be grounded in the absence of dogmatic beliefs ?
255
Raymond Boudon Une éthique est-elle possible en l’absence de croyances dogmatiques?
abstract A recurrent topic among philosophers as well as social scientists since Novalis, Comte, Weber, modern existentialists, and post-modern sociologists, etc. is that in the absence of what Tocqueville called “dogmatic beliefs” values cannot be grounded : you prefer liberty, I prefer equality; none of us would be neither right nor wrong. Contemporary writers as Rawls and Habermas defend, against this current view, the idea that value statements can be grounded rationally. Habermas’ theory of communicational rationality remains procedural, formal and on the whole mysterious, however: how can this peculiar type of rationality be definied and made analytical ? A cognitive theory of axiological rationality is developed here starting from the basic point that normative statements and axiological beliefs should be analyzed as grounded on reasons with a transsubjective validity, as positive statements are. This theory is checked in a tentative fashion against some examples of axiological beliefs from ordinary experience and against a few pieces of data drawn from experimental social psychology.
Une obsession Le “désenchantement” a-t-il ruiné les valeurs? Sommes-nous devenus incapables d’endosser un jugement de valeur avec confiance? L’axiologique est-il devenu une affaire d’opinion ? Cette inquiétude est depuis longtemps omniprésente dans les sciences sociales et ailleurs. Dans “La Chrétienté ou l’Europe”, Novalis regrette que nous ne vivions plus “dans l’ère belle et heureuse où l’Europe était unie par une croyance universellement partagée”. A. Comte partage la même inquiétude. Le thème est repris de manière positive par ce disciple si proche du maître que fut Durkheim : sur quelles bases asseoir une morale laïque? Chez Max Weber, le “désenchantement” se conjugue avec le “polythéisme des valeurs”, mais laisse subsister la “rationalité axiologique”. Dans ce concert, Tocqueville est peut-être -comme souvent- le plus nuancé et le plus perspicace. La ruine des “croyances dogmatiques”, irréversible selon lui, est grosse d’une
256 lourde menace : la tyrannie de l’opinion. Mais le fait qu’elle puisse être vécue comme une tyrannie suffit à témoigner de l’existence d’une aune supérieure1. La question du fondement de l’axiologie dans un monde d’où se sont évanouies les croyances dogmatiques est peut-être au total la plus fondamentale pour toute théorie de l’ordre social. Je laisse de côté la réponse que lui apportent les religions traditionnelles : elle consiste à nier l’irréversibilité du désenchantement et à annoncer le retour des “croyances dogmatiques”. Le XXIe siècle sera religieux, proclama l’écrivain A. Malraux. On répète souvent cette formule-choc après lui. Je la crois rhétorique : elle contredit trop de faits. L’interprétation religieuse des phénomènes naturels a irréversiblement cédé la place à une interprétation de type scientifique. Les espaces non occupés par le savoir scientifique eux-mêmes sont plutôt laissés vacants que remplis par des interprétations de type religieux. La morale elle-même s’est irréversiblement laïcisée depuis Kant et les philosophes des Lumières. L’argumentation religieuse en matière d’éthique est abandonnée aux croyants. Seuls sont publiquement pris en compte les arguments non fondés sur de croyances dogmatiques. Je laisse également de côté la réponse “sociologiste” (les valeurs doivent s’analyser comme des illusions sociales), qu’elle soit déclinée sur le mode nietzschéen ou marxiste, ou même durkheimien. Malgré sa popularité auprès des “post-modernistes”, elle contredit, elle aussi, trop de faits pour mériter d’être considérée. Afin de clarifier d’entrée de jeu ma position, j’ai toujours pensé pour ma part, dans la ligne de Benjamin Constant ou de Tocqueville2, qu’il n’y avait aucune raison pour que le désenchantement ruinât l’éthique et plus généralement l’axiologique (je désigne ainsi l’univers des jugements de valeur). Les jugements de valeur ne sont pas fondés sur des bases moins solides aujourd’hui qu’hier. Le “polythéisme des valeurs” n’exclut pas la “rationalité axiologique”. Les doctrines religieuses doivent être tenues, comme l’indiquait encore Tocqueville, comme une expression sur le mode symbolique de l’exigence de valeur qui définit la transcendance de l’homme3. Elles doivent donc être vues comme traduisant des réalités irrécusables, mais aussi comme leur conférant une expression contingente.
Can axiological statements be grounded in the absence of dogmatic beliefs ?
257
Les théories qui tentent de saisir les valeurs de façon positive sont rares aujourd’hui. Celle de J. Habermas en est une. Elle a attiré l’attention parce qu’elle pose une bonne question : celle des conditions de possibilité d’une axiologie ne reposant pas sur des “croyances dogmatiques” au sens de Tocqueville. Avant d’esquisser ma propre réponse, je tenterai de dire pourquoi la réponse qu’il donne à cette question me paraît insuffisante. Une réponse moderne Mon but n’est pas de proposer une critique de Habermas, mais plutôt d’aller droit à quelques objections. L’auteur parle de la “capacité de vérité de la question pratique”4. Ainsi, les jugements de valeur relevant de l’ordre de l’éthique seraient capables de vérité. Comment déterminer leur validité? En se donnant par la pensée une situation idéale où des participants impartiaux, pouvant exprimer leurs vues sans entraves, délibéreraient les uns avec les autres. La “raison communicationnelle” à l’oeuvre dans cette situation idéale serait de nature à déterminer la vérité éthique. Cette situation de référence véhicule une heureuse idée de méthode. Elle concrétise l’idée que l’arbitre non impliqué mais concerné a plus de chance de voir le juste que celui qui est juge et partie. Pour mesurer l’insuffisance de la réponse de Habermas, considérons toutefois un exemple simple. Plaçons-nous en un temps fictif précédant la démonstration de la formule donnant la surface du rectangle. Un paysan a un champ de dimensions x et y ; un autre a un champ de dimensions x’ (>x) et y’ (
258 superficie égale? Ou bien iront-ils jusqu’à avoir l’idée de comparer xy et x’y’ pour déterminer celui qui doit payer le plus d’impôts? Cette historiette ne traduit pas la complexité de la théorie de Habermas, mais elle n’en trahit pas non plus le noyau dur. Elle fait apparaître que la situation créée par l’apparition de l’arbitre, en obligeant les paysans à se détacher de leurs intérêts, rend plus aisée la détermination de la vérité. Mais elle montre aussi qu’une situation de communication transparente ne garantit pas la validité des conclusions auxquelles s’arrêtent les participants. Si l’on veut que les conclusions atteintes dans une situation de communication pure et parfaite soient nécessairement valides, on tombe dans les apories du conventionnalisme. Si l´on souhaite les éviter, il faut reconnaître qu’une conclusion peut être valide même si les participants en décident autrement dans une situation de communication pure et parfaite. Mais c’est alors admettre que la vérité axiologique ne peut se reconnaître à de simples critères procéduraux. Que reste-t-il alors de la mystérieuse raison communicationnelle? Quelle est la réalité du principe U? Le même argument peut être présenté sous une forme plus particulière : une discussion sur un sujet axiologique comporte des assertions, or aucune procédure ne garantit la justesse d’une assertion : toute l’histoire des sciences est là pour en témoigner ; et même s’il est parfaitement conduit, en toute transparence et en toute légalité, un procès peut aboutir à une erreur judiciaire. On peut d’ailleurs faire remarquer que la théorie procédurale de Habermas est insuffisante s’agissant non seulement des vérités axiologiques, mais des vérités positives, celles qu’établissent notamment les sciences. Si l’on en croit Merton5, la société de communication pure et parfaite de Habermas est approximativement réalisée dans ce cas depuis le XVIIIe siècle. Pourtant l’histoire des sciences continue d’être constituée pour l’essentiel par un cimetière d’idées fausses. Même dans le domaine du factuel et du positif, aucune procédure ne garantit donc l’accès au vrai. Je glisse sur une difficulté complémentaire, à savoir que Habermas distingue des types d’argumentations correspondant à ses types de rationalité: un type d’argumentation caractériserait la “rationalité instrumentale-cognitive”, un autre la “rationalité morale-pratique”6. En quoi ces types se distinguent-ils? Le
Can axiological statements be grounded in the absence of dogmatic beliefs ?
259
second est-il par exemple dispensé de se plier au principe de contradiction? De tenir compte des faits pour ce qu’ils sont? Si la distinction se fait sur d’autres points, lesquels? Je crois qu’on peut proposer à la question posée par Habermas une réponse plus satisfaisante, que je qualifierai de cognitiviste. Elle consiste dans son principe à retenir que ce qui importe, ce n’est pas la transparence de la discussion, une condition utile mais ni nécessaire ni suffisante, mais la solidité de l’argumentation. La conclusion consistant à comparer xy et x’y’ est bonne parce qu’elle repose sur des raisons plus solides que les autres réponses possibles (comme : comparer x et x’, comparer y et y’, déduire de x<x’ et y>y’ que xy=x’y’)7. La théorie cognitiviste des croyances Première thèse. Je prends l’adjectif “cognitiviste” en un sens plus étroit que celui dans lequel on le prend généralement. En effet, l’on qualifie souvent ainsi la théorie pratique de Kant, comme celle de Habermas, indiquant par là que le jugement moral est supposé avoir dans ces théories des bases cognitives plutôt par exemple qu’affectives. En parlant de théorie cognitiviste, j’entends indiquer que les jugement et plus généralement axiologiques (le jugements de valeur) ne me paraissent pas assis sur des bases différentes des jugements assertoriques. Plus brutalement : la validité des jugements qui nous disent comment le monde doit être fait ne se fonde pas autrement que celle des jugements qui nous disent comment il est fait. Deuxième thèse. Le jugement “la surface d’un rectangle est égale à xy” se mesure à la solidité des raisons qui fondent cette assertion. Il n’y a aucun moyen, en examinant cette proposition en elle-même, de déterminer si elle est acceptable ou non. Pour le savoir, il n’est d’autre moyen que d’examiner les raisons qui la fondent et d’en apprécier la validité. Il en va de même, selon la théorie cognitiviste que j’esquisse ici, des jugements portant sur le devoir-être. Reprenons l’exemple ci-dessus. Les trois participants concluent “il faut comparer xy et x’y’ pour déterminer l’impôt que chacun des deux paysans doit payer”. Cette proposition sur le devoir-être est-elle valide ou non? Pour le déterminer, il est inutile de chercher à en évaluer les propriétés. La seule
260 manière de la juger consiste à examiner les raisons qui la fondent et à déterminer leur solidité : un jugement de valeur est valide s’il est fondé sur des raisons solides. Troisième thèse. Deux argumentations peuvent différer selon leur degré de validité. Ce sera le cas par exemple si l’une des argumentations, mais non l’autre, comporte un argument faible. Ainsi, dans l’exemple précédent, les deux premières argumentations sont dominées par la troisième. À supposer qu’on s’accorde à penser que l’impôt foncier doit être proportionnel à la superficie des terres, le jugement de valeur “le premier paysan doit payer moins d’impôts que le second puisque x<x’ “ est moins solidement fondé que le jugement “il doit payer plus d’impôts puisque xy>x’y’ “. Pour des raisons de simplicité, j’ai pris ici un exemple où un jugement de valeur se ramène à un jugement assertorique. On verra plus bas que l’idée de la solidité relative des argumentaires axiologiques peut être généralisée quand on sort de ce type de cas. Quatrième thèse. Ce cas particulier permet toutefois d’attirer l’attention sur une proposition importante, à savoir que l’axiologique se réduit bien souvent à l’assertorique. Cela se produit notamment lorsqu’un jugement de valeur est fondé sur des critères conséquentialistes : “x est mauvais car l’application de x entraînerait des conséquences que tous s’accorderaient à trouver détestables”. “Trouver détestable” est un jugement de valeur. Que “tout le monde trouve un état de choses détestable” est un jugement de fait. Jugements de fait et de valeur se combinent et s’interpénètrent d’ailleurs constamment. “Ce couteau est bon” (un jugement de valeur) signifie “ce couteau coupe” (jugement de fait) ; “c’est un grand mathématicien” peut vouloir dire “il a inventé un théorème, ce qui est rare” (combinaison de deux jugements de fait) ou “il a inventé un théorème important” (combinaison indissociable d’un jugement de fait et d’un jugement de valeur). Encore une fois, tous les jugements de valeur ne se réduisent pas à des jugements de fait. Mais cette intersection entre jugements de valeur et jugements de fait suggère que le mur que toutes sortes de traditions de pensée, de l’empirisme au sociologisme, tentent de bétonner entre l’être et le devoir-être mériterait peut-être d’être abattu.
Can axiological statements be grounded in the absence of dogmatic beliefs ?
261
Cinquième thèse. Un bon argumentaire dans le domaine de l’assertorique est un ensemble de propositions dont chacune est acceptable. Il en va de même dans le domaine de l’axiologique. Sixième thèse. Il n’existe pas dans le domaine de l’assertorique de théorie unique composée d’un nombre fini de propositions qui permette de déduire l’ensemble des énoncés vrais sur le réel. Je prends soin d’apporter cette précision, car plusieurs théories cherchent à déduire l’ensemble des jugements de type “cela est juste”, “cela est injuste”, d’un ensemble fini de propositions. Il n’existe pas de tel système s’agissant de “cela est vrai”, “cela est faux”. Pourquoi le domaine de l’axiologique serait-il plus simple que celui de l’assertorique ? Je suis bien conscient que ces remarques bousculent des idées reçues. Elles indiquent en effet que “rationalité axiologique” et “rationalité instrumentale” ne peuvent être traitées comme deux compartiments étanches; que la coupure traditionnelle entre l’axiologique et l’assertorique, entre l’être et le devoir être, entre “raison instrumentale” et “raison axiologique” est beaucoup plus fragile qu’on ne le pense à la suite d’influentes traditions de pensée. Des croyances assertoriques M’autorisant une certaine liberté de vocabulaire, j’appelle assertoriques les croyances portant sur l’être par opposition aux croyances axiologiques, celles qui portent sur le devoir-être. Avant de passer à l’axiologique, il me faut souligner un point essentiel à propos des croyances assertoriques: elles doivent être analysées comme faisant sens pour l’acteur, i.e. dans la plupart des cas comme fondées sur des raisons. C’est un des apports les plus importants de la sociologie -du moins dans sa tradition de la sociologie de l’action- que d’avoir montré qu’une assertion sur le monde, même si elle apparaît absurde à l’observateur, doit être analysée comme ayant un sens pour l’acteur. Il en va de même s’agissant des croyances relatives au devoir-être. Ce postulat essentiel se dégage de la méthodologie implicite d’un Tocqueville et demi-explicite d’un Max Weber: il faut analyser les croyances, quelles qu´ elles soient, comme fondées sur des raisons. On est convaincu que x, on croit que x parce que x est fondé sur un système de raisons qu’on perçoit
262 comme solides. Ces raisons peuvent être objectivement bonnes. Elles peuvent être bonnes pour tel ensemble d’acteurs, mais non pour tel autre. Je propose de parler alors de “bonnes raisons”. Certains des “philosophes” du XVIIIe siècle avaient de bonnes raisons de croire aux vertus de ce qu’on appellera plus tard la planification, même si elle est souvent une mauvaise chose. Ces raisons tenaient à ce que, vu l’état de la France de l’époque, on pouvait facilement croire qu’il était indispensable de substituer à des institutions perçues comme chaotiques et illégitimes une société organisée selon des plans préétablis8. Tocqueville ne nous dit pas que cette proposition ait la validité objective de “2+2=4". Lui-même la considère plutôt comme fausse. Et il souligne que les Anglais n’avaient aucune raison d’endosser les mêmes vues. Mais toute son analyse suggère en même temps que, si l’on cherche à expliquer pourquoi cette croyance collective s’est installée, il faut examiner les raisons que les “philosophes” en question et leur public avaient d’y croire. Seules ces raisons sauraient légitimement être tenues pour les causes de ladite croyance. En même temps, nous avons des raisons de croire (je ne les développerai bien sûr pas) qu’ils avaient tort: nos raisons sont meilleures que les leurs. Cette méthodologie a l’avantage d’éviter les apories du relativisme (à chacun sa vérité) et du rationalisme sommaire (une croyance qui n’est pas fondée sur des raisons objectivement bonnes, du type de celles qui fondent 2+2=4, est irrationnelle). Bref, il s’agit de substituer à l’opposition brutale entre “superstitions” et raisons objectivement bonnes l’idée que des systèmes de raisons peuvent: être plus ou moins solides, se trouver en concurrence ou non sur un marché des idées, être de “bonnes raisons” pour tel groupe, etc. Plusieurs configurations peuvent alors être observées: celle où un système de raisons est en concurrence avec d’autres et où l’un de ces systèmes est définitivement meilleur ; celle où des systèmes sont en concurrence sans qu’aucun ne domine les autres; celle où un système “local” résiste à un système “cosmopolite”, celle au contraire où le premier cède devant le second, etc. Les Indiens Papago de l’Arizona expliquent toutes sortes d’événements et de faits par la volonté d’un Dieu dont ils croient qu’il vit au sommet du mont Boboquivari, un point culminant qui peut être vu de l’ensemble de leur
Can axiological statements be grounded in the absence of dogmatic beliefs ?
263
territoire. Pourquoi personne n’a-t-il jamais vu ce Dieu? Parce que les araignées l’avertissent de l’approche des humains, lui permettant ainsi de se cacher9. Il serait bien superficiel de considérer cette argumentation comme irrationnelle ou comme obéissant à des lois de la pensée propres aux Papago. Ce qui frappe au contraire, c’est sa virtuosité logique et son souci vétilleux d’éviter la contradiction et l’incompatibilité avec les faits. Le fait de n’avoir jamais vu le Dieu du Boboquivari n’est pas une preuve de sa non existence, mais montre qu’il ne veut pas être vu et qu’il a les moyens d’accomplir cette volonté, laquelle s’explique par son souci de tenir ses fidèles à distance afin de préserver le respect qui lui est dû. L’existence des araignées peut être vérifiée, mais dans l’état actuel de nos connaissances, on ne peut vérifier qu’elles avertissent le Dieu du Boboquivari: il faudrait pour cela que les humains parlent l’araignée ou que les araignées maîtrisent le Papago, l’Anglais ou l’Espagnol. Mais comme par ailleurs l’hypothèse de l’existence de Dieu explique tant de choses aux yeux des Papago, cette difficulté leur paraît à juste titre secondaire. Cette observation rappelle un apologue du néo-popperien Lakatos10: un astronome qui n’observe pas la planète dans le ciel là où il l’attendait fait l’hypothèse -laquelle peut se révéler pendant très longtemps aussi difficilement vérifiable que celle du langage des araignées- qu’il existe un nuage de poussières cosmiques qui en modifie le cours. Sa foi dans sa théorie peut donc rester intacte: elle explique tant de choses! On comprend donc que les Papago aient des raisons de croire au Dieu du Boboquivari. En même temps, même le plus coriace des relativistes aura la certitude absolue que la théorie des Papago est fausse. Pourquoi? Parce qu’il peut facilement leur opposer un argumentaire qui domine le leur: aucun Dieu ne loge au sommet du Boboquivari. C’est pour cette raison qu’on ne le voit pas. Il n’y a donc pas lieu de supposer que les araignées ont un langage. En outre, nous disposons pour rendre compte des phénomènes que les Papago expliquent par la volonté divine de théories qui se passent d’hypothèses aussi lourdes. Notre conviction négative à propos des croyances des Papago est fondée sur le fait que notre argumentation est objectivement supérieure. Même au prix d’une immersion prolongée dans leur société, l’ “ethnométhodologue” le plus à cheval sur ses principes (les croyances d’un groupe valent celles d’un autre) ne pourrait
264 réussir à reprendre à son compte les croyances des Papago: il ne pourrait en effet oublier qu’on peut expliquer d’une manière plus acceptable les phénomènes dont ils rendent compte par la volonté divine. (Je note incidemment que l’on tire de ces remarques un corollaire: celui de l’irréversibilité du “désenchantement”). On éprouve une certitude négative de même nature lorsqu’on évoque aujourd’hui les vérités scientifiques d’hier, comme la théorie à l’aide de laquelle la physique aristotélicienne expliquait le mouvement des flèches. Cette théorie se comprend: les aristotéliciens avaient des raisons fortes d’y croire. Il n’y a pas de mouvement sans cause, argumentaient-ils: un objet au repos n’y reste-t-il pas tant qu’une cause ne vient pas le déplacer? Quelles causes expliquent-elles donc que la flèche qui vient de quitter l’arc continue son mouvement? Réponse: elle provoque une perturbation du milieu aérien ayant pour résultat d’entretenir son propre mouvement. Cette argumentation garda sa force de conviction jusqu’au moment où elle fut ébranlée par un argument simple qui était appelé à bouleverser la physique naissante: un voilier est en mouvement; le vent tombe; donc les causes du mouvement disparaissent; pourtant, il continue de glisser sur son erre. Le principe de l’inertie qui se profile derrière cet argument s’imposa progressivement, discréditant les tourbillons aristotéliciens: à une situation d’équilibre entre argumentations succéda une situation de domination d’une argumentation par l’autre. Les deux exemples que j’ai évoqués ne sont pas fondamentalement différents l’un de l’autre. Notre certitude négative provient dans les deux cas de ce que nous savons. Notre familiarité avec le principe de l’inertie fait que nous percevons facilement la théorie aristotélicienne comme tout aussi inacceptable que la théorie des Papago. Nous savons qu’il n’y a pas lieu de s’interroger sur les forces mystérieuses qui entretiendraient le mouvement des flèches puisqu’un corps en mouvement tend à le rester. Cette argumentation a aujourd’hui une valeur “cosmopolite”. Mais les physiciens aristotéliciens avaient des raisons de croire à la théorie des tourbillons. Cet exemple a aussi l’avantage de rappeler que, s’il existe des situations où une argumentation en domine une autre, il existe des situations où deux argumentations différentes sont en situation
Can axiological statements be grounded in the absence of dogmatic beliefs ?
265
d’équilibre. C’est seulement lorsque le principe d’inertie a eu fait ses preuves que l’argumentation des physiciens aristotéliciens est devenue non crédible. Ce que montrent ces exemples familiers, c’est d’abord que la connaissance ordinaire s’appuie, tout comme la connaissance scientifique, sur des systèmes de raisons plus ou moins solides. C’est ensuite qu’on a avantage à chercher à déceler un système de raisons derrière toute croyance assertorique: cela provient de ce que sur beaucoup de sujets l’idée d’une croyance qui soit purement “personnelle” est inconcevable; si l’on ne peut justifier x par des raisons acceptables par les autres, on ne peut y croire soi-même. C’est d’autre part qu’un système de raisons apparaît comme solide ou non par comparaison avec les systèmes de raisons concurrents présents sur le marché. La sociologie cognitive peut donc tranquillement souscrire au principe de Tocqueville-Weber: toute conviction s’appuie sur des raisons que le sujet perçoit comme fondées dans le contexte qui est le sien. Ce postulat esquisse une théorie générale des croyances. Il évite bien des oppositions sommaires qui s’évanouissent dès qu’on tente de les saisir: superstitions/croyances, croyances rationnelles/ irrationnelles. Il suggère qu’il est préférable de parler de croyances locales/ universelles, dominantes/dominées. Ainsi, les croyances des Papago comme celles des philosophes du XVIIIe siècle selon Tocqueville sont “locales”: les Français mais non les Anglais avaient des raisons de croire que la planification était une bonne chose; les Papago, mais non nous, que les araignées informent le Dieu du Boboquivari; les physiciens aristotéliciens, mais non leurs successeurs, que le mouvement des flèches est produit par la vibration de l’air qu’elles provoquent. Des croyances axiologiques Ainsi, on a la conviction que “x est vrai” quand on a la certitude qu’aucune argumentation meilleure ne risque, dans l’état de notre information, d’aboutir à une autre conclusion. La thèse principale de la théorie cognitiviste que je défends ici est qu’il en va de même dans le domaine de l’axiologique: la conviction que “x est bon, juste, acceptable, etc.”, comme la conviction “x est vrai”, s’établit à partir du moment où, de façon plus ou moins consciente, on a
266 la certitude de ne pas entrevoir d’argumentation meilleure et comportant une conclusion opposée. S’il en est ainsi, la mystérieuse “raison communicationnelle” de Habermas et son tout aussi mystérieux “principe U” se clarifient. Dans le domaine de l’axiologique comme dans le domaine de l’assertorique, on rencontre des situations où une argumentation aboutissant à la conclusion “x est bon, juste, acceptable, etc.” apparaît comme plus solide que toute autre. On pourra dire dans ce cas, utilisant et transposant une notion familière, que l’argumentation en question représente un équilibre réflexif. Dans ce cas, la “raison communicationnelle” nous dit que “x est bon, juste, acceptable, etc.”. Dans d’autres cas, on peut opposer à une argumentation concluant à “x est bon, juste, acceptable, etc.” une autre argumentation aboutissant à la conclusion opposée sans qu’il soit facile d’affirmer que l’une est préférable à l’autre. On observe aussi des situations évolutives où une argumentation devient obsolète, soit qu’un nouvel argument soit apporté auquel on n’avait pas pensé auparavant, soit que des faits nouveaux viennent à être découverts. Cet aspect “dynamique” n’a rien de surprenant étant donné notamment l’interpénétration des jugements de valeur et des jugements de fait. Ainsi, l’attitude à l’égard de la peine de mort varie entre autres choses selon que ses effets dissuasifs apparaissent démontrés ou non. La philosophie morale a souvent tenté d’exprimer la source cognitive de la morale. Le succès d’un Rawls11 s’explique sans doute par la nature cognitive de son projet: établir une théorie composée d’axiomes susceptibles d’entraîner un assentiment général et tirer de ces axiomes des critères permettant de définir ce qui dans le domaine du politique peut être tenu pour juste, légitime ou acceptable; réciproquement, fournir une explication des sentiments de justice ou d’injustice, de légitimité ou d’illégitimité que suscitent les institutions et les décisions politiques. C’est dire que selon cette théorie, les sentiments de justice ou d’injustice, de légitimité ou d’illégitimité sont vus comme le produit de systèmes de raisons. Il faut d’ailleurs noter que Rawls reprend ici une méthode vénérable, la méthode contractualiste. Dans son principe même, elle vise à déterminer ce que des contractants libres jugeraient à l’unanimité comme bon et, réciproquement, à expliquer les jugements “cela est bon, juste, légitime” par
Can axiological statements be grounded in the absence of dogmatic beliefs ?
267
des systèmes de raisons assez solides pour que le théoricien puisse les présenter comme acceptables à l’unanimité. L’on peut noter incidemment que Habermas paraît ne pas bien saisir l’essence de la méthode contractualiste, ni la nature de l’entreprise de Rawls12. Il la taxe d’ “invraisemblance” sans prêter attention au fait, bien marqué pourtant par le célèbre “écartons les faits” de Rousseau, que le contractualisme ne doit pas être interprété de manière réaliste. Qui peut imaginer que Rousseau lui-même se représentait la fondation des sociétés comme un contrat passé devant notaire? L’ “état de nature” crée seulement une situation idéal-typique permettant de comprendre les sentiments de légitimité ou d’illégitimité associés aux institutions politiques. C’est cette idée de méthode que reprend Rawls. Imaginons, nous dit-il, des individus placés “sous le voile de l’ignorance”, ne sachant rien de leurs propres goûts, de leurs aptitudes, de leurs préférences, ignorant la place qui sera la leur dans la société, les aléas auxquels ils seront confrontés, etc. Sur quels principes les institutions de ladite société devraient-elles être appuyées pour qu’ils les jugent acceptables? Cette fiction de la “situation originaire” permet à Rawls de répondre à des questions comme: à quel prix des inégalités vont-elles être jugées légitimes? Réponse: les citoyens dans la situation originaire vont jouer la prudence. Ne sachant pas quel sera leur sort, ils recourent à la stratégie dite du maximin: ils exigent que les institutions aient pour objectif de rendre la condition des moins favorisés aussi bonne que possible. Si un accroissement des inégalités a pour effet d’améliorer leur condition, il sera donc jugé bon. Il sera jugé indifférent s’il n’a aucun effet sur la situation des plus démunis et mauvais s’il aboutit à une dégradation de leur situation. Il n’y a aucun doute que l’argumentation qui compose la théorie de la justice de Rawls est bonne: ses propositions de base sont acceptables. La seule question est de savoir si elle est plus acceptable que toute argumentation concurrente. Pour concrétiser cette difficulté, je me bornerai à évoquer l’argumentation développée par le fonctionnalisme sociologique dans les années 50-60. Cette théorie propose de considérer que les inégalités tendent à être jugées légitimes lorsqu’elles sont favorables, non seulement comme chez Rawls aux plus démunis, mais à tous. Ainsi une politique de redistribution des revenus qui améliorerait la condition des plus démunis, disons de 10% sans affecter la
268 condition des autres serait jugée par les contractants de Rawls meilleure qu’une politique qui améliorerait la condition de tous de 5%. Les “fonctionnalistes” soutiendraient l’opinion opposée. Bref, il n’est pas sûr que sur cette question des inégalités, la théorie de Rawls ne veuille pas trop préciser les choses. On peut en effet facilement imaginer des situations où les sentiments de légitimité trancheraient en un sens différent du sien. On verra ci-dessous où réside la source principale de cette faiblesse. Mais les deux théories évoquées ont en commun un point essentiel, à savoir que le sentiment “ces inégalités sont acceptables/inacceptables” y est analysé comme une conviction fondée sur des raisons solides. Il est vrai que si une réduction des inégalités entraînait une détérioration de la situation soit de tous soit des moins bien lotis, cela serait jugé mauvais. On peut par comparaison évoquer la théorie à l’aide de laquelle le danois Ranulf tentait d’expliquer les sentiments d’injustice soulevés par les inégalités : l’envie est la passion dominante de l’homme, avance-t-il ; mais elle est si disgracieuse que les sciences humaines passent leur temps à essayer de la dissimuler13. Si cette théorie était vraie, il en résulterait que, toutes choses égales d’ailleurs, une situation plus égalitaire serait toujours considérée comme plus juste. L’observation la plus simple montre que cela n’est pas le cas. Mais la théorie de Rawls me semble, comme bien des théories produites par la philosophie morale, se heurter à une objection principale. Aucune théorie unique, quelle que soit sa solidité, ne peut se donner pour ambition de déduire l’ensemble des propositions de type “x est juste, bon, recevable”, s’agissant même d’un domaine particulier. Dans Political liberalism, Rawls insiste sur le point que sa théorie ne concerne que les institutions et les décisions politiques ; elle ne traite en aucune façon, dit-il, des questions morales14. Il est vrai qu’elle ne porte que sur les droits fondamentaux et les problèmes relevant des inégalités (inégalités des chances et inégalités des résultats). En ce sens, sa théorie n’a effectivement pas l’ampleur par exemple de la théorie kantienne. Malgré cette restriction, elle se heurte à l’objection, à mon sens fondamentale, que le monde des sentiments de justice est trop complexe pour qu’il soit possible d’en rendre compte par une théorie unique. Pour mesurer la naïveté de cette ambition, considérons le cas de la physique. Les mouvements du pendule sont expliqués par la théorie de Huygens, la
Can axiological statements be grounded in the absence of dogmatic beliefs ?
269
réflexion optique par celle de Descartes, etc. Sans doute existe-t-il un tissu conjonctif entre ces différentes théories. Mais même dans une discipline aussi “mûre”, il n’est pas question de déduire l’ensemble des phénomènes d’un nombre fini de propositions. L’ensemble des propositions “x est vrai”, même s’agissant d’une catégorie bien déterminée de phénomènes, correspond non pas à une théorie unique, mais à un ensemble de théories, i.e. de systèmes de raisons multiples. La connaissance scientifique évoque l’image plutôt d’un archipel que d’un continent. Pourtant, alors que la vision newtonienne d’un savoir totalisé est devenue caduque s’agissant de la connaissance scientifique, elle persiste curieusement s’agissant de la morale, peut-être en raison de l’influence durable de Kant en matière de théorie de la pratique. Pourquoi faudrait-il qu’un argumentaire unique de type rawlsien permette de déduire toutes les propositions de forme “x est juste/injuste” qu’on peut émettre à propos des institutions ou des décisions politiques ? Même si on se limite aux sentiments de “justice”, même si parmi les sentiments de justice on se borne à ceux qui sont liés à des questions de répartition des biens, il paraît impossible de les déduire d’une théorie unique. C’est là en tout cas l’un des enseignements principaux des innombrables études “empiriques” qui ont été produites par les sciences sociales sur les sentiments de justice. Sans doute réflètent-elles une attitude naturaliste. On s’y soucie davantage d’enregistrer les sentiments de justice ou les jugements de valeur comme des faits bruts que de comprendre leur genèse. C’est pourquoi la richesse et les enseignements théoriques potentiels de ces travaux ne sont pas toujours bien perçus. Rien n’interdit cependant d’aller au-delà et de tenter d’extraire notamment de la structuration statistique des réponses qu’elles font apparaître des conjectures sur les systèmes de raisons qui fondent les sentiments de justice. Surtout, ces études permettent de voir que, si la certitude morale est associée à des raisons solides, ces raisons ne peuvent se réduire à un argumentaire totalisant. C’est pourquoi, malgré leur modestie, elles ouvrent une piste permettant de corriger les faiblesses du cognitivisme kantien ou même rawlsien. Une étude psychosociologique
270 A l’appui de cette analyse, j’évoquerai un fragment d’une belle étude de psychologie sociale, très typique des travaux que j’évoque ici15. J’espère que les quelques remarques qui suivent suffiront à montrer leur importance pour l’analyse du phénomène axiologique. Ils fournissent en tout cas une confirmation empirique remarquable à la version particulière de la théorie cognitiviste des sentiments moraux que je défends ici. Cette étude vise à explorer un problème moral classique : dans quelle mesure et sous quelles conditions a-t-on le droit de tirer profit de circonstances favorables, lorsque cela n’est pas sans incidence sur autrui? Lesdites circonstances concernent en l’occurrence les variations de l’offre et la demande sur différents marchés concrets, de sorte que l’étude apporte aussi de précieux éclairages sur les interférences entre les sentiments moraux et les “lois” économiques. On y propose à un ensemble de sujets, dont l’effectif varie d’une question à l’autre, un ensemble de situations simples où un acteur économique prend une décision affectant son environnement social. Les sujets sont invités à juger de la recevabilité de la décision. Je me bornerai à considérer quelques unes des deux douzaines de situations fictives évoquées par les auteurs de l’étude. 9a. Une petite entreprise emploie plusieurs ouvriers et leur verse des salaires moyens ; il y a un sérieux chômage dans la région et l’entreprise pourrait facilement remplacer ses employés avec de bons ouvriers à des salaires plus bas. L’entreprise fait des bénéfices. La direction réduit les salaires de 5%. Cela est-il acceptable? Sur 195 personnes, 23% trouvent la réduction acceptable, 77% la jugent inacceptable. 9b. Une petite entreprise [...] L’entreprise perd de l’argent. La direction réduit les salaires de 5%. Cela est-il acceptable ? Cette fois, les répondants jugent la réduction acceptable dans 68% des cas et inacceptable dans 32 %. On discerne assez facilement une théorie dominante derrière ces réponses. On peut la traduire de la façon suivante :
Can axiological statements be grounded in the absence of dogmatic beliefs ?
271
¨ Dans un système où offre et demande sont des paramètres importants, qui s’imposent aux acteurs économiques, il faut tenir compte de leur valeur. ¨ Néanmoins un acteur ne peut profiter unilatéralement d’une situation qui le favorise s’il n’y est pas contraint et si cela provoque une détérioration sans contrepartie de la situation des agents appartenant à son système de production. ¨ Or dans la situation 9a évoquée, il n’y est pas contraint (la santé de la firme est bonne). ¨ Dans cette situation, il ne peut donc arguer du chômage dans la région pour baisser les salaires de ses employés. En revanche quand la santé de la firme n’est pas bonne, une baisse des salaires d’une part est peut-être indispensable à la survie de l’entreprise et par conséquent de l’intérêt de tous. Dans ce cas (situation 9b), l’argumentation bascule donc vers la conclusion opposée. On a observé récemment en France une situation réelle qui n’est pas sans rappeler cette situation quasi-expérimentale. Il s’agit de la grève de la compagnie Air France d’octobre 1993: la direction avait décidé d’un plan destiné à mettre fin à un déficit considérable. Le plaÁ comportait notamment une réduction des primes allouées aux catégories de personnel les plus modestes; un malheureux télescopage entre des décisions indépendantes fit que la direction donna l’impression qu’elle comptait surtout sur les sacrifices des bas salaires pour rééquilibrer ses comptes. La grève comportait des inconvénients pour les usagers. Elle mettait à mal la compagnie. Elle comportait des inconvénients pour les compagnies étrangères atterrissant à Paris. Malgré cela un jugement s’imposa: les grévistes ont eu raison. Les sytèmes d’arguments qu’on peut déceler ou en tout cas conjecturer derrière les réactions des acteurs et de l’opinion sont de même ordre que ceux qui sous-tendent les appréciations des juges dans l’étude expérimentale sous examen. La situation de l’entreprise AirFrance, la nécessité de la redresser dans un contexte de concurrence internationale, le fait que sa mauvaise situation ait menacé son existence même et par conséquent ses employés de tous niveaux n’entraînait pas qu’on puisse ignorer le principe selon lequel des sacrifices doivent être équitablement répartis. L’intensité des réactions fut à la mesure de la solidité de cette
272 argumentation. En dépit des conséquences économiques et politiques de la grève, le public n’a pas dans son ensemble jugé incompréhensible la vigueur de la réaction syndicale. L’argument “on n’a pas le droit de revendiquer en période de chômage” émis par certains journalistes a été mal perçu; l’argument “ils provoquent des conséquences nuisibles à la compagnie, à la communauté nationale, à eux-mêmes” n’a pas entraîné le sentiment qu’ils avaient tort. Je reviens maintenant à l’étude expérimentale : 14. Un propriétaire loue une petite maison. Au moment du renouvellement du bail, il apprend que son locataire a pris un emploi tout près de son domicile. Il y a par conséquent peu de chances qu’il veuille déménager. Le propriétaire augmente alors son loyer de 40 dollars de plus qu’il ne l’avait envisagé. 9% des sujets jugent la décision acceptable ; 91% la jugent inacceptable (N=157). Les réponses sont encore plus nettes que dans le cas précédent. On ne peut unilatéralement profiter de circonstances fortuites lorsque cela entraîne des inconvénients pour une personne avec laquelle on est en relation. Á la différence du cas précédent, les acteurs hypothétiques concernés n’appartiennent pas à un système coopératif; mais ils s’apprêtent à s’engager mutuellement par contrat. Surtout, il y aurait ici pour l’acteur favorisé par les circonstances quelque chose de plus choquant que dans le cas précédent à profiter de la situation. Le droit légitime et imprescriptible qu’a le locataire de choisir librement son emploi se trouverait en effet comme retourné contre lui par le propriétaire. Il ne s’agit plus seulement pour ce dernier de tirer avantage du jeu de l’offre et de la demande, mais de profiter de la situation de faiblesse dans laquelle se met le premier en exerçant ses droits élémentaires. L’étude ne le dit pas, mais on peut supposer que si le propriétaire hypothétique avait décidé d’augmenter le loyer en raison d’une tension de la demande de logements dans l’environnement, on aurait observé davantage de réponses positives. Dans ce second cas hypothétique, le propriétaire se contenterait de profiter de la loi de l’offre et de la demande; dans le premier, il transformerait en faiblesse un droit du locataire afin d’ “exploiter” ladite faiblesse. Considérons un autre exemple
Can axiological statements be grounded in the absence of dogmatic beliefs ?
273
16. Une entreprise est implantée dans une communauté qui compte un taux élevé de chômage. Elle recrute un informaticien. Quatre candidats sont jugés qualifiés pour l’emploi. Le directeur leur demande d’indiquer le salaire le plus bas qu’ils accepteraient et choisit celui qui a indiqué le salaire le plus bas. La décision est jugée acceptable par 36% et inacceptable par 64 % des répondants (N=154). L’on peut supposer que la décision est jugée majoritairement inacceptable parce que le décideur profite de la faiblesse des candidats. Celui qui indique le salaire le plus bas est peut-être celui qui a le moins d’espoir de trouver un emploi, ou le plus timide. Mais on n’a pas sur ce point de certitude: en effet il est peut-être aussi le plus stratégique: a-t-il deviné que la question de l’employeur n’était pas désintéressée? Au mieux, le directeur considère des traits des candidats qui n’ont rien à voir avec leur capacité de contribuer à la production. Il excède donc les limites de son droit à s’informer. De surcroît, il utilise à son profit les renseignements que lui donnent les candidats. La décision est donc inacceptable. Mais à la différence du cas précédent, où l’un des acteurs, le décideur, était en position de force par rapport à l’autre, les protagonistes sont ici dans une situation d’interaction stratégique. C’est sans doute pourquoi la décision est tout de même perçue comme acceptable par près de 40% des répondants? Peut-être aussi certains ont-ils considéré que la situation n’était pas décrite avec clarté. Ainsi, si l’on introduit l’hypothèse que la firme a des difficultés, la décision représente une mesure favorable pour l’ensemble du personnel. Surtout, la décision du directeur n’entraîne pas, à la différence du premier cas, de détérioration de la situation de quiconque. Le candidat qui estime s’être fait piéger peut finalement refuser de se laisser recruter. Il n’est même pas sûr que sa situation soit plus mauvaise qu’elle ne le serait si le directeur n’avait pas forcé les candidats à exprimer leurs préférences. En d’autres termes, on peut facilement imaginer un argumentaire étayant la réponse “acceptable”. Si la majorité se porte de l’autre côté, c’est sans doute surtout parce que le directeur apparaît comme ayant eu recours à une rouerie pour tenter de profiter de l’excès de la demande locale d’emploi sur l’offre. Autre différence avec le cas précédent: le propriétaire imposait au locataire une
274 hausse de loyer sans qu’on puisse faire l’hypothèse d’une éventuelle contrepartie positive pour quiconque. Ici, il n’impose rien et l’on peut évoquer l’éventualité de contreparties. Examinons un dernier extrait de cette étude. 5a. Une file d’attente se développe pour un modèle populaire d’automobile. Les clients doivent désormais subir un délai de livraison de deux mois. Un concessionnaire vendait ses voitures au prix du catalogue. Il les propose désormais à un prix supérieur de 200 dollars au prix du catalogue. La décision est jugée acceptable par 29% des répondants, inacceptable par 71% (N=130). 5b. [...] Un concessionnaire vendait ses voitures en proposant un rabais de 200 dollars. Il les propose désormais au prix du catalogue. La réponse est jugée acceptable par 58% et inacceptable par 42% des répondants (N=123). Dans le premier cas, le concessionnaire profite de la situation de manière unilatérale et impose à ses clients des conditions moins favorables pour eux. En revanche, dans le deuxième cas, il revient sur un avantage qu’il consentait auparavant. Or on a le droit de revenir sur un avantage qu’on proposait librement, surtout lorsque ledit avantage était lié à des circonstances particulières et que ces circonstances ont disparu. C’est bien le cas ici: cet avantage visait à attirer la clientèle. Or il est devenu inutile et même absurde, en raison de la conjoncture de pénurie. Comme dans le cas précédent, des incertitudes interprétatives peuvent contribuer à expliquer la dispersion des réponses. Que font les autres concessionnaires? Le concessionnaire est-il en situation de monopole? L’hypothèse la plus simple est qu’il tire profit de la suppression de la réduction. Si tel est le cas, il y a enrichissement sans cause et avantage unilatéral. Mais le concessionnaire ne rompt aucun contrat. Et le client peut sans doute aller ailleurs et dans bien des cas garder son ancienne voiture en attendant une situation plus favorable. L’enrichissement sans cause tend à faire pencher la balance dans le sens de la réponse “inacceptable”. Mais cet enrichissement n’est pas pendable dans la mesure où le client est libre de ne pas accepter les nouvelles conditions.
Can axiological statements be grounded in the absence of dogmatic beliefs ?
275
L’absence de consensus qu’on observe ici n’implique pas que le jugement moral soit idiosyncrasique, qu’il émane d’un point de vue injustifiable et purement intuitif. Le fait que la structuration de la distribution des réponses varie sensiblement d’une situation à l’autre suggère au contraire que celles-ci sont toujours fondées sur une théorie, c’est à dire sur un système d’arguments que le répondant perçoit comme fort. Mais la plupart de ces situations laissent à l’interprétation une plus ou moins grande marge. Selon les hypothèses qu’on rajoute pour remplir les “blancs” laissés par la situation fictive, la validité d’une argumentation peut changer. Dans le dernier cas, selon que l’on suppose le concessionnaire en situation de monopole ou non, son comportement est plus ou moins acceptable. Dans le cas où apparaît une forte asymétrie dans la distribution des réponses, c’est que les “blancs” sont réduits et que l’on peut appliquer en confiance un argumentaire solide et qui tend à être dominant. Il m’est difficile, vu la nature des données, d’aller plus loin dans l’analyse. Mais les ébauches précédentes permettent de vérifier qu’il est impossible de comprendre l’ensemble des phénomènes de structuration (dans la distribution statistique des croyances collectives normatives) qu’on observe dans des études comme celle que je viens d’évoquer, si l’on ne fait pas l’hypothèse que les jugements de type “ceci est acceptable/inacceptable” sont appuyés sur des argumentaires visant à un maximum de validité. Quelquefois, un argumentaire tend à s’imposer: on a alors une situation d’ “équilibre réflexif”. Dans d’autres cas, on pressent que plusieurs argumentaires valides peuvent être développés. La symétrie de la distribution des réponses est plus accusée dans le second cas. De façon générale, lorsqu’on examine l’étude réanalysée ici dans son ensemble, on en tire facilement l’impression qu’on décèle derrière les réponses une véritable théorie globale relative aux conditions sous lesquelles on peut légitimement tirer profit des circonstances: cela est légitime si, ce faisant, on n’impose pas une nuisance à autrui; si l’on y est contraint, si la nuisance qu’on impose à certaines personnes est compensée par des effets positifs sur d’autres; si l’on ne rompt pas un engagement, etc. Le développement complet de cette théorie dépasse mon propos présent. Tout ce que je veux suggérer c’est que son existence dans l’esprit des répondants fait peu de doute au sens où, sans elle, il paraît impossible de rendre compte de la structuration des réponses.
276 D’autre part, il est clair que cette théorie ne se réduit en aucune façon à la simple application de principes généraux, mais qu’elle représente un argumentaire complexe modulé par les répondants en fonction des situations hypothétiques auxquelles ils sont exposés. Enfin, on peut émettre la conjecture -mais il faudrait des études empiriques conçues d’une manière dynamique pour le vérifier- que, si les “blancs” étaient éliminés par la discussion, cela faciliterait l’identification d’un argumentaire dominant. Bien sûr, il faut admettre aussi qu’il est des cas d’indécidabilité objective, où même si les “blancs” étaient éliminés et si la discussion devenait entièrement transparente, on ne pourrait obtenir une réponse unique s’imposant à tous. Ainsi, à la question 5a, on peut insister ou sur l’enrichissement sans cause du concessionnaire ou sur le fait que personne n’est forcé d’accepter ses conditions, et il est difficile de montrer qu’il faille trancher plutôt dans un sens ou dans l’autre. Ces espaces d’indécidabilité incompressibles sont au fondement même de la politique : aucun argumentaire ne peut par exemple déterminer les meilleures limites de la contrainte publique en matière de lutte contre le tabagisme. C’est pourquoi dans un cas comme celui-là la raison du plus fort politiquement tend à être la meilleure. Mais autant il est indispensable de souligner l’existence de ces espaces d’indécidabilité, autant l’on doit se garder de considérer que toutes les questions axiologiques en relèvent. On peut noter au passage que c’est sur cette hyperbole que se fonde souvent le nihilisme axiologique des “post-modernistes”. Conclusion Des habitudes de pensée contractées sous l’influence des empiristes, des positivistes et des différentes variétés de théories réductionnistes des valeurs ont occulté quelques propositions simples mais essentielles, à savoir que les convictions axiologiques comme les convictions assertoriques tendent à s’appuyer sur des argumentaires aussi solides que possible. Une conviction morale ne saurait être vécue comme telle par un sujet qui n’aurait pas le sentiment qu’elle est justifiée par un système de raisons solides et par là communicables.
Can axiological statements be grounded in the absence of dogmatic beliefs ?
277
Ce postulat est présent dans la sociologie de Tocqueville comme dans celle de Weber : les croyances axiologiques doivent s’expliquer par la force des raisons que l’acteur social a d’y croire. Il explique l’efficacité de l’une et de l’autre s’agissant de l’explication des croyances axiologiques. Ce même postulat se retrouve au fondement de la philosophie “contractualiste”. Sa force explique sans doute aussi l’importance qui a été accordée à la théorie de Rawls. Adoptant le point de vue de la philosophie contractualiste, elle repose en effet sur l’idée que les sentiments de légitimité ou d’illégitimité qui s’attachent aux institutions et aux décisions politiques s’appuient sur un argumentaire que des juges impartiaux endosseraient à l’unanimité. D’un autre côté, la tradition contractualiste présente une faiblesse majeure : celle de croire que l’ensemble des jugements de type “cela est bon, légitime, recevable” peut être déduit d’un système unique de principes simples. Cette faiblesse affecte aussi bien entendu la tradition kantienne. Les études “empiriques” sur les sentiments moraux, comme celles que j’ai évoquées dans la dernière partie de cet article, suggèrent quant à elles que l’on peut conserver de ces traditions l’idée que les argumentaires associés aux convictions morales doivent être conçus sur le modèle des systèmes de raisons associées aux convictions assertoriques. En revanche, elles suggèrent clairement que les sentiments moraux ne peuvent être déduits d’une axiomatique unique, mais plutôt, comme dans le cas de l’assertorique, de “théories”, i.e. de systèmes de raisons capables d’épouser la diversité et la complexité des situations concrètes. Les mêmes études suggèrent aussi que, pas plus que les convictions assertoriques, les convictions axiologiques ne sont dépendantes de l’existence de croyances dogmatiques. Enfin, elles font bien sentir l’importance du ciment moral dans l’ordre social. Ce ne sont pas seulement les discussions ou les événements politiques majeurs qui sont soumis par le citoyen au crible de l’argumentation morale; les événements les plus prosaïques et les plus mineurs de la vie de la cité provoquent aussi un flux continu d’appréciations et de réactions morales. En tout cas, les sujets de Kahneman et de ses collaborateurs paraissent ne manifester aucun doute sur deux points: que le légal ne coïncide en aucune façon avec le légitime, i.e. que les décisions sur lesquelles le droit est
278 muet sont jugées d’un point de vue moral, et que le jugement moral peut normalement prétendre à l’objectivité. Finalement, la théorie cognitiviste que j’ai ébauchée ici permet peut-être de donner un contenu à la “raison communicationnelle” de Habermas, puisqu’elle avance que, comme les convictions assertoriques, les convictions axiologiques se fondent sur des systèmes de raisons visant à être aussi objectives et par suite communicables que possible.
Notes: 1 Boudon, R. “Le pouvoir social : variations sur un thème de Tocqueville”, (Communication présentée devant l’Académie des Sciences morales et politiques, le 16 novembre 1992), Revue des Sciences Morales et Politiques, 1992, 4, 531-558 et Commentaire, été 1993, nE 62, 311-322. 2 Et aujourd’hui d’un H. ALBERT, “Der Sinn des Lebens ohne Gott”, in Hörster, N. (ed.), Religionskritik, Stuttgart, Reclam, 1984, 119-28. 3 Au sens de Luckmann, T. Die unsichtbare Religion, Frankfurt, Suhrkamp, 1991. 4 Habermas, J. Moralbewusstsein und Kommunikatives Handeln, Frankfurt, Suhrkamp, 1983, p.53 ; tr. fr.: Morale et communication: conscience morale et activité communicationnelle, Paris, Cerf, 1986. 5 Merton, R., Science, Technology and Society in Seventeenth Century England, New York, Howard Fertig, 1970 (1938). 6 Habermas, J. Theorie des kommunikativen Handelns, Frankfurt, Suhrkamp, 1981, 3e ed. 1985; tr. fr.: Théorie de l’agir communicationnel, Paris, Fayard, 1987. 7 Habermas semble parfois subodorer cette réponse. Ainsi il évoque occasionnellement l’idée que la validité puisse émaner de la “pratique argumentative” ( “Argumentationpraxis”), Faktizität und Geltung, Frankfurt, Suhrkamp, 1992, p.565. 8 Toqueville, A. de. L’Ancien Régime et la Révolution, 1856; Paris, Laffont, 1986. Livre 3, Chap. 1 à 3. 9 Borhek, J.T. et Curtis, R.F. A sociology of Belief, New York, Wiley, 1975. 10 Lakatos, I. “Falsification and the Methodology of Scientific Research Programs” in Lakatos, I. et Musgrave, A (ed.) Criticism and the Growth of Knowledge, Cambridge, Cambridge University Press, 1974, 91-196. 11 Rawls, J. A Theory of Justice, Cambridge MA, The Belknap Press of Harvard University, 1971; tr. fr.: Théorie de la justice, Paris, Ed. du Seuil, 1987 (préface propre à l’édition française). 12 “Nicht nur unter Philosophen und Juristen, auch unter Oekonomen hat sich ein Diskurs eingespielt, der an Theoreme des 17 und 18. Jahrhundert so ungeniert anknüpft als brauche man von der sozialwissenschaftlich Entzauberung des Rechts keine Notiz zu nehmen”, Faktizität und Geltung, op. cit., p.79. À propos du contractualisme, il commente : “diese unwahrscheinliche Idee”, Ibid. , p.63 13 Ranulf, S. Moral Indignation and Middle Class Psychology; A sociological Study, Copenhagen, Levin & Munksgaard, 1938. 14 Boudon, R. “Libéralisme et pluralisme selon John Rawls”, Analyses de la Société d’Études et de Documentation Économiques, Industrielles et Sociales, sept. 93, nE95, 1-9.
Can axiological statements be grounded in the absence of dogmatic beliefs ?
279
15 Kahnemann, D. Knetsch, J.L Thaler, R. “Fairness as a constraint on profit seeking: entitlements in the market”, The American Economic Review, sept. 1986, Vol. 76, NE4, 728-42.Voir aussi Boudon, R. “L’objectivité des valeurs”, in: S. Langois, Y Martin (ss.ladir.de) l ´horizon de la culture, hommage a Fernand Dumont, Sainte Fey (Quèbec) , Les Presses de l`Université Laval 1995, 217-236. article à paraître dans un volume d’hommage à F. Dumont et “La logique des sentiments moraux”, L’Année sociologique, 1994 (à paraître).
280
RaimoTuomela Rational Cooperation and Collective Goals
abstract It is argued that full-blown cooperation needs collective goals in a strong sense satisfying the “Collectivity Condition”. According to this condition, a collective goal ist of the kind that necessarily, due of the goal-holders acceptance of the goal as their collective goal, if it is satisfied for one of the goal-holders it is satisfied for all the others. Not only collective goals but also other group-factors (such as possibly institutional “group-mode” preferences and utilities) are argued to be relevant to rational cooperative solutions of collective action dilemmas.
I Introducing Rational Cooperative Action The purpose of this paper is to discuss the notion of rational cooperation and particularly under what conditions it is rational to cooperate. In part the discussion will make use of game-theoretical notions and results, but with an emphasis on conceptual rather than technical issues. I will take cooperation in its full sense to be collective activity requiring the shared pursuit of a collective goal. “Quasi-cooperation”, however, is a weaker notion of cooperation that only requires action towards shared personal goals (which fall short of constituting a collective goal). Quasi-cooperation is the kind of cooperation that is typically meant when cooperation and defection in the context of collective action dilemmas (such as exemplified by the Prisoner’s Dilemma situation) are considered. Cooperation can concern both single-agent actions and collective (as well as joint) actions. The main new idea or point in this paper is the elaboration of the idea that one’s reasons for cooperative action can be either “merely personal” (or “individual”, but still possibly highly social) or “collective” (or “group-related”). Collective reasons are relevant to attempts to resolve the conflict between individual rationality and collective rationality involved in collective action dilemmas.
Rational Cooperation and Collective Goals
281
When a group of persons rationally accepts a collective goal and acts together to achieve it, we are dealing with full-blown cooperation (this will be clarified in Section II). Each participating agent is supposed to contribute to the collective goal, acting together - at least in a broad sense - with the other participants. A single agent’s contribution can accordingly also be called cooperation. We may ask what such rational contribution really is and under what conditions cooperation is rational. In this paper I will mainly operate with a notion of “strictly” rational action. This is the normative notion according to which rational action is not action performed for good prudential reasons but action which is best or optimal for a certain agent or agents in a certain situation relative to the resources (including normal human abilities) available. This notion can be spelt out in more detail for action-tokens (of a type C, say) as follows: R) A cooperative single-agent action (viz. action-token) performed by an agent A in a situation S was (strictly) rational for A if and only if a) it was “correctly” grounded in A’s rational intentions (and goals), references, and beliefs, and b) it maximized his expected utility in S, taking into account both his private (viz. merely personal) goals and preferences and his collective goals and preferences. What we are dealing with here is the comprehensive rationality (not only instrumental rationality) of a cooperative action token by a single agent. (I will not discuss the case of rational cooperative joint action in detail in this paper.) Analysis R) relies on the notion of cooperation, which will be clarified below. As rationality is a very broad notion and can be taken to include actions which merely “satisfies” some relevant rationality criteria, the above analysis must be taken to concern the strict notion of rationality - rational action as something not prudentially improvable in the circumstances in question. The correct applicability of the predicate ‘rational’ accordingly is a different matter, for which clauses a) and b) are sufficient but not necessary. The present paper concentrates almost solely on b) - which by itself certainly is a broad enough topic. This clause concerns instrumental rationality, and also takes into account collective rationality. Clause b) entails that the
282 agent believed that he was acting in accordance with his (want-based) preferences, or, speaking technically in terms of quantified preferences, was maximizing his expected utilities by acting.1 According to clause a) his belief must be rational, but not necessarily true. A rational belief is one acquired using well-known rational methods of reasoning and adequate corrective procedures, but the demands of rationality must allow for the psychological limitations of normal human beings. Rational goals are supposed in general to respect the agent’s preferences, except that collective action dilemmas make this a problem because of a conflict between the agent’s merely personal and collective preferences (see below and Section IV). Clause a) is supposed to make the action rational in a comprehensive sense also concerned with “endrationality”, “value-rationality”, and “expressive rationality”. The idea is, of course, that the agent’s action-generating intentions, goals, and beliefs should adequately reflect his society’s and culture’s (rational) values and norms as well as his basic underlying needs. (For an account of some central features of the “well-groundedness” conception of rational single-agent action, see e.g. Föllesdal, 1982, Audi, 1985, and for the rationality of beliefs in a strong gametheoretic sense see Bicchieri, 1993.) Part of the discussion below will be concerned with defending and explicating the following thesis: T) One may cooperate for one’s personal reasons (which are allowed to be other-regarding) or for one’s group, and these two reasons, viz. the groupreason (or collective reason) and the private (or mere personal) reason, may be in conflict with each other (serving to create collective action dilemmas). T) may not be new in itself, but it will be illustrated and defended by using some new considerations. If a reason or the reasons for which one acts are rational or “good”, we can speak of rational action in a non-instrumental sense, as clause a) of R) does. Clause b) makes the action rational in an instrumental sense. Corresponding to T), actions can be to various degrees group-rational actions and merely personally rational. For instance in a Prisoner’s Dilemma (PD) situation performing C (“cooperation”) and performing D (“defection”) are both rational in their own, incompatible ways. Thus C is group-rational at least in an instrumental sense - and D is personally rational - at least in an
Rational Cooperation and Collective Goals
283
instrumental sense. I will use PD, one of the nastiest strategic situations, to illustrate my main points as we go along. For a very simple example of a PD consider the following two-person two-choice outcome matrix: B C
D
C 3,3
-1,5
A D 5,-1 0,0 The joint outcomes are thus ranked - in a personal, non-collective sense - by the players as: DC, CC, DD, CD. Collective action dilemmas are dilemmas between, so to speak, “collective and individual rationality” as exhibited by PD and other related game-situations (such as Chicken and the Battle of the Sexes).2 I will argue below that in some circumstances it is rational for the participants to cooperate by choosing C even in a “single-shot” case, especially when groupfactors are heavily emphasized. II Collective Goals and Cooperation According to the view I defend in my recent work (Tuomela, 1996b), cooperating (viz. intentionally cooperating) means acting together intentionally either in the pursuit of an intended collective (or, more specifically, joint) goal or in the pursuit of an intended personal goal. Our writing a joint paper or singing a song together are examples of cooperative joint action in the pursuit of an intended joint goal. In such joint action each participant cooperates by performing his part of the joint action. Two drivers can cooperate by jointly removing a tree fallen across the driveway and preventing the drivers from getting where they want. This is an example where cooperation has more the character of a joint means to different personal goals rather activity towards a preplanned joint goal. The joint or collective action with respect to which the agents cooperate may accordingly be a goal in itself or (inclusive “or”) it can be a means for the agents to achieve their shared collective goal, when such a goal exists in the situation in question, or their personal goals. Whichever of these
284 three possibilities concerning further goals is involved, the joint action in question can in any case be regarded as at least a proximate goal - telos - that the agents share. Thus it is possible to say that when cooperating they share an intended collective goal - at least the same joint action with regard to which they cooperate. A cooperative situation can be viewed in terms of the practical reasoning the participants are supposed to be disposed to perform (cf. Tuomela, 1995, Chapter 3, for a fuller discussion). Concentrating on two basic “bare-bones” patterns and leaving out the fine points, let us consider a situation in which the participants cooperate towards a collective goal G. When in a reflective mood, they can collectively be taken to reason (more or less) as follows in a certain situation: CPR) i) We intend (rationally) to achieve collective goal G. ii) We mutually believe that the best way for us to achieve G here is to collectively perform action X. iii) Therefore, we intend to perform X. Each single participant is personally assumed to be disposed to reason thus: PPR) a) We intend to perform X collectively. b) Therefore, I intend to contribute to G by performing my share of X, viz. the best way I can contribute to G. We note that i)-iii) concern the members of the group collectively, in a “chorus sense”, while a) and b) relate to one single member. Clause b) is understood to entail that the reason for his intention to contribute is his acceptance of a), viz. the collective intention to perform X collectively, this in turn having as its central reason the members’ acceptance of the collective goal G. Note here that the schema CPR) becomes logically binding only if the participants are taken to understand that the rational achievement of a goal
Rational Cooperation and Collective Goals
285
entails performing actions which are best, viz. utility-maximizing, for G. (Note that there are other possibilities for premiss ii), e.g. X could be regarded as necessary for G; see Tuomela, 1984, Chapter 11.) More about the general nature of cooperation can be argued for. Thus all full-blown cooperation must not only involve commitment toward a (cooperative) collective goal or plan but the participants’ underlying interests or preferences, qua participants of the action, had better be positively, if not highly, correlated. In other words, commonality of interests serves to make the action situation cooperative by nature (by making additional and “supererogatory” activities contributing to the collective goal desirable and rational). Furthermore, the cooperative nature of an action is enhanced if the participants act out of a cooperative attitude. (See Tuomela, 1993 and 1996b, for a discussion of these features.) In a nutshell the following is an acceptable thesis about cooperation: C) Two or more actors cooperate in the full sense of the notion if and only if they share a collective (or joint goal) and act together in order to achieve that goal. Cooperation is rational in the comprehensive sense if the collective goal is rational and the collective means-action is also rational (in the context of strict rationality: utility-maximizing). Thesis C) is a rough statement of what cooperation in a general but full-blown sense can be taken to involve. However, this thesis must be understood broadly enough to be compatible with the claim that not all cooperation need involve acting towards a collective end-state. The truth of this claim is based on the possibility of cooperation which only involves shared activity - a collective action-goal - but which shared activity does not purport to lead causally to a collective end, only to personal ends or no ends separate from the action at all. Note, too, that cooperation in the sense of C) does not require an agreed-upon joint plan. Thesis C) centrally relies on the notion of a collective goal. A summary analysis of the full-blown notion can be given as follows (cf. Tuomela (1996a): (ICG) G is an intended collective goal of some persons A1,...,Am forming a collective C in a situation S if and only if G is a state or (collective) action such that
286 a) each member of C has G as his goal in S, entailing that he intends to contribute (at least if “needed”), together with the others, as specified by the mutually believed presupposition of the shared goal G - to its realization; b) part of each member’s reason for a), viz. for his having G as his goal, is that there is a mutual belief (entailing iterable loop beliefs of the kind “A believes that B believes that A believes such and such”, for all A and B) among them to the effect that a); c) if G is satisfied for a member Ai of C, then, on quasi-conceptual grounds, it is satisfied for every member of C; and this is mutually believed in C. (Collectivity Condition) I have suggested that this analysis gives the strongest viable notion of an intended collective goal which does not involve full-blown joint intention. It is based on personal intentions in the “we-mode”, viz. with the collective content of acting together.3 It also makes the personal intentions responsive to mutual belief (common belief, in the game-theorist’s vocabulary). However, this is a requirement that we need to impose only on full-blown cases. The analysis (ICG) makes the intention (goal) collective not only in the sense of involving acting together but also in the sense (which also joint intentions and joint goals satisfy) of “all for one and one for all”. This is spelt out by the central clause c), the Collectivity Condition. Let us consider it briefly (drawing from Tuomela, 1996a, below). Consider a familiar example like getting street lights in our village. When this goal has been achieved (in accordance with whatever the participants have presupposed of the goalsatisfaction) every villager’s collective goal of getting street lights has been (nonaccidentally) satisfied. The satisfaction of clause c) is an important feature of an intentions’s being a collective one. I wish to emphasize that the satisfaction of a collective intention requires more than the mere coming about of the contentstate - it must come about from collective action as presupposed by the participants. The participants can be said to construct collective goals by their conceptual activities, by their collective acceptances and allowances. In our street light example, they must collectively bring about the goal in order to satisfy it. What if only one of us gets the street lights? This process leads to proper satisfaction
Rational Cooperation and Collective Goals
287
of the collective goal only if the participants have somehow authorized the person to do it - or, to use my earlier terminology, only if this is allowed by the presupposition of the collective goal. I will say below that one can have a goal (one and the same state or action) either in the private (or merely personal) mode, viz. the “I-mode”, or in the collective mode, the “we-mode”, the central difference being that the we-mode attitude brings about the satisfaction of the Collectivity Condition satisfied while the I-mode attitude does not.4 Whether the situation or state whose existence the satisfaction of the goal G conceptually guarantees can be somehow utilized by all persons having had G as their goal is a different matter. If we have as our collective goal to provide i) streetlights or ii) a barrel of whisky for our village we can say that the satisfaction of a goal is supposed to be rewarding per se, since if you get what you want (viz. G) that is personally rewarding. Thus the provision of i) or ii) is rewarding to all who had the goal in question (and for those who did not succeed in their attempts to help to bring the goal about), irrespective of whether they can make use (be beneficiaries) of the state resulting from the provision of the goal. My analysis does not take a stand on this. The matter depends on what the members of the group decide or accept about the situation. This matter is independent of whether the goal is “indivisible” (or, equivalently, “in joint supply”) as in case i) or “divisible” (case ii)) in the economists’ sense. Thus, as economists typically define public goods in terms of the conjunction of the ontic feature of indivisibility and the “accessibility” feature of non-excludability, a collective goal in my sense can be either a public or a non-public one. Rational cooperation in the full sense was taken to be based on rational collective goals. In this paper this rationality feature cannot be properly discussed. I will, however, impose the condition that a rational collective goal must be an equilibrium (a Nash equilibrium) in the game-theoretical sense. It must, in other words, be the state resulting from the agents’ best responses to the other persons’ best responses. An equilibrium state is accordingly one in which no participant has an incentive to deviate, given that the others do not. We can see that by itself my analysis ICG) almost entails that G is an equilibrium outcome. This is seen by noting, first, the following result of game
288 theory: in a choice situation in which i) each participant is rational (viz. a utility-maximizer) and in which ii) the participants have mutual beliefs about each the others’ strategy choices, the choices constitute a pure-strategy (Nash) equilibrium (see Brandenburger, 1992, p. 90). Note that clause b) of ICG) assumes that the participants not only have a true shared but even a true mutual belief about the means-action for G (cf. ii). Assuming next that our participants are rational utility-maximizers (cf. i)) we arrive at the result that a collective goal G is a Nash equilibrium outcome (but in general not conversely; cf. note 9). Assumptions i) and ii) seem fairly realistic. Thus it is not rare that collective goals in our full sense are stable in the precise sense of a Nash equilibrium. We can in addition discuss the desideratum that collective goals be individually rational, viz. that achieving them improves on what the individuals can achieve separately. Achieving this may sometimes involve changing the situation appropriately so that a contained collective action dilemma is solved (think of a case where free-riding is made very costly to individuals by sanctions). There are weaker kinds of cooperation, including quasi-cooperation. For instance, cooperative activity based on reciprocity, where no collective goal but only personal goals need to be present, represents quasi-cooperation. What is discussed under the heading ‘cooperation’ in game-theoretical literature normally or often belongs here. This actually is the sense of cooperation I will discuss at length below. A brief summary of the two-person case goes as follows (cf. Tuomela, 1996b):5 (COINT) Two agents A and B interact quasi-cooperatively if and only if a) they fit their relevant private (or merely personal) goals, preferences, and actions to the other’s private goals, preferences, and actions; but b) they do not have a joint or collective goal related to the actions in question. (Alternatively, if one wants a broader notion, one could say in clause b) that A and B do not have to have a collective goal.) Here each of the participants can be said to quasi-cooperate when they interact quasicooperatively. This would cover mutual cooperation in a collective action dilemma. We can of course also speak of unilateral cooperation in such a dilemma and allow that a) holds true of only one of the agents.
Rational Cooperation and Collective Goals
289
In game-theoretical literature one also finds uses of ‘cooperation’ which have hardly anything to do with the intuitive notion. Thus one may more or less arbitrarily label one of the choices ‘C(ooperation)’ and the other one, in a two-choice case, ‘D(efection)’, perhaps, however, requiring that the mutual Cchoice outcome be Pareto-preferred to the mutual D-choice outcome. In this highly liberal use cooperation does not even require taking into account what the other person wants (over and above what is given by the mutually known preference or utility structure). III The Rationality of Cooperation and Quasi-Cooperation In this section, and in the rest of the paper, I will mainly operate within a gametheoretical setting and concentrate on so-called non-cooperative games, in which no agreements between the players are made. I will present below a schema for collective action dilemmas showing a number of relevant parameters - viz. parameters which will help to answer the question “Under what circumstances is it rational to cooperate?”.6 Here cooperation will be mostly quasi-cooperation, but full-blown cooperation requiring a collective goal may be involved. I will view the situation mainly from a single participant’s point of view, which makes it possible to speak of one-sided cooperation as well. In this section I will concentrate on merely personal reasons for cooperation. These reasons can be highly social, but it is not assumed that the participants share a collective goal in the full-blown sense. They may, however, share a goal in a personal sense (which does not satisfy the Collectivity Condition). As stated, I will concentrate on a game-theoretical situation of strategic interaction in which the participants actions are dependent on each other with respect to the outcomes. A finite non-cooperative game in “strategic” (or “normal”) form consists of a) a finite set of players and, for each player b) a finite set of choices and c) consistent preferences concerning them represented by a payoff or utility function associating a payoff to that player with every specification of choices by all the players. The agents are also assumed to have d) subjective conditional point probabilities about each other’s actions.7 They are also assumed to have mutual beliefs about a)-d).
290 We can, more generally, take the participants’ preferences to be about the entities in the situation they “care about”. These entities may be a selected set of joint outcomes or goals or conglomerations of actions together with their outcomes, or something else relevant (see Tuomela, 1984, Chapter 12, for a discussion). Thus in a simple two-person two-choice situation (on which I concentrate) in a PD case I will simply speak of the four joint outcomes CC, CD, DC, and DD as the entities valued by the agents. This kind of talk may mean several things, particularly the whole mutual action-process with a certain intended and expected joint outcome. Thus agent A’s action of choosing C and carrying it out accompanied by B’s action of choosing D and carrying it out together with the resulting joint outcome CD is the entity assumed to be valued by the agents from their own perspective (“in the I-mode”). The joint outcome may but need not involve their shared goal. Assumptions a) -d) are problematic as they are generally unrealistic and as there are technical problems involved with the various approaches to formalizing preferences and degrees of belief. Ordinary folks simply cannot be modeled so that often - as studies by psychologists (such as Tversky and Kahneman) show or seem to show. Since however my present topic is rational action one may better be excused to use the mentioned kinds of formal tools. (A validity problem, which I cannot really discuss in this paper, still remains.) I will start by considering personal utilities relevant to situations of strategic interaction. In the next section I will consider how to take collective preference and group utilities into account, but for the time being I will work with the “Imode” utilities rather than the “we-mode” utilities, reasoning, and acting. I will consider some parameters representing reasons for rational (in the comprehensive sense) intention formation and action in problematic cases, viz. cases involving a conflict between collective and individual rationality. In terms of these parameters it is also possible to formulate decision-making criteria for when to cooperate rationally and when not. Suppose we are concerned with the bringing about of a goal-state G. In this “single-shot” case (which may be the sole case of its kind) G can in principle be either a public good or a private good. The production of G gives a certain amount of utility to the participants in the situation. This can be any kind of
Rational Cooperation and Collective Goals
291
utility. I will here be concerned with the situational factors affecting a person’s utilities concerning his participation in the production of G - this is typically a collective action dilemma situation. I will be concerned with quasi-cooperation, which only needs to involve a state, G, which is wanted (actually, wanted first and foremost) by some agents who are disposed to strive for this goal, depending on the “costs” involved. The goal-state G thus is assumed to be personally wanted by the agents; it need not be a state they have personally committed themselves to achieving (and thus intend to achieve). Still less need it be a state they jointly or collectively want or intend in any interesting sense (they need not have, for instance, explicitly or implicitly agreed to achieve the goal-state together). To simplify the exposition, I shall impose some further, easily removable restrictions. Assume first that G is an “indivisible” and non-excludable public good, viz. a good whose use or consumption does not reduce the amount available to others and which is made available to all the members of the collective in question. Next, G is taken to be a step-good in the sense that it requires the participants to perform their parts to come about at all. I also assume in my technical comments that there are only two participants with two possible choices (C and D). Furthermore, I will begin by assuming that G can be produced even alone but that, assuming a fixed total collective cost, the individual cost of producing it alone is higher than when it is produced together. Let u be the gross reward (utility) that a participant receives when G is produced, whether alone or together. What I call a reward here is meant to be understood in a broad sense to include persons who act out of duty or moral principle or, more demandingly, act because of the validity of a normative principle. In the limiting case of Kantian unconditional cooperators there is also a kind of reward related to his ranking cooperation higher than defection, possibly in a somewhat figurative sense. The utility u can be a transformed utility (in the sense of Kelley and Thibaut, 1978, and Chapter 12 of Tuomela, 1984), but it need not yet be the utility on which our agent acts. Even if u were an other-regarding gross utility, in an actual situation of action new elements not explicitly considered previously must be taken into account.
292 As earlier, the utilities dealt with here apply to the actions (achievementactions, including the outcomes). Thus, so to speak, they give values to the whole action process leading to a given outcome. The actions can, furthermore, be understood as described in a way that takes the reasons for which they are performed into account. For instance an agent can perform a “cooperative” action, C, for a rational reason, which might even be or include the reason that he wants to show that he is a cooperative person by performing it. I will not here discuss these factors but simply remind the reader that my framework allows for their inclusion. I will assume that if G is produced alone, only one of the participants contributes (C) while the other defects (D). Assume, for simplicity’s sake, that there is a fixed (material and/or psychological) cost, c, of producing G. When G is produced by both of the participants jointly there will be a jointness effect or an interaction effect, say j, which can be negative in some cases. On the whole, j can be taken to represent at least the reasons for cooperating a) for the sake of cooperation, b) because one normatively ought to (be this a personal or a social norm), c) out of friendliness, and last but not least it can express d) various “consequentialist” factors (e.g. cooperate because in this situation cooperation has good consequences in being necessary or being in some sense useful). Category d) is obviously a large one. Factors a)-d) can coexist and exist to various degrees. I will not try to speculate here on how they might combine to result in a single numerical index j (even if this is not always possible, let us simplify the situation and assume here that it is). In general, j is a function of the costs and a net interaction effect, say i. For instance, if the two of us carry a table upstairs together the total cost of achieving the goal that the table is upstairs can be much less than when one of us alone carries it. Furthermore, we may be able to do it more effectively and to cause less damage to the walls doing it together: i here represents the net gain from both of the agents’ action rather than only one. We may accordingly have an interaction effect - positive or negative - both with respect to costs and with respect to what is achieved by joint action. We need not here take a definite stand on what kind of function of i and c the parameter j in various cases is, but will here assume for the purpose of facilitating our discussion that it is simply
Rational Cooperation and Collective Goals
293
a sum of the kind j= c/2+i. Thus, when both participants contribute they will both receive the payoff u+j less c/2 (assuming equally shared cost for simplicity’s sake). In part then j involves the gain of c/2 as compared with the case of producing X alone (with cost c). (Two persons cannot each produce the good related to X separately, since once produced the good cannot be reproduced.) The case of two participants taking part in the production of the public good involves two possibilities. They can do it together (intentionally) or separately. The interaction effect i should in a finer analysis be decomposed into two components to account for these possibilities. If separate two-person production is concerned there may - in spite of the separateness concerning the production intentions - still be a factual interaction effect, but full joint production can involve an additional effect from coordination. I will for simplicity not make explicit use of this possibility of decomposing i here. Next we consider the possibility that one of the agents, say A, defects. Supposing that X can be performed alone and that the other participant’s contribution here amounts to performing X alone, the free-rider will then gain a certain amount f by his defection, viz. from switching from C to D. Alternatively, f can be regarded as a free-rider effect or a free-rider incentive. What happens when A contributes while B defects? Then A has to produce X alone, and that may of course be much more costly for him than performing it jointly with B. The sole contributor has to pay cost c rather than c/2, but A may lose more since he may also psychologically and socially lose something from the very fact that he (correctly believes he) is being cheated or is a “sucker”. We will denote by s the total loss (viz., the extra effort plus the sucker effect) accruing to A from his being the sole contributor. Factor s can also have a positive value in that the sole contributor may view herself as a good person or something like that. (In principle there could also be other higher-order effects while A’s utility may be affected by his thought that he is being cheated by B, this fact may in turn affect B’s utility, and so on. But I shall not consider these possibilities here.) There is also a normative aspect of free-riding. In normal collectives there is a social norm barring free-riding (cf. Chapter 1 of Tuomela, 1995, on social norms of two different kinds). At any rate, any collective goal by itself
294 presupposes and thus entails that the goal-holders ought to contribute. Informed and rational participants accordingly will think that they ought to participate in the performance of X. If they do not, they face social sanctions (disapproval) and perhaps experience such sanctions as feeling of guilt (a psychological expression of the sanction from deviating from the accepted norm of cooperating) or shame (a psychological consequence of social disapproval of not acting in accordance with the normative expectation of cooperation). Thus there is a negative normative effect, sometimes a moral one, from defection, given that there was an obligation or at least a normative pressure to contribute. I will denote the effect of social sanctions by m. In the case of mutual defection this social sanction may be nonexistent or at any rate may have a different value. We let the mutual defection utility, including the social sanction effect, be m*. I will now write out the various sources of utility in the form of a diagram and in doing so make two assumptions: i) the utility factors can be linearly totaled as net utilities, and ii) these factors can have negative values; thus no minus signs need to be used. What we now get is the following, assuming that the participants are in a symmetrical position with respect to their payoffs, and writing out only participant A’s payoffs: B C
D
C
u+j
u+s
D
u+f+m
A m*
When should a rational agent A contribute (cooperate, choose C) rather than defect or act separately? Suppose he ascribes the following subjective probabilities to B’s actions: p(CB/CA) = p1, p(CB/DA) = p2, p(DB/CA) = p3, p(DB/DA) = p4. Now we can compare the expected payoffs for C and D accruing to A: EU(C) = p1(u+j) + p3(u+s) EU(D) = p2(u+f+m) + p4(m*)
Rational Cooperation and Collective Goals
295
If A acts on his preferences he will cooperate rationally in the production of G by choosing C if and only if EU(C) > EU(D). Consider now our earlier example of a Prisoner’s Dilemma (I now write out both participants’ utilities): B C
D
C 3,3
-1,5
D 5,-1
0,0
A Our relevant parameters might now get the following values: u=4, c=-4, i=1, s=-5, f=1, m=m*=0. We could also make m=m*=-1/2 and subtract one half of a point from the defection line values without changing the nature of the game. The - or a - standard “external” solution of a PD goes in terms of norms. For instance, if we can bring it about that m=m*=-3 the cooperative action C will dominate defection, and a kind of resolution of the collective action problem in question has been arrived at - see Section VI for more comments.8 However, we can arrive at the result that EU(C) > EU(D) for some suitable probability values without changing the structure of the game. I will next show this in the context of another issue. In general, utility transformations change the preference structures involved and lead to new, more palatable and friendly games. I will not discuss such transformations here in detail (see Kelley and Thibaut, 1978, and Tuomela, 1996b, Chapter 8). Let me, however, mention one special case involving the transformation of objective payoffs into S-shaped utilities. We start with a PD with either objective payoffs such as money, or possibly with some other objective utilities - e.g. institutionally and normatively defined utilities. These given utilities are transformed into realistic, S-shaped final utilities in accordance with what experimental research tells us. In such a situation, agreeing with experimental research, in some cases we have the result that while the expected utility of defection is greater than that of cooperation in the case of the original payoffs, in the case of the S-transformed utilities cooperation wins, given suitable probability assignments. (See e.g. Tversky and Kahneman, 1992,
296 and Dacey and Gallant, 1995, and Tuomela, 1996b, for a discussion and references.) Similar observations as above can be made in the case of at least some other dilemmas of collective action (e.g. Chicken). It can be shown in the case of twoperson games that if the participants share their knowledge of the structure of the game, the rationality of the players, and about the above kind of probabilistic beliefs, then we get a mixed strategy equilibrium; full-blown mutual knowledge (“common” knowledge in game-theoreticians’ terminology) is not needed (see Brandenburger, 1992). In many cases mutual cooperation can be such an equilibrium. IV I-Mode Utilities and We-Mode Utilities I will distinguish between personal utilities and group utilities. Personal utilities can be other-regarding, but they are still assumed to be distinct from group utilities. In the present context these will be assumed to be based on collective preferences defined over joint outcomes in situations of strategic interaction or to be based on goals generated by joint outcomes. In order to keep things simple (my purpose being to illustrate conceptual issues rather than try to be very realistic in all ways), we will then deal with group preferences such as CC being regarded by the group as preferable to DD in a two-choice two-agent game with C and D as the choice possibilities. Next, and this is crucial, I will assume that each participant has group preferences of this kind. A and B being the participants, both A and B then are assumed to have preferences concerning joint outcomes. Suppose we are dealing with a PD situation. Let us call merely personal or individual preferences i-preferences and group preference or collective preferences g-preferences. In our earlier terminology i-preferences are I-mode preferences and g-preferences are we-mode preferences. In the case of a PD both agents then take the joint outcome CC to be both i-preferable and gpreferable to DD. Here g-preference means that the group (here a dyad) prefers CC to DD. In part because of this, each member of the group qua a group member, also prefers at least in the ideal case, and we now can say g-prefers, CC to DD (cf. schema PPR) of Section II). Each group member thus thinks that it is better for their dyad that CC be realized than DD. In a PD this g-preference
Rational Cooperation and Collective Goals
297
happens to coincide with the person’s i-preferences concerning the outcomes in question, as CC is Pareto-preferred to DD. Each participant thus i-prefers what he personally “gets” from the joint outcome CC to what he personally gets from the joint outcome DD. This is a clearly different preference from his collective preference for what the group (the participants in toto) gets from the joint outcome CC over what it gets from DD. Note that a participant might prefer outcome CC over DD not merely because of his selfish or self-regarding reasons, but because he other-regardingly i-prefers CC to DD for the reason that the sum (or product, or both) of the participants’ utilities from CC is greater than that from DD. I wish to emphasize that this is still an i-preference in my present classification and fails to satisfy the Collectivity Condition. Even if all the participants have as their mutually believed goal, say, to maximize the sum of their utilities with the sider that no one falls to the sucker-level, that need not satisfy the Collectivity Condition. Even if all participants accidentally chose C, that would not amount to their acting together in choosing C. This is because they would not intentionally act (choose C) so as to satisfy their collective intention to maximize the utility sums together. They would only act to satisfy their personal intention to maximize the utility sums, the other agents being regarded as contingent parts of their surroundings, as it were. Group preferences for outcomes and goals may of course be discussed from the point of view of their rationality, and rationality desiderata may be imposed on them. Thus, if a group prefers a collective goal G to another goal G’ this must somehow be reflected in the group members’ personal g-utilities. For instance, either the sum or the product (or both) of the personal utilities of G may be larger than the respective sum or product (or both) of the utilities of G’. Take the utility sum case: each agent then has the sum as his utility, and maximization of this utility of course means choosing an action in favor of G rather than G’; in the case of our PD it means mutual choice of C. Note that as we are dealing with two different kinds of preference orderings here, presumably only the i-utilities would give a PD. The g-preferences could go in many different ways, except that the CC outcome would be preferred to the
298 DD outcome (for instance, the group might or might not prefer CD and DC to CC). If a reason or the reasons for which one acts are good we can speak of rational action in the comprehensive sense. An action can be made rational by g-reasons and an incompatible action can be made rational by i-reasons. Thus, in the two extremes in a PD situation, doing C (“cooperation”) and doing D (“defection”) are both rational in their own incompatible ways (assuming what has been said above about the relations between g-preference rankings and ipreference rankings). I will discuss two technical ways of implementing this general idea. First, I suggest we can combine personal utility maximization and group utility maximization, for simplicity, by a linear combination (this may not be the only feasible way of combining them) and use the index i for individual or merely personal and g for collective. Thus the suggestion is to use the following formula for the basis of decision-making: EUt(X) = wiEUi(X) + wgEUg(X) Here EUt(X) means the total expected utility of a choice X for a participant in a situation of strategic interaction. The weights, viz. the individual or iparameter wi and the collective org-parameter wg, add up to one: wi+wg=1, 0 # w i,w g # 1. The factors in Ui are supposed to be factors viewed from an
individual’s perspective, whereas those involved in Ug are factors viewed from the group’s perspective. Thus one and the same factor f can be involved here but viewed from these two different perspectives so that we can speak of gpredicates and i-predicates, e.g. g-shame and i-shame. Some special cases and some dependences between the parameters have to be imposed. Thus wi=0 entails unconditional cooperation and wg=0 acting on merely personal preferences to satisfy purely personal goals (which of course may be otherregarding). If a person strictly accepts a goal G as his collective goal and is fully committed to it, this entails that wg=1.9 But he can in a weaker sense take group factors into account and respect individual factors. G could be a collective goal in a group or collection of participants but a certain person might not yet have committed himself to it, so that he would only give some
Rational Cooperation and Collective Goals
299
weight less than 1 to wg. If a participant accepts the standard game-theoretical dominance principle for i-preferences then wg=0 for him in a PD. In the case of the expected utility EUi the probabilities are as specified above. In the case of EUg the situation is different. Do we even need expected utility in the case of collective goals or could we get by with the plain goalvalue (or, more precisely put, the g-utility value of the joint outcome)? We do seem to need probabilities (degrees of belief). This is because it is possible that the probability (p) of the chosen action X not leading to goal G is less than 1. This may come about if the collective action opportunities do not hold - e.g. not enough participate - or because the environment does not cooperate. But probabilities here are of a different kind than in the case of EUi. When a group rationally accepts a goal it does so on the basis of its preferences. Suppose now that in a situation of strategic interaction it has accepted a certain joint outcome G as its goal (or as a group means to a goal but let us here be simple-minded and think of CC itself as a collective goal or a group goal). In the present setup this entails that the participants accept G as their collective goal (to be distinguished from their purely individual, i-goals). One of the central features of a collective goal that the members have is that in accepting the goal they also in effect accept the Collectivity Condition, a principle relating the satisfaction conditions for the individual members’ g-goals in a noncontingent way. Note here that if the participants of a coordination game just happen to select one of the coordination equilibria (say, because of its salience) thus, in a well-worn example, a meeting at the church of the foreign village rather than at some other place, this equilibrium is not a collective goal in the strong, full-blown sense meant here. Rational collective goals in general, however, should be and also will be equilibria - or so I argued in Section II. What do we get in the case of PD as the values of EUt? If CC has been selected as the dyad’s goal then, no matter how unstable, it will be carried out by rational, committed participants: wi=0 and wg=1 and EUt(C) > EUt(D) (=0). This does not require agreement by the players to choose C, only their separate acceptance of CC as a collective goal (which is not an equilibrium relative to i-preferences).
300 In other cases, in which there is no commitment on the part of both participants (or no expectation to this effect with a probability of one) and which correspond to some of the cases with no agreement concerning CC or cases with non-enforceable agreement concerning CC, we get something else. Both wi and wg can then have non-extreme values. Both individual and collective reasons might still favor cooperation and EUt would then be maximized by mutual cooperation (recall the case with S-shaped utilities), or ireasons and g-reasons might conflict, and then EUt might or might not favor cooperation. With sufficiently strong i-reasons for defection the expected total utility of C will become less than that for D. The extreme case is where there is commitment to D (e.g. via the acceptance of the dominance principle). Then wi=1 and wg=0. The second way to combine i-reasons and g-reasons technically is to do it in a partial way as follows. In view of the schemes CPR) and PPR) of practical reasoning introduced in Section II and assuming C to be the agents’ contributory action in conclusion b) of PPR), we simply do this: In our PD of the previous section we add a parameter g to A’s C row (cells CC and CD) of personal utility, and likewise for B (cells CC and DC). In this way we come down to the level of individual utilities and can use our previous model, where the utilities now involve both merely personal and group utilities. Accordingly, in the case of A, the expected utility of C will be EU(C) = p1(u+j+g) + p3(u+s+g) and that of D EU(D) = p2(u+f+m) + p 4(m*). Obviously, positive g-values can on some occasions make EU(C) larger than EU(D). There is the problem with this second solution that, although perhaps “extensionally correct”, it summarily mixes I-mode utilities (what the original model has) and we-mode utilities (the g-factor) in a theoretically unacceptable or at least suspect way. This is why the first solution seems clearly preferable. Leaving aside technicalities, let me comment on institutional collective goals. They can be taken into account via g-preferences in one of the ways discussed above. By institutional goals I mean normatively defined goals such as the general goal of obeying the laws of the state and more specific goals like paying one’s taxes, keeping public places peaceful and clean, educating one’s children properly, being polite to the elderly and the disabled, and so on. One
Rational Cooperation and Collective Goals
301
of our institutional goals is to maintain our democratic political system by voting and in other ways. Consider voting. We can regard voting as an institutionally proposed goal which concerns all citizens. Voting can be discussed as a collective action dilemma. At least in some contexts, one can perhaps regard a general election as a PD situation from a purely personal point of view. A citizen prefers his candidate to win, but the chances are slim. However, without voting the whole system would collapse and then one’s own candidate of course cannot succeed. Voting can be regarded as more costly (at least physically) than abstaining from voting; one’s candidate winning without voting oneself is the most preferable situation whereas the worst situation is where one votes in vain for one’s candidate. This can be construed as a PD situation by treating the others as a collective player choosing either in favor of one’s candidate or against him. When g-preferences are brought into the picture it may change a lot, depending on how strongly committed one is to the institutional goal of voting. Suppose, for instance, that a person accepts the collective goal that the election is to be successfully held. The presupposition belief underlying this is that a great majority of people vote. Having accepted the election as a collective goal (G) he ought to contribute by voting. As the collective prefers that the majority vote and also wishes to keep the institution alive (repeated horizon), an agent’s voting is collectively rational even if not necessarily individually rational (a big effort with a slim chance of having an effect on the outcome of the election). Why the collective regards the institution of voting and other institutions as important, is another matter, which I cannot discuss here. This kind of institutional situations can, however, be fruitfully compared with an indefinitely played collective action dilemma game (see the next section). V Repeated Situations of Strategic Interaction The best hope of finding rational cooperative solutions to social action dilemmas may seem to relate to the case of repeated games. The strategically interesting thing here is that the participants can now reward and punish the other participants in the course of playing the game. Various psychological
302 “continuity” factors such as reputation and trust can be argued to affect the strategic situation. I will discuss some well-known technical results on repeated games below. (For good presentations of these results standard textbooks such as Myerson, 1991, Binmore, 1992, Morrow, 1994, and Osborne and Rubinstein, 1994, can be recommended; also cf. Axelrod, 1984, and Bicchieri, 1993.) We consider games in normal form and assume for the time being in the standard fashion that the participants have mutual knowledge (or at least true mutual belief) about the structural features of the game. We say that a joint outcome is in Nash equilibrium if it is a result of the players’ use of (pure or probabilistically mixed) strategies which are in Nash equilibrium. Such a set of strategies is in Nash equilibrium if and only if each player’s strategy gives his best response to the other players’ fixed (pure or mixed) strategies. We say that the equilibrium is subgame-perfect if the players’ strategies are in Nash equilibrium in every subgame. Let us now consider a game G (also called the stage game) and denote the repeated game consisting of G being repeated either finitely or infinitely many times by G(T). Let us first consider finitely repeated games. For the our present purposes the payoffs of G(T) can be taken to be the sum of the payoffs of G. Here is a basic result for such games: If the original game G has a unique Nash equilibrium then for any finite T, the repeated game G(T) has a unique subgame-perfect outcome consisting of the equilibrium of G being played at every stage. For the game to be epistemically adequate this result assumes that the players have at any stage perfect information of what they have done before in the game and it also assumes higher order beliefs, basically that a player at any stage knows, not more and not less, what the next choosing player knows (see Bicchieri, 1993, Chapter 4). Applied to the case of a PD this epistemically burdensome result entails that the mutual defection outcome will result at all stages. (In the case of stage games with several equilibria, some additional cooperativeness can rationally come about due to repetition - see e.g. Osborne and Rubinstein, 1994.) For a person to be epistemically rational in a strategic situation we must require optimal use of social and other information in practical reasoning and the capacity to gather relevant new information (cf. Tuomela, 1984, Chapter 7,
Rational Cooperation and Collective Goals
303
Bicchieri, 1993, Chapter 3). Repeated games are in many ways informationally demanding, as rational players must be able e.g. to keep track of the moves made in the game and respond to them (auxiliary technical devices can of course be used). It is worth noting that there are some results concerning epistemically less demanding situations, in which a PD game actually becomes more cooperative. Thus Kreps et al. (1982) show that in a simple two person PD uncertainty about the other player’s dynamic strategy or “player type” may make a considerable difference. Suppose that the players think that the other one will with some small probability not be fully rational but mechanically play only tit-for-tat (viz. start with cooperation and cooperate if the other does, otherwise defect). If there is two-sided asymmetrical information of this kind, there will be an equilibrium in which the players will cooperate almost until the end of the game. Next consider indefinitely repeated games, viz. games which are assumed to continue at least with some probability. Here the general picture is somewhat different. The so-called folk-theorems, of which there are quite a few corresponding to different kinds of situations, state that there will be lots of individually rational equilibrium outcomes, both cooperative and noncooperative. The results are usually proved by using Moore-machines and simple choice-strategies (e.g. so-called tit-for-tat, grim, tweedledum, etc.) formulated in terms of these finite automata. To state one of these theorems for the two-player case, assume complete mutual knowledge as above. Let us say that a set of payoffs, M, is feasible if it is a combination of payoffs for different outcomes in the stage game. A payoff is individually rational if it is not less than the minimax value he can secure for himself under any circumstances. Let d be the discount parameter for discounting future payoffs. The folk theorem in question now says this: For any individually rational, feasible payoffs M of an indefinitely repeated stage game G and for a sufficiently large d, there is a Nash equilibrium that has payoffs M. As indicated, there are many other kinds of analogous folk theorems, but I cannot consider them here. Instead, to make the matter more concrete, we can look at our example PD with the payoff matrix
304 B C
D
C 3,3 - 1,5 A D 5,-1
0,0
In the indefinitely repeated game we get lots of equilibria, an infinity of them. If, in particular, we suppose that the players use tit-for-tat, it follows although now we do not get subgame perfect equilibria - that mutual cooperation CC with the payoff 3,3 will be one of the equilibria, and so will of course DD with 0,0 together with a convex set of others (but not CD or DC). Tit-for-tat is not informationally demanding, as players respond only to a move at the preceding stage. Analogously to PD, such collective action dilemmas as Chicken and Battle of the Sexes can be also shown to have lots of equilibria. In such cases repeating a game does not mean that the participants will cooperate, but does offer it as a rational possibility. Let us now consider the significance of these results for rational cooperation. First, as to rationality itself, these results offer opportunities for acting rationally in the sense of striving for an equilibrium outcome. This means not only that the behavior process is rational but also that the end is rational relative to other comparable ends in such a situation. A rational collective goal is an equilibrium (recall Section II), which at least must be a Nash equilibrium but preferably a subgame perfect one and perhaps even a stronger one (e.g. a trembling-hand equilibrium). Being an equilibrium outcome is necessary but not yet sufficient for the rationality of the goal. As to the above folk-theorems, it can be noted that the equilibria are entirely brought about by the participants in a self-policing way, thus without external authorities or controllers. This is rationality in a “reason-control” or autonomy sense. The folk theorems involve the disturbing feature that most of them concern infinite interaction sequences while we human beings are finite beings with rather short finite lives. Nevertheless, we can act for reasons which are in a sense “future-open” (recall Section III). We can have in mind a sequence of interactions without paying attention to its finiteness. In particular, we often do not have a clear idea of when precisely a continuing relationship will end.
Rational Cooperation and Collective Goals
305
This kind of “indefinitely open horizon” seems to be mentally possible, viz. a possible perspective in our mind when we consider our reasons for action even if we may not be able to play the games in our minds. We may come to think of a process of interaction converging to some equilibrium when continued sufficiently long. This contrasts with a finite horizon in which we know that the process will end after so and so many stages. I suggested earlier that many institutional processes, e.g. voting or advancing democratic liberalism, are openended processes. Similarly, a organization like the UN or the Red Cross could be thought of as an open-ended organization with positions and roles surviving the death or disappearance of particular office-holders. Closer to home, people might act for the prosperity of such groups as their families or clans on the understanding that new position and role-holders will “always” emerge. Repeated games - in an idealized way - serve to make clearer what rational cooperative processes are like and also give some idea of when it is rational to cooperate and when not. The game-theoretical results discussed here of course do not have much predictive power even in the case of agents rational in the game-theoretical sense. This is in part generated by the infinite character of many of the processes and the bewildering plurality and variety of equilibria (even admissible, viz. “non-improvable” ones).10 VI Cooperative Solutions to Collective Action Dilemmas We may divide collective action dilemma solutions and attempts of solution into internal and external. Internal ones leave the general structure (especially the inbuilt preference structure) of the collective action dilemma unchanged and commend cooperation to rational agents. In contrast, external solutions change the structure of the situation. What kinds of rational solutions or sketches of solutions for cooperation have I been offering in this paper? Briefly put, the discussion in Section III related to the various parameter changes occurring when given preferences or utilities change into final or effective ones mainly concerns changes in the preferences and thus is concerned with external solutions. (An exception to this was the consideration of S-shaped utilities, if we take the initial objective
306 payoffs to be institutionally created utilities.) The consideration of collective or group preferences in Section IV mainly leads or can lead to external solutions. However, the points about commitment and agreement (commented on in note 9) are concerned with internal solutions. Finally, the results from the theory of repeated games, where applicable, yield internal solutions, even selfrecommending ones (because of their self-policing nature). Internal solutions are of course preferable when they can be achieved, but they may be rare. As we saw, the game-theoretical results are highly idealized and typically cannot be directly applied to real life situations. Still, on the whole, it can be said that there is no longer a large gap between what experimental evidence and what game-theoretical and other theoretical (e.g. philosophical) investigations have arrived at. Experimental evidence suggests that quite a lot of cooperation in collective action dilemma situations occurs, and more recent theoretical investigations tend to concur. Let me end with some general comments on real life collective action dilemmas such as PD. When such a dilemma structure is changed into a more palatable situation by a law of the state (a frequent case), we are dealing with a standard kind of external solution. This approach is what is often attempted in modern societies, and it often works. One well-known problem with this kind of solution is that it may be too costly, at least when laws (and other similar rules) are used for the purpose, and that the payment of the costs may involve a new second-order collective action dilemma. However, in collectives in which there are plenty of social norms based on mutual beliefs and approvaldisapproval sanctions (and are called s-norms in Tuomela, Chapter 1) and in which good upbringing and education play a central role, people are often typically disposed to cooperate in dilemma situations. As the sanctions are either low-cost or, being part of the social nature of people, do not cost a thing, this helps the collective to avoid higher-order dilemmas. Good upbringing and education can be expected to socialize people by giving them “cooperative” values, goals and (conditional) we-intentions - and hence cooperative action strategies and repertoires. These factors function so as to dispose people to share collective goals and thus to cooperate in the full sense rather than to
Rational Cooperation and Collective Goals
307
cooperate only in the weaker quasi-cooperation or coordinative sense discussed in this paper. Consideration of repeated situations is important, be the situation actually repeated or not. The central element is what kinds of mental games people are playing. If in an overtly single-shot situation the participants’ reasoning takes into account what might occur in future situations of the same kind either with the very same participants or with participants who can spread information about one’s behavior and character (think of reputation, for instance) the situation is really an iterative one, in which we are actually dealing with a higher-order factor. The participants need not be assumed to play the very same game with the very same participants, but what is at stake is social interaction especially the face-to-face type of interaction - on the whole. What we do to others and what they do to us tends to matter for our future. The distinction between “general” preferences and “situation-specific” preferences is also central. The general given preferences often directly reflect underlying objective payoffs (money or other transferable objective media of exchange). However, in a concrete situation of cooperation various new elements may enter the picture (cf. Sections III and IV). The resulting final costinvolving preferences may be such that the participants favor cooperation instead of defection. That such situational considerations change the dominances or expected utilities need not as such entail anything about other situations. In the next situation - say one with unfriendly participants - our former cooperator may rationally change into a defector. (See Tuomela, 1995, Chapter 4 for additional remarks emphasizing the role of “we-ness” thoughts in solving collective action dilemmas.) Comprehensively rational cooperation in the sense of R) of Section I may require reference to irreducible values and norms. The argued need for irreducible collective goals and the existence of such game-theoretical results as the huge multiplicity of equilibria in repeated games seem to lend support to this general and venerable old idea. Indeed, game theory does not seem to suffice to account for the social order; in this sense (and on this kind of “objectlevel”) social norms thus seem to be needed over and above strategic rationality.
308 Game-theorists may disagree, and there is room for disagreement. Who is right may hopefully be decided by future empirical research.
Rational Cooperation and Collective Goals
309
Notes 1 In the case of preferences we can also speak of wants: My preferring x to y can be taken to amount in this context to my wanting x to be realized rather than y. While I will not take a specific stand in this paper, we may represent the preferences numerically by means of von Neumann-Morgenstern utilities, which requires that the preferences be defined over lotteries and make use of previously available objective probabilities. (In Section III subjective probabilities will be used; cf. note 7.) In general, intention-contents are goals. There are both “action-intentions” (concerning what the agent has committed himself to) and “aim-intentions” (concerning commitments the agent believes require collective action for their satisfaction). As indicated, a rational agent tends to select goals and form intentions which respect his preferences, whenever his preferences are not themselves in conflict - as merely personal and group preferences (preference rankings) may be. 2 Let me consider the notion of a collective action dilemma in some detail. Some typical preference structures exemplifying a collective action dilemma in addition to the Prisoner’s dilemma (PD) are Chicken (CG); and the Battle of the Sexes (BS). In the two-person cases they can be described in terms of the following orderings, using the standard interpretation C = contribution, D = defection with the comma representing the “greater than equal” relation: PD: DC, CC, DD, CD CG: DC, CC, CD, DD BS: DC, CD, CC, DD Many-person game-structures can be obtained by generalization, although there are several possibilities of generalization. Here are some examples: PD: DCC, CCC, CCD, CDC, DCD, DDC, DDD, CDD CG: DCC, CCC, CCD, CDC, DCD, DDC, CDD, DDD BS: CDD, DCD, DDC, CCC, DCC, CCD, CDC, DDD I have discussed in Tuomela (1992) and (1996b) collective action dilemmas at length and have proposed the following rather general description: (CAD) Let S be an interpersonal outcome structure (viz. a game-theoretical structure) or a token of such a structure. S then involves a collective action problem (or dilemma) if and only if S involves a conflict between collectively rational and individually rational action, viz., if and only if there are (distinct and incompatible) actions or strategies C and D such that C is a collectively rational action (e.g. in the sense of leading to a Pareto-preferred outcome when chosen by all or most) and D is an individually rational action (e.g. in the sense of individual expected utility-maximization). This simple analysis needs some qualifications and refinements, but will suffice for the purposes of this paper. 3 In clause a) the notion of acting together is used. Acting together is meant to be understood here as a something weaker than proper joint action, understanding proper joint action to be action based on the agents’ shared plan to do something together. Let me briefly and roughly indicate what I mean without giving a proper defense (but see Tuomela and Bonnevier-Tuomela, 1996). Consider the simple case of two agents, you and I: (AT) You and I intentionally act together in performing X if and only if 1) X is a collective action type (in the sense of a “joint action type” Tuomela, 1984, Chapter 5, viz. an “achievement-whole” divided into A’s and B’s parts, not necessarily on the basis of an agreement or even a social norm); 2) a) I intend us to perform X together, and I perform my part of X (or participate in the performance of X) in accordance with and (partly) because of this intention; b) you intend us to perform X together, and you perform your part of X (or participate in the performance of X) in accordance with and (partly) because of this intention; 3) a) I believe that you will do your part of X (or participate in the performance of X);
310 b) you believe that I will do my part of X (or participate in the performance of X); 4) 2) in part because of 3); 5) If my intention that we perform X together is satisfied, then, on quasi-conceptual grounds, your intention that we perform X together is also satisfied, and vice versa (viz. my participation commitment to X is not fulfilled before yours is, and vice versa), and each of us believes this. 4 In view of the importance of the collectivity condition the following more detailed remarks about it are warranted. Let me restate its basic, strong form: (CCs) If G is satisfied for a member Ai of C, then, on quasi-conceptual grounds, it is satisfied for every member of C; and this is (normally mutually) believed in C. Here the qualification “on quasi-conceptual grounds” involves - to put the matter somewhat circularly - that the collective goal G is collective because of its collective acceptance (and construal) by the members of C as their intended collective goal (understood minimally in a sense entailing (CCs)). If the analogue of our strong collectivity condition were satisfied on contingent grounds only, G would not be a collective goal, but simply a shared personal goal with a collective content. The fact that a collective goal must be conceptually constructed by the participants (or by some authorities in institutional cases) and accepted as a collective goal (at least in a pre-systematic sense) can still be illustrated by the following example. Suppose that at an airport the authorities have put up a sign “Do not leave your luggage unattended”. This mandates the acceptance of a collective goal. If the passengers obey the order, not leaving one’s luggage unattended becomes a collective goal. Here the collective goal is “built on” personal ones. To clarify the conceptual situation assume there are only two participants, you and I. I accept as my personal goal not to leave my luggage unattended, as you do. These personal goals are satisfied by our not leaving our luggage unattended. This can also be our collective goal if we have accepted it as such. In this case the Condition of Collectivity is imposed. Not leaving one’s luggage unattended is satisfied as a collective goal only if we not only have not left our luggages unattended but also have accepted that our collective effort is required in a sense leading to satisfaction of the Condition of Collectivity. Thus the collective goal is not satisfied until each person in our collective (here a dyad) does not leave his luggage unattended but also accepts that when the goal is satisfied as a collective goal for one of them, it is by its very construction also satisfied for the other party. There are also differences with respect to the commitments involved in personal as against collective goals, see Tuomela, (1996a,b). Space does not allow discussion here. 5 I have discussed in a joint paper a closely related notion, that of a compatible coaction (Tuomela and Bonnevier-Tuomela, 1996). This notion might be taken to explicate quasi-cooperation in the present sense. The following is a concise explication of this notion: (CO) Agents A1 and A2 coact compatibly in a situation S relative to their personal goals G1 and G2 if and only if 1) their respective primary goals in S, viz. types of states or actions, G1 and G2, which relate to the same field of action dependence) in S are compatible, viz. they can be satisfied without conflict by their respective agents; 2) a) A1 intends to achieve G1 without means-actions conflicting with A2's attempts to satisfy his goal and believing that he can at least with some probability achieve it in that context although his relevant G1-related actions are dependent on A2's relevant G2-related actions, and he acts so as to achieve G1; and b) analogously for A2: 3) a) A1 believes that 1) and 2) , and b) analogously for A2. 6 Consider the following list of cases where it is in some sense collectively rational (and in some cases even necessary for a task) for some agents to cooperate, to join their forces and act together as a
Rational Cooperation and Collective Goals
311
group rather than separately (see Tuomela, 1995, for more detailed discussion). Cooperation in this sense is a central case of cooperation, and it accords with thesis C) of Section II. Here is the list: A. This first group consists of actions which simply are such that typically or often it is not possible for a single agent to perform the action in question. The possibility in question may be conceptual, moral, legal, etc., or may be purely factual (and generally nomological). B. Next we have the cases where it is desirable or useful, for various reasons, to perform something jointly or together. Thus joint action may, on factual grounds, save time, energy, etc.. C. Acting jointly may as a matter of fact increase the likelihood of success. D. Two or more agents may by acting jointly improve the quality of the joint product significantly above what they could have achieved by acting separately. E. Sometimes it is more pleasant, and less boring, to do things together rather than separately. F. As with the previous case, acting together may make the participants feel more secure than when acting alone. G. In some cases of competition it may profit some of the agents to form a coalition against the other agents or coalitions of agents. H. In joint action each participating agent may gain or profit more than by acting alone. This situation may arise in the cases of exchange between agents in cases of imperfect competition in the economic sense (cf. Edgeworth diagrams and models of oligopoly). I. In cases involving a collective action dilemma (e.g., Prisoner’s Dilemma type situations) it is in many circumstances collectively and individually more rational to act jointly (or collectively) rather than separately. In general we can speak of a jointness effect in collective and joint action in the following senses. Let us consider an action X and assume that it is in principle possible to perform X both jointly and separately. (Actions which can only be performed as joint actions or only as single actions can be treated as special, limiting cases.) We can compare the situation in which two agents A and B do X jointly on the basis of their agreement to do so with a) a situation in which X is done by no one; b) a situation in which one of the participants does X; c) a situation in which A and B each do X but separately (or at any rate not jointly in the full-blown sense); d) a situation in which one of the participants is forced by the other’s threat to do something Y, which may be worse for the threatened agent than his doing nothing or either one doing nothing or the person threatened performing X separately or alone. In this paper I will concentrate on c), but it is advisable to keep the other cases in mind as well. Reasons for cooperating consired in the present note may or may not amount to the kind of good, optimal or maximizing reasons required by the criterion of rationality in R) for making the action rational. I will discuss such maximizing reasons in the rest of the paper, although mainly in formal terms only. 7 I will assume here that we can use well-grounded conditional probabilities here. However, in general there seems to be reason to employ causal conditionals in the arguments (cf. Gibbard and Harper, 1978 and Tuomela, 1984, esp. Chapter 12). Speaking in non-formal terms, what we should thus use is probability sentences of roughly the following kind: p(outcome CC would be “purposively generated”, viz. be generated in the intended way, should A do X intentionally for the rational intention-belief reason). This is the probability of a causal conditional statement being true. The probabilities here have been regarded as being independent of utilities. This seems to be a simplification since wants and beliefs may factually interact - e.g. we seem to have a tendency to “believe what we want”. Note, however, that the discussion in this section has assumed that goal G is strictly (= with probability one) generated by the CC outcome. In a more general treatment we will need to take into account probabilities of the kind p(G/CC), p(G/CD), etc.
312 8 Let us next try to see what happens if we remove or change the special assumptions concerning goal G and its achievement. First assume that G is a private good, viz. a divisible good. Next we assume that if a group member does not participate (make a contribution) he will be excluded from the consumption of the good - he does not get a slice of the cake. Then our schema looks like this: B C D C u+j, u+j u+s, m A D m, u+s m*,m* Here the person who does not participate becomes socially sanctioned and receives the negative utility m, assuming that G can be produced alone or without this person. In the case of mutual defection both are socially sanctioned, but, as earlier, it can have a different value (m*). (In cases where the free-rider still succeeds in getting his slice of the cake, our first schema, meant for a public good, applies.) Assume next that goal G cannot be produced alone - or (in our example) that both participants are needed. We then get the following schema: C B D C u+j,u+j s,m A D m,s m*,m* The defector gets nothing but a social sanction. In the special cases discussed here, the expected utilities of actions of course can be computed as in the case of public goods producable alone. 9 In cooperative game theory commitments have been dealt with in terms of contracts or agreements (see e.g., Myerson, 1991, pp. 245-247. Considering a simple PD, let us make the following distinction: a) commitment to a collective goal (e.g. the joint outcome CC or one its consequences in our earlier context), entailing a personal commitment to contribute to the collective goal. b) acceptance of an agreement to cooperate (act jointly, e.g. to mutually choose C) with respect to a collective goal, entailing a strong interpersonal commitment to fulfil the agreement. To deal with commitment in terms of the normal or strategic form of a game we start with our usual PD discussed in Sections I and IV and add to it the choice of making an agreement. This results in an “agreement game”. Consider thus adding a new choice possibility, K, to our earlier PD: C D K C 3,3
-1,5
-1,5
D 5,-1
0,0
0,0
K 5,-1
0,0
3,3
A
We consider two different interpretations of K correspondingrespectively to cooperation towards a collective goal in the sense of ICG) and in the stricter sense of cooperative joint action in the “proper” sense: 1) K = accept CC as a collective goal for the dyad (and thus form the intention to perform C, committing oneself to it), given that the other player also commits himself to CC; if only one player commits himself to perform C choose D. 2) K = accept the agreement that all are to perform C, given that the other player also accepts the agreement; if only one player accepts the agreement choose D. We are speaking about binding acceptances here. (The second interpretation has been inspired by a related one in Myerson, 1991, p. 245.) The payoffs for K are rather obvious. Under both interpretations mutual choice of K means adopting K as a collective goal (almost in the sense of (ICG)). There is the same payoff as accrues from the mutual choice of C. If one of the players does not commit himself to K we are back in the pre-agreement situation with defection (D) as the choice.
Rational Cooperation and Collective Goals
313
It is easily seen that KK will be a Nash equilibrium (cf. Section V) in pure strategies, being the best response outcome for the participants. A cannot improve his payoff by switching, nor can B. We can now make the observation that the mutual choice of KK entails that the participants accept KK as their collective goal almost in the sense of ICG). Note particularly that the central Collectivity Condition is clearly satisfied. I will not discuss this in more detail here except to point out that in the second, agreement-interpretation of K the situation is simple. We have conceptually built into the definition of K that if it is satisfied for one of the participants then it is satisfied for the other. The satisfaction of the Collectivity Condition can be regarded as a conceptual consequence of the construction of our agreement game. The content has simply been conceptually built into the choice alternative K. The first clause of 1) of ICG) can also normally be regarded as satisfied in our present context of contract (or agreement) games. At least cooperative game theory seems thus to be able to incorporate, although in a theoretically rather trivial way, the Collectivity Condition related to collective goals, but note that the “we-ness” problem required by the notion of acting together is yet to be dealt with. 10 In a more realistic approach related to full-blown cooperation we could speak of the production function involved in the provision of the collective goal (which can here be assumed to be a public good) in question. The production function might be of the general form x=f(y,z,...) where x represents the collective goal in question and y the number of cooperative action tokens. The other arguments (z,...) can deal with the qualitative features of the situation, taking care that the right kind of variety of actions is present, if the production of the good is based on a division of tasks and labor. For simplicity’s sake, I shall suppress these other variables below and deal with a simple function of the kind x=f(y), assuming the variable y to be of the right kind so that it measures the number of such actions needed for the production of any amount of good x in the first place and, in the second place, for the production of an increment in variable x. I assume that there is a number, say K, which is an allowed value of variable y such that f(K)=x(0), where x(0) represents a token of the minimally existing quantity of the public good X. f may be a steadily growing (discrete or continuous) function of the number of cooperative action tokens or it may be S-shaped so that f(K+N)>f(K) for some N but f(K+N+P)
314 Brandenburger, A., 1992, ‘Knowledge and Equilibrium in Games’, Journal of Economic Perspectives 6, 83-101 Dacey, R. and Gallant, K., 1995, ‘Crime Control and Harassment of the Innocent’, ms Föllesdal, D., 1982, ‘The Status of Rationality Assumptions in Interpretation and in the Explanation of Action, Dialectica 36, 301-316. Gibbard, A. and Harper, W.L.: 1978, ‘Counterfactuals and Two Kinds of Expected Utility’, in Hooker, C.A., Leach, J.J., and McClennen, E.F. (eds.), Foundations and Applications of Decision Theory, Vol. I, Reidel, Dordrecht and Boston, pp. 125-162. Hampton, J. 1987, ‘Free-Rider Problems in the Production of Collective Goods,’ Economics and Philosophy 3, 245-273 Hardin, R. 1982, Collective Action, The Johns Hopkins Press for Resources for the Future, Baltimore Kelley, H. and Thibaut, J. 1978, Interpersonal Relations, Wiley, New York Kreps, David M., Milgrom, P., Roberts, J., Wilson, R, 1982, ‘Cooperation in the Finitely Repeated Prisoner’s Dilemma’, Journal of Economic Theory 27, 245-253 Morrow, J., 1994, Game Theory for Political Scientists, Princeton University Press, Princeton Myerson, R., 1991, Game Theory: Analysis of Conflict, Harvard University Press, Cambridge, Mass. and London Osborne, M. and Rubinstein, A., 1994, A Course in Game Theory, The MIT Press, Cambridge, Mass. and London Tuomela, R., 1984, A Theory of Social Action, Reidel, Dordrecht and Boston Tuomela, R., 1992, ‘On the structural aspects of collective action and free-riding’, Theory and Decision 32, 165-202 Tuomela, R., 1993, ‘What is Cooperation?’, Erkenntnis 38, 87-101 Tuomela, R. 1995, The Importance of Us: A Philosophical Study of Basic Social Notions, Stanford Series in Philosophy, Stanford University Press, Stanford Tuomela, R., 1996a, ‘Collective Goals and Cooperation’, forthcoming in the Proceedings of the ICCS95 Conference held in San Sebastian, Spain, Kluwer Tuomela, R., 1996b, Cooperation: A Philosophical Study, book ms Tuomela, R. and Bonnevier-Tuomela, 1996, ‘From Social Imitation to Teamwork’, ms Tversky, A. and Kahneman, D., 1992, ‘Advances in Prospect Theory: Cumulative Representation of Uncertainty’, Journal of Risk and Uncertainty 5, 297-323
Vernunft heute
315
Wolfgang Welsch Vernunft heute
abstract What type of reason will work under the present conditions? To answer this question a meaningful conception of reason (as distinct from rationality) has to be developed, and is contemporary conditions (due to change in the field of rationality) have to be specified. In part I. of the paper, the radically altered structure of rationality is analysed; it turns out to be characterized by rational disorder. Part II. offers a redefinition of reason; guided by the idea of justice reason operates in transition from one rationality to another. This new kind of reason - “transversal reason” - is further elaborated in part III. It is regarded as a key-element of any type of reason. Vorbemerkung Unter dem Titel “Vernunft heute” behandle ich nicht die zeitgenössische Vernunftkritik und deren Varianten, sondern die Frage, wie Vernunft heute möglich und geboten sein könnte. Im Unterschied zur Radikalkritik an Vernunft will ich es mit Wittgensteins Satz halten: “Das Philosophieren mag zwar vielleicht bedeuten, daß man sein Temperament preisgibt, niemals jedoch die Vernunft”.1 Gegenüber der allzu simplen Berufung auf Vernunft hingegen erinnere ich an Adornos Warnung, “daß es gerade an der Stelle, an der die Berufung auf Vernunft am promptesten eintritt, unweigerlich um die Apologie der Unvernunft geht”.2 Vernunft welcher Art, so will ich fragen, vermag jenseits von Vernunftdefaitismus und Vernunftdogmatismus - unter heutigen Bedingungen tragfähig zu sein? Um diese Frage beantworten zu können, muß ich erstens einen gehaltvollen Begriff von Vernunft explizieren. Weder darf, wie weithin üblich, nur von Rationalität die Rede sein, noch darf selbst dort, wo von Vernunft gesprochen wird, doch bloß Rationalität gemeint sein. Es braucht einen von Rationalität
316 distinkten Begriff der Vernunft (was nicht notwendig heißt: einen von Rationalität völlig losgelösten Begriff) derselben. Zweitens muß ich die spezifisch heutigen Bedingungen von Vernunft angeben. Ich bin der Auffassung, daß diese Bedingungen sich aus Veränderungen in der Sphäre der Rationalität ergeben. Auf sie und die mit ihnen verbundene Herausforderung - sie liegt, vorgreifend gesagt, in einer neuartigen und uneliminierbaren Unordentlichkeit von Rationalität - muß Vernunft heute eine Antwort finden, angesichts dieser neuen Situation der Rationalität muß Vernunft ihre Konturen verändern. Daher werde ich so vorgehen, daß ich in einem I. Teil die veränderte Verfassung der Rationalität darstelle, um in einem II. Teil anzugeben, welche Gestalt Vernunft unter diesen Bedingungen annehmen muß. In einem III. Teil werde ich dann einige Leistungen einer solchen Vernunft diskutieren.3
I. Die Verfassung der Rationalität 1. Königsweg Pluralisierung? Seitdem die Dialektik der Aufklärung als Defizite traditioneller Vernunft deren Uniformierungstendenz und Herrschaftscharakter diagnostiziert hat, gilt Pluralisierung als Königsweg der Therapie. Denn Pluralisierung scheint mit einem Schlag von beiden traditionellen Problemlasten befreien zu können. Eine Vernunft, die in unterschiedliche Formen ihrer selbst auseinandergetreten und nur in solcher Pluralität noch Vernunft ist, wird eo ipso nicht mehr uniformierend sein, und sie legt dadurch zugleich ihren herrschaftlichen Charakter ab. Daher ist Pluralisierung in den letzten Jahrzehnten in den verschiedensten Lagern - von Ritter bis Rorty, von Habermas bis Lyotard zum Fokus der Vernunftdiskussion geworden. Allerdings scheint mir längst auch ein Einspruch gegen die Pluralisierungseuphorie an der Zeit zu sein. Denn zwar befreit die Pluralisierung von alten Problemen, aber sie schafft auch neue. Und gerade den Folgen der Pluralisierung entspringt die heutige Form des Vernunftproblems.
Vernunft heute
317
2. Die Pluralisierungsdynamik und ihre Folgen - die zwei Stufen der Pluralisierung Bei der Rede von Pluralisierung sind meines Erachtens zwei Typen zu unterscheiden. Erstens hat Pluralisierung den Sinn von ‘Ausdifferenzierung’: die ehedem eine Vernunft tritt modern in eine Mehrzahl eigensinniger Rationalitäten auseinander. Zweitens kommt es dann innerhalb der so entstandenen Rationalitätsbereiche zum Hervortreten unterschiedlicher Paradigmen, die jeweils vollgültige Realisationen des betreffenden Rationalitätstyps zu sein beanspruchen. Diese zweite Form, die Pluralisierung der Paradigmen innerhalb der Rationalitätsbereiche, bezeichne ich als ‘Pluralisierung’ im eigentlichen Sinn. Während der erste Schritt, die Ausdifferenzierung, zu einem schiedlichen Nebeneinander gleichsam mehrerer Rationalstaaten führt, erzeugt die Paradigmenpluralisierung innerhalb dieser Staaten Grundkonflikte, und es ist absehbar, daß diese sich nicht mehr durch Strategien einer Gebiets- oder Gewaltenteilung werden auffangen lassen. Bislang hat man sich in der Rationalitätstheorie allzu sehr auf den ersten Schritt, die Ausdifferenzierung, beschränkt. Nur deshalb konnte man glauben, Rationalität habe auch heute noch die Form einer Wohlordnung. Es käme längst darauf an, den zweiten Schritt, die Paradigmenpluralisierung, schärfer ins Auge zu fassen. Dann würde sich allerdings zeigen, daß die Sphäre der Rationalität zu einer Sphäre rationaler Unordentlichkeit geworden ist. - Warum dies so ist, will ich in einer Folge von mehreren Punkten darlegen.
3. Rationale Unordentlichkeit als Folge der Pluralisierung zweiter Stufe a. Binnensektorielle Dissense Erstens: Die Paradigmen halten sich nicht an die vorgegebenen Abgrenzungen und scheinbar verbindlichen Strukturen ihrer Bereiche, sondern unterschiedliche Paradigmen bestimmen die Extension und Konfiguration ihres jeweiligen Bereichs unterschiedlich. Beispielsweise definieren logische Puristen den Bereich der Kognition weitaus enger, als Kontextualisten das tun. Popperianer beharren auf einer
318 scharfen Grenzziehung zwischen Wissenschaft und Kunst, während Kuhnianer und Feyerabendianer die Gemeinsamkeiten der Wissenschaften mit den Künsten auch in Sachen Kognition für besonders aufschlußreich halten. Auf dem Stand der Pluralisierung sind Bereiche nicht mehr selbstverständlich vorgegebene Böden, auf denen dann erst sekundär Paradigmenkonflikte auftreten, sondern der Dissens der Paradigmen betrifft - unweigerlich und legitimerweise - schon die Definition der Bereiche. Von einem Bereich zu sprechen, wird fortan heißen, von einer bestimmten Definition dieses Bereichs im Unterschied zu anderen, konkurrierenden Definitionen zu sprechen. Zweitens geben die Paradigmen auch unterschiedliche Methoden, Ziele und Kriterien für ihre Gegenstände und Fragen vor. Was nach den Kriterien des einen Paradigmas positiv zu bewerten ist, wird es nach denen eines anderen keineswegs sein müssen. Eher steht, im Maß wie die Paradigmen unterschiedlich sind, das Gegenteil zu erwarten. Die Paradigmen sind so frei, sich ihrer Freiheit auch zu bedienen. Man kann sie nicht mehr darauf verpflichten, ein vorgegebenes Programm einfach abzuspulen. In der entwickelten Moderne stehen vielmehr gerade solche Programmvorgaben zur Disposition. Von da an ist keine Grundbestimmung weder die Extension noch die Konfiguration noch die Anzahl oder Abgrenzung der Rationalitätsbereiche - vor Veränderungen sicher.
b. Keine Reduktionsmöglichkeit - bleibende Vielfältigkeit Der Dissens solcher Optionen läßt sich durch keinen Schiedsspruch aus der Welt schaffen. Man kann den Streit weder - gleichsam horizontal - zwischen den Paradigmen entscheiden, denn alle Kriterien, die man dafür einsetzen mag, werden selber paradigma-gebunden und insofern einseitig sein, hätten den Streit also schon vorentschieden. Noch kann der Streit - gleichsam vertikal - aus der übergeordneten Warte eines Hyperparadigmas entschieden werden, denn ein solches Hyperparadigma gibt es nicht. Von jedem Paradigma, das ein Hyperparadigma zu sein beansprucht, läßt sich vielmehr zeigen, daß es in Wahrheit in der Reihe der Paradigmen steht, nicht darüber schwebt. Jedes Kriterium ist in
Vernunft heute
319
die Problemmasse, die man durch Rückgriff auf es beenden möchte, selber schon verstrickt. Keines verkörpert einen archimedischen Standpunkt. Gewiß wird das eine Paradigma diese und das andere jene Vorteile aufweisen. Aber Vorteile sind Vorteile immer nur aus einer bestimmten Perspektive. Ebenso gelten Gründe immer nur auf der Basis von Prämissen. Daher wird ein bestimmter Grund zwar für das eine Paradigma überzeugend, für ein anderes aber zweifelhaft und für ein noch einmal anderes überhaupt kein relevanter Grund sein.
c. Die Paradigmen als Radikale der Rationalität Letztlich rührt die Unentscheidbarkeit von dem bislang zu wenig beachteten Umstand her, daß die Paradigmen - und nicht etwa die Rationalitätstypen - die eigentlichen Elemente im Feld der Rationalität sind. Es ist nicht so, daß Rationalitätstypen den Paradigmen verbindlich zugrundelägen, sondern umgekehrt kommt den Paradigmen die üblicherweise den Rationalitätstypen zugeschriebene Aufgabe zu, einen Gegenstandsbereich sowie die Konstitutionsund Verkettungsregeln seiner Objekte und Sätze zu definieren. Die Paradigmen sind die eigentlichen ‘Radikale’ im Feld der Rationalität. Demgegenüber haben die Rationalitätstypen nur sekundären Status. Sie sind Großgruppen, die durch die Überschneidung von durch Familienähnlichkeiten verbundenen Paradigmen entstehen. Daher macht die Paradigmenpluralisierung die einzelnen Bereiche - an deren Wohldefiniertheit der Ausdifferenzierungstheoretiker noch glauben mochte unaufhebbar divers, unklar, in spezifischer Weise unordentlich. Ihre innere Verfassung wird kontrovers, und ihre äußeren Grenzen werden instabil, brüchig und verschiebbar. Die Pluralisierung überführt die einst scheinbar eindeutigen Bereiche unwiderruflich in Felder des Konflikts und der Uneindeutigkeit. Die rationale Wohlordnung geht in rationale Unordentlichkeit über. Das ist jedoch noch nicht alles, sondern nur der erste Schritt. Die Paradigmenpluralisierung zeitigt nämlich nicht nur binnensektorielle, sondern auch transsektorielle Effekte, und auch hier ist rationale Unordentlichkeit die Folge.
320
d. Transsektorielle Unordentlichkeitsfolgen der Paradigmenpluralisierung Paradigmen implizieren stets Optionen, die über ihren angestammten Bereich hinausgehen. Sie vertreten sogar sehr bestimmte Vorstellungen hinsichtlich der richtigen Anzahl und Konfiguration der anderen Rationalitätsbereiche. Wer beispielsweise unter kognitiven Fragen nur die Erörterung dessen versteht, was der Fall ist, erreicht dadurch eine klare Abgrenzung gegenüber ethischen und ästhetischen Fragen. Wer hingegen auch die Analyse von Aussagen über nicht-kognitive Phänomene dem Bereich der Kognition zurechnet, macht durch diese - scheinbar kleine - Veränderung Ethik und Ästhetik tendenziell zu Subdisziplinen der Kognition. Oder ein anderes Beispiel: Während sich ein ästhetisches Paradigma wie ‘Kunst um der Kunst willen’ trennscharf vom ethisch-moralischen Bereich abgrenzt, greift ein anderes - ‘Kunst und Leben’ - systematisch auf die ethische Dimension aus. Im einen Fall müssen Kunstwerke nur ästhetische Gestalthöhe erreichen, im anderen hingegen sind sie ästhetisch gelungen erst dann zu nennen, wenn sie überdies zum Gelingen des richtigen Lebens beizutragen vermögen. Der unterschiedliche Zuschnitt von Paradigmen des gleichen Referenzbereiches hat also nicht nur diesen Sektor betreffende, sondern auch transsektionelle Auswirkungen. Er tangiert nicht nur die rationalen Konfigurationen des Stammbereiches, sondern läßt auch die Nachbarrationen - sowohl deren Anzahl wie ihren Zuschnitt - nicht unberührt. Daher wird infolge der Paradigmenpluralisierung nicht nur der einzelne Rationalitätsbereich, sondern auch das Verhältnis der verschiedenen Bereiche zueinander kontrovers und ‘unordentlich’ - und dies sogar potenziert, denn die von einem Rationalitätsbereich ausgehenden Umfeldoptionen treffen auf von anderen Bereichen ausgehende Optionen, die nicht nur vektoriell gegenläufig, sondern auch sachlich mit den ersteren nicht zur Deckung zu bringen sind. - Von da an wird es unmöglich, noch einmal eine einheitliche Landkarte der Rationalität zu zeichnen.
Vernunft heute
321
e. Vereinheitlichung durch Paradigmenverbände? Allerdings scheint es inmitten dieser Potenzierung von Divergenzen auch einen Vereinheitlichungsfaktor zu geben. Denn manche Paradigmen sind offenbar füreinander anschlußfähig und fügen sich daher zu kohärenten Paradigmenverbänden zusammen, die quer zu den Bereichsgrenzen durch verschiedene Bereiche hindurchgehen. Nur: Selbst wenn solche Paradigmenverbände sich durch sämtliche Bereiche erstrecken sollten, blieben sie gleichwohl partial; denn ihnen treten andere Paradigmenverbände gegenüber, die sowohl im einzelnen andere Optionen vertreten als auch im ganzen ein abweichendes Bild vom Verhältnis der Bereiche und Rationalitätsdimensionen zeichnen. Daran hat die Vereinheitlichung durch Paradigmenverbände ihre Schranke. Der zunächst binnensektoriell und dann transsektoriell konstatierte Differenzcharakter setzt sich im Konflikt solcher Großverbände, setzt sich auch auf dieser integrativ erscheinenden Ebene noch einmal fort.
f. Globale Konsequenz: Unterschiedliche Versionen des Ganzen Und wie steht es schließlich im Ganzen? Nicht anders. Denn da zumindest einige Paradigmenverbände ins Ganze ausgreifen, wird das Ganze der Rationalität fortan aus einer Mehrzahl unterschiedlicher Versionen dieses Ganzen bestehen. Je nach gewähltem Ausgangsparadigma kommt man einem anderen Paradigmenverband auf die Spur und gelangt zu einer anderen Version des Ganzen. Das Ganze ist fortan durch eine Gemenge- und Konfliktlage unterschiedlicher Versionen des Ganzen bestimmt. Und es ist unmöglich, diese Versionen noch einmal zu einem kohärenten oder auch nur angebbaren Ganzen zusammenzufügen.
g. Fazit: Rationale Unordentlichkeit im ganzen Insgesamt führt die Pluralisierung somit unter drei Aspekten zum Gesamtbefund rationaler Unordentlichkeit. Erstens kommt es innerhalb der Rationalitätsbereiche zu einer Konfliktlage konkurrierender Paradigmen. Zweitens
322 beschränken sich deren Auswirkungen nicht auf den jeweiligen Bereich, sondern zeitigen transsektorielle Auswirkungen. Und drittens entstehen dadurch unterschiedliche Optionen hinsichtlich des Ganzen der Rationalität. Fortan werden sich an jeder Stelle mehrere Optionen und im Ganzen unterschiedliche Versionen des Ganzen gegenüberstehen. Das setzt jeder Hoffnung auf Wohlordnung ein Ende. Es gebietet, rationale Unordentlichkeit als Realverfassung und Letztbestimmung der Rationalität anzuerkennen.
4. Der Verflechtungsbefund und seine Folgen Die Pluralisierungsdynamik, die ich bislang verfolgt habe, ist jedoch nicht der einzige Bestimmungsfaktor moderner Rationalität. Ein zweiter ist durch Verflechtungen gegeben. Wird sich, wenn man diese ins Auge faßt, ein anderer Befund einstellen? Auch Verflechtungen bestehen auf zwei Ebenen. Sie betreffen sowohl die Ausdifferenzierungsprodukte des ersten Pluralisierungschritts, die Rationalitätstypen, als auch die Akteure des zweiten Pluralisierungschritts, die Paradigmen. Der Kürze halber beschränke ich mich auf die Analyse der letzteren.4
a. Binnensektorielle Verflechtungen Paradigmen sind - anders, als man gewöhnlich meint - meist bis in ihren Kern hinein durch Verflechtungen bestimmt. Als erstes ist dabei an binnensektorielle Verflechtungen zu denken. Paradigmen bilden sich im allgemeinen in Gegenzeichnung gegen andere Paradigmen des gleichen Bereichs. Sie werden konzipiert, weil man vorhandene Paradigmen für ungenügend, neuen Problemen nicht gewachsen oder konstitutionell mißraten ansieht. Von dieser Genese her sind den Paradigmen Verhältnisse des Gegensatzes oder der Fortführung, der Umdeutung oder Verwerfung, der Wiederaufnahme oder Neuartikulation von Anfang an eingeschrieben.
b. Transsektorielle Verflechtungen
Vernunft heute
323
Zweitens weisen die Paradigmen transsektorielle Verflechtungen auf. Beispielsweise stützt sich das universalpragmatische Paradigma der Moral auf eine ganze Reihe anthropologischer, sprachphilosophischer und entwicklungstheoretischer Annahmen, deren Begründungen anderswoher zu garantieren sind. Ebenso gehören oftmals spezifische historische Verhältnisse zum Bedingungssatz eines Paradigmas. So setzen sozialdarwinistische Theorien nicht nur den biologischen Darwinismus voraus, sondern greifen auch nur in einer Konkurrenzgesellschaft und unter Zusatzbedingungen wie Selbstverständniskrise oder Übervölkerungsdruck. Ethikmodelle sind selbst dort, wo sie nicht historisch argumentieren, von historischen Erfahrungen und aktuellen Problemlagen geprägt. Kunsttheorien beziehen sich oft nicht nur auf Befunde aus der Entwicklung der Kunst, sondern stützen sich zugleich auf allgemeine Zeitdiagnosen - heute beispielsweise auf die Dominanz der elektronischen Medien oder auf neuere Entwicklungen in der Wissenschaft, etwa die Chaostheorie. Manchmal haben solch transsektorielle Bezüge nur konturierende oder plausibilisierende Funktion, oftmals haben sie aber auch konstitutive Funktion für die Paradigmen. Deren entscheidende Begründungen können außerhalb liegen.
c. Die interparadigmatische Struktur der Paradigmen Zusammengefaßt bedeutet dies: Paradigmen sind im allgemeinen interparadigmatisch verfaßt. Sie sind das sowohl ihrer Genese wie bleibenden Zügen ihrer Verfassung und vielen ihrer Optionen nach. Wo immer man ein Paradigma eingehend analysiert, wird man auf solch scheinbar externe Relationen, Fremdvoraussetzungen und Basisanschlüsse stoßen. Die Paradigmen sind gleichsam von Anfang an fremdgegangen. Sie implizieren Anleihen, Übernahmen, Fundierungen und Trabanten aus zum Teil beträchtlich entfernten Bereichen. Die vordergründige Erscheinung eines Paradigmas stellt gleichsam nur die Spitze des Eisbergs dar, der es im ganzen ist.
324 d. Umdenken hinsichtlich der Realverfassung der Rationalität - die Unhaltbarkeit der Selbständigkeitsprämisse Das nötigt zu einem prinzipiellen Umdenken in Sachen Rationalität. Die Paradigmen - und damit die ‘Radikale’ der Rationalität - sind in Wahrheit nicht insular, sondern netzartig verfaßt. Sie stellen nicht Solitäre, sondern Komplexe dar. Man ließ sich bislang allzu selbstverständlich von der Erwartung selbständiger und wohldefinierter Rationalitätstypen und Paradigmen leiten. Verbindungen wurden zwar nicht geleugnet, aber als Sekundärphänomene betrachtet.5 In Wahrheit verhält es sich jedoch umgekehrt. Die Paradigmen sind schon in ihrem Kern durch Verflechtungen bestimmt. Die Sphäre der Rationalität ist von ihrer Mikroebene bis zur Makroebene, sie ist insgesamt durch Verflechtungen geprägt. Dieser Verflechtungsbefund scheint mir heute den springenden Punkt der Rationalitätstheorie auszumachen. Das Selbständigkeitsaxiom war das proton pseudos der bisherigen Rationalitätstheorien. Man stellte sich die Welt der Rationalität wie eine friedlichschiedlich in Territorien mit je eigenen Populationen eingeteilte Erde vor. Das war Nationalstaatsdenken im Bereich der Rationalitätstheorie - mit der Hoffnung auf Nicht-Vermischung der Rassen und auf Verschonung vor Multikulturalität und Cross-Culture. Heute ist solcher Rationalitäten-Nationalismus unhaltbar geworden. Wie wir gegenwärtig auf der Ebene der Kulturen erkennen müssen, daß diese längst nicht mehr gegeneinander abgeschottet sind - Bestrebungen in diese Richtung sind vielmehr eklatant reaktionär, nur leistet noch allzuvieles in unseren herkömmlichen Kulturbegriffen dieser Tendenz Vorschub -, so ist auch hinsichtlich der Rationalität ein entsprechender Wandel fällig. Die Rationalitäten gehen - salopp formuliert - beträchtlich durcheinander. Verflechtungen bestimmen ihre Signatur. Es gilt, zu einem von Grund auf non-separatistischen Design der Rationalität überzugehen. Nur dann wird man von der Realverfassung der Rationalität sprechen.6
e. Integration infolge der Verflechtungen?
Vernunft heute
325
Andererseits: Könnte man nicht gerade angesichts der Verflechtungen noch einmal die Hoffnung fassen, sie würden zu einer Integration, ja gar zu Systembildung führen können oder müssen? Denn selbst wenn das Netz der Verflechtungen sehr komplex sein sollte - muß es nicht, da nichts vom Verflechtungscharakter ausgenommen ist, letztlich auf einen Gesamtzusammenhang hinauslaufen? Diese Hoffnung wird gründlich enttäuscht. Die Verflechtungslinien führen nicht zu einem kohärenten Netz, sondern zu unterschiedlichen Gespinsten. Die gemeinsamen Elemente nehmen oft schon nach wenigen Schritten eine andere Bedeutung an. Im Kontext eines anderen Paradigmas verändern sie ihren Sinn und Aspekt - manchmal nur um Haaresbreite, gelegentlich aber auch ums Ganze. Die ‘Gemeinsamkeiten’ führen daher - scheinbar paradox - aus der Unterschiedlichkeit nicht heraus, sondern eher noch tiefer in sie hinein. Integration mag eine Nahwirkung, Dispersion wird die Fernwirkung der Verflechtungen sein.
5. Unübersichtlichkeit im Ganzen der Rationalität Insgesamt führt somit sowohl die zunächst dargestellte Paradigmenpluralisierung als auch die soeben thematisierte Verflechtungsstruktur der Paradigmen zum Gesamtbefund einer Unordentlichkeit der Rationalität im Kleinen wie im Großen, von ihren Elementen bis zum Ganzen. Das Feld der Rationalität ist insgesamt zu einer hochkomplexen Sphäre rationaler Unordentlichkeit geworden. Eine Ordnung des Ganzen kommt nicht mehr in Sicht - vielmehr tauchen immer mehr Gründe auf, warum mit dergleichen nicht mehr zu rechnen ist. Soviel zur heutigen und neuartigen Verfassung der Rationalität. Nicht nur das Ausmaß der Pluralisierung, sondern vor allem der Formbefund ist neuartig. Die Elemente der Rationalität besitzen die Form von Komplexen mit weitverzweigten Verbindungen, und die Gesamtform der Rationalität ist durch Unordentlichkeit gekennzeichnet. Diese rationale Unordentlichkeit gilt es als Realverfassung der Rationalität zu erkennen. Sie hat ersichtlich nichts mit einer Anzapfung irrationaler Potentiale zu tun. Die Auflösung der klaren Linien der
326 Rationalität resultiert vielmehr aus dem Entwicklungsprozeß der modernen Rationalität selbst. Insofern handelt es sich in einem betonten Sinn um rationale Unordentlichkeit.7 Man wird diese Unordentlichkeit und die durch sie gestiegenen Problemvorgaben, die der Bearbeitung durch Vernunft harren, weder einfach abwehren noch leichthin ‘bewältigen’ können. Die Aufgabe von Vernunft wird vielmehr sein, sich auf diese Unordentlichkeit einzulassen und mit ihr - nicht gegen sie - zu denken. Nur eine Vernunft, die dies vermag, wird noch leistungsfähig sein können und ihren Namen zu Recht tragen. Gegen die Versuchung, die Unordentlichkeit noch einmal zu ignorieren, um weitermachen zu können wie gewohnt, sei eine Feststellung Adornos angeführt: “Das
traditionelle
Denken
und
die
Gewohnheiten
des
gesunden
Menschenverstandes [...] fordern ein Bezugssystem, ein frame of reference, in dem alles seine Stelle finde. Nicht einmal allzuviel Wert wird auf die Einsichtigkeit des Bezugssystems gelegt - es darf sogar in dogmatischen Axiomen niedergelegt werden -, wofern nur jede Überlegung lokalisierbar wird und der ungedeckte Gedanke ferngehalten. Demgegenüber wirft Erkenntnis, damit sie fruchte, à fond perdu sich weg an die Gegenstände. Der Schwindel, den das erregt, ist ein index veri [...].”8 - In diesem Sinn gälte es, auch den Schwindel, den die rationale Unordentlichkeit hervorruft - eben als “index veri” - auf sich zu nehmen.9 II. Neubestimmung von Vernunft angesichts der Pluralen und ‘unordentlichen Fassung’ der Rationalität Vernunft - so meine These - muß angesichts dieser veränderten Verfassung der Rationalität selbst neue Konturen annehmen. Im folgenden versuche ich darzulegen, Vernunft welcher Art in dieser Situation noch leistungsfähig zu sein vermag. Zuvor ist allerdings auf einen Einwand der Parteigänger der Rationalität einzugehen. Wozu, so fragen sie, soll es in einer Situation hochdifferenzierter und ubiquitärer Rationalität Vernunft überhaupt noch brauchen? Werden nicht alle denkbaren Fragen schon durch die Rationalitäten beantwortet?
Vernunft heute
327
1. Vernunft und Rationalität a. Die Aufgabe der Vernunft gegenüber der Rationalität Vernunft bleibt nötig, sofern es ihre Eigenart ist, sich auf das Ensemble der Rationalitäten zu beziehen, und sofern ihre Aufgabe darin liegt, für das korrekte Verhältnis der Rationalitäten Sorge zu tragen. Dies ist die moderne Konstellation von Vernunft und Rationalität seit Kant.10 Die einzelnen Rationalitäten sind auf ihre Eigenperspektive beschränkt und nehmen allenfalls noch auf rationale Gegebenheiten in ihrem näheren Umfeld Rücksicht. Sie wollen verläßliche Gegenstandsaussagen machen, nicht der komplexen Konfliktsituation der Rationalitäten im ganzen Rechnung tragen. Sie zielen nicht auf diskursive Gerechtigkeit. Dies hingegen ist die Aufgabe der Vernunft - eine gerade angesichts der Vielheit von Rationalitäten höchst dringliche Aufgabe. Vernunft muß die unterschiedlichen und einander widerstreitenden Rationalitätsversionen ins rechte Verhältnis setzen. b. Reine Vernunft - die Eigenart von Vernunft gegenüber Rationalität Dabei wird Vernunft als Vermögen unbeschränkter Reflexion wirksam. Vernunft vermag jeden erreichten Einsichtsstand erneuter Befragung und Reflexion auszusetzen. In dieser Tätigkeit ist sie - zumindest prozessual - von jeglicher Prägung durch die Paradigmen, mit denen sie befaßt ist, frei. Vernunft ist im Kern reine Vernunft - oder nicht Vernunft. Diese Reinheit hat allerdings die strikte inhaltliche Leere der Vernunft zur Kehrseite. Vernunft ist kein Vermögen inhaltlicher Prinzipien. Wie Karl Jaspers sagte: Vernunft bringt “nichts durch sich selbst hervor”, “ist kein eigener Ursprung als Gehalt”.11 Inhaltliche Prinzipien zu vertreten, Gegenstandsaussagen zu machen und Gebiete zu konstituieren, ist vielmehr Sache der Rationalitäten. Vernunft hingegen bezieht sich auf das Verhältnis solch rationaler Aussagegruppen und Ansprüche. Darin ist sie bleibend etwas anderes als Rationalität. Dies soll nicht heißen, daß Vernunft und Rationalität schlechthin zu trennen wären - eher soll auf ihr Passungsverhältnis hingewiesen werden. Vernunft und Rationalität sind nicht zwei separate Vermögen, sondern dasselbe
328 Vermögen in unterschiedlicher Ausrichtung. Es gibt das eine gar nicht ohne das andere. Vernunft wäre ohne Rationalität gegenstandslos; umgekehrt sind den Vollzügen der Rationalität Momente von Vernunft schon inhärent. Nur können diese Funktionsweisen einander nicht wechselseitig ersetzen. Vernunft kann nicht die Aufgabe der Rationalitäten, Sachaussagen zu machen und Bereiche zu konstituieren, übernehmen. Umgekehrt kann Rationalität nicht die Aufgabe der Vernunft, das korrekte Verhältnis der Rationalitäten im ganzen zu ermitteln, erfüllen. 2. Die Frage nach dem Ganzen Warum aber ist die für Vernunft charakteristische Frage nach dem Ganzen unumgänglich? Woher rührt sie überhaupt? a. Totalität als Frage der Vernunft Diese Frage entstammt der Dynamik der Vernunft selbst. Man kann sie “nicht abweisen”, weil sie “durch die Natur der Vernunft selbst aufgegeben” ist.12 Daß Vernunft aufs Ganze geht, ist eine elementare Bestimmung. Dabei ist es nicht so, daß Ganzheit objektiv bestünde, daher klärungsbedürftig wäre und daß wir dann glücklicherweise auch noch über Vernunft als Vermögen zur Beantwortung dieser Frage verfügten. Logisch verhält es sich vielmehr umgekehrt. Vernunft - und nur sie - wirft die Frage nach dem Ganzen auf. Sie erzeugt den Horizont Totalität und ist zugleich das Vermögen zu seiner Klärung. b. Der traditionelle Fokus der Totalitätsfrage: Einheit Was aber ist des näheren die Perspektive, die Vernunft bei ihrem Hinausgang ins Ganze verfolgt? Traditionell war dies die Perspektive der Einheit. Aber wenn meine vorausgegangenen Ausführungen über die Situation der Rationalität richtig sind, dann kann Vernunft angesichts der neuen Verhältnisse der Rationalität nicht mehr unverändert den Erweis letzter Einheit oder Ordnung zum Ziel haben. Denn letztlich stößt sie im Ganzen auf Diversität und Unordentlichkeit. Die vernünftige Betrachtung erkennt gerade die generativen Mechanismen, die
Vernunft heute
329
zu diesem Resultat führen. Von da an wird sich Vernunft zu einer Entkoppelung von Ganzheitsfrage und Einheitsantwort genötigt finden. Die klassische Annahme, die Antwort auf die Frage nach dem Ganzen könne nur im Aufweis letzter Einheit bestehen, entsprach bloß der traditionellen Erwartung, nicht einer Verbindlichkeit von Vernunft überhaupt. Angesichts einer Gesamtsituation rationaler Unordentlichkeit kann, die Frage nach dem Ganzen zu stellen, nicht mehr eo ipso bedeuten, sie im Sinn von Einheit zu beantworten. Selbstverständlich verspüren wir auch heute noch das Bedürfnis nach Einheit und empfinden Freude, wenn es uns gelingt, Unterschiedliches zur Einheit zu verbinden. Nichts wäre törichter, als sich der Anstrengung der Einheitssuche einfach entziehen zu wollen - und nichts naiver als der Glaube, man könne solch traditionelle Prägungen dadurch loswerden, daß man sich nicht mehr um sie kümmert; das wäre vielmehr die sicherste Art, ihnen unkontrolliert zu verfallen. Aber wenn die vernünftige Analyse heute letztlich auf Vielheit und Unordentlichkeit führt, dann muß man sich diesem Befund stellen, statt ihn zu leugnen. Schon Kant wies darauf hin, daß man sich im Fall eines Konflikts zwischen dem auf Einheit zielenden “Bedürfnis der Vernunft”13 und einer Vielheit erweisenden Einsicht der Vernunft gegen den Einheitswunsch für die Vielheitseinsicht entscheiden müsse. Andernfalls degradierte man Vernunft zum bloßen Handlanger von Wünschen.14 c. Der neue Fokus der Totalitätsfrage: Gerechtigkeit Was aber wird dann, wenn Einheit angesichts der Unmöglichkeit eines ausschreibbaren Begriffs des Ganzen als Leitidee in den Hintergrund treten muß, zur neuen, in den Vordergrund rückenden Leitidee der Vernunft? Die Idee der Gerechtigkeit - die Idee rationaler Gerechtigkeit. Sie bildet die neue Leitperspektive einer Vernunft, die, ihrer Ganzheitsverpflichtung folgend, auf den Umstand stößt, daß sich das Ganze nicht mehr zu einer einheitlichen Ordnung fügt, sondern durch eine Vielheit gegenläufiger Rationalitäten und Optionen gekennzeichnet bleibt. In dieser Situation vermag nur noch das Ideal der Gerechtigkeit Orientierung zu bieten. Deshalb wird Gerechtigkeit zur
330 neuen Leitidee einer Vernunft, die sich auf eine Vielzahl von Rationalitäten unter Bedingungen rationaler Unordentlichkeit beziehen muß. Während sich die einzelnen Rationalitäten, wie gesagt, nur sehr beschränkt und in vergleichsweise egoistischer Absicht auf andere Rationalitäten beziehen sie suchen dort Anschlußpunkte oder Stützen zu finden oder wollen Kontrahenten aus dem Feld schlagen -, bleibt es der Vernunft vorbehalten, sich in der Weise der Gerechtigkeit auf die Rationalitäten insgesamt zu beziehen. Darin liegt ihre neue, angesichts von Diversität und Unübersichtlichkeit sowohl schwierige wie unverzichtbare Aufgabe. Wie aber kommt diese Idee der Gerechtigkeit gewissermaßen in die Vernunft hinein? Und warum nur in der spezifischen Form rationaler Gerechtigkeit, nicht als Gerechtigkeit überhaupt? Meine These lautet: Gerechtigkeit wird heute durch Konsequenzen, die sich unter dem Aspekt der Wahrheit ergeben, zur neuen Leitidee der Vernunft. aa. Anerkennung Bei genauer Analyse der Paradigmen bzw. rationalen Komplexe zeigt sich, daß diese jeweils eine bestimmte innere Konfiguration - eine interne Logik aufweisen und daß sie - zumindest in bestimmten Punkten und in gewissem Rahmen - externe Leistungsfähigkeit besitzen. Zwar wird das eine oder andere Paradigma einer entsprechenden Prüfung nicht standhalten (sei es, weil es logischer Konsistenz entbehrt, oder weil es nichts leistet, was andere, insgesamt leistungsfähigere Paradigmen nicht auch leisten würden). Aber dabei bleibt eine Mehrzahl gut bewährter Paradigmen übrig. Deren Verhältnis aber ist eines des Konflikts.15 Sie vertreten unterschiedliche Einzelaussagen und Rahmenthesen. Nun sind die Paradigmen bzw. rationalen Komplexe, die dieser ersten Prüfung standhalten, zumindest in einem schwachen Sinne wahr zu nennen: im Sinn von Leistungsfähigkeit (pragmatischer Wahrheitsbegriff) oder im Sinn von Erschließungskraft (entdeckender bzw. ‘aletheuischer’ Wahrheitsbegriff).16 Die Anzahl dieser Paradigmen aber läßt sich, wie zuvor dargelegt wurde, nicht weiter reduzieren, weil für die Beurteilung ihrer Kontroversen keine überlegenen bzw. neutralen Kriterien, sondern nur Kriterien der Beteiligten selbst zur Verfügung stehen. Daher ist - unter Wahrheitsgesichtspunkten - die
Vernunft heute
Anerkennung
331 dieser
Paradigmen
geboten.
Sobald
Konsistenz
und
Leistungsfähigkeit klargestellt sind, gibt es keinen Grund mehr, eines von ihnen aus dem Kreis legitimer Kandidaten auszuschließen. Auch wäre die Nichtberücksichtigung mit Einbußen verbunden, denn man ginge der spezifischen Aufschlüsse, derer das jeweilige Paradigma fähig ist, verlustig. Somit ist die Anerkennung nicht nur juridisch, sondern auch pragmatisch, sie ist sowohl unter logischen wie unter Wahrheitsgesichtspunkten geboten.17 bb. Gerechtigkeit Mit dieser Anerkennung ist der erste Schritt in Richtung Gerechtigkeit getan. Der zweite schließt daran unmittelbar an. Anerkennung verpflichtet stets zur Wahrung und Sicherung der Rechte des Anerkannten. Wenn also der Rechtsanspruch der rationalen Komplexe einsehbar und ihre Anerkennung geboten ist, dann besteht auch die Pflicht, ihre jeweiligen Rechtsansprüche zu sichern, Unrecht zu unterbinden und Gerechtigkeit im Ganzen zu gewährleisten. Darin liegt fortan die genuine Aufgabe der Vernunft. Sie muß für die Rechte des Anzuerkennenden eintreten. Daher wird Vernunft, wo sie ihre klassische Wahrheitsverpflichtung unter Bedingungen der Pluralität reflektiert und weiterverfolgt, zur Perspektive der Gerechtigkeit geführt. Die Anwaltschaft der Vernunft für Wahrheit im Ganzen vollendet sich unter Pluralitätsbedingungen in der Idee der Gerechtigkeit.18 Erst diese Perspektive der Gerechtigkeit sichert auch die Rationalität - statt bloßer Machtbestimmtheit - der Auseinandersetzung. “Rationale Gerechtigkeit” hat insofern einen doppelten Sinn. Sie bedeutet erstens die Gerechtigkeit gegenüber den Formen der Rationalität, und sie garantiert zweitens die Vernünftigkeit bzw. die Rationalität des Umgangs mit und unter ihnen. Bloße Rationalität und Machtbestimmtheit versus Vernünftigkeit und Gerechtigkeit das ist die Alternative. 3. Die Rationalitätsverwiesenheit der Vernunft in ihren Operationen a. Vernunft kann nicht dekretieren, sondern muß ins Geflecht der Rationalitäten eintreten Wie erfüllt Vernunft - und welche Vernunft - die skizzierte Aufgabe?
332 Gewiß darf Vernunft nicht dekretorisch verfahren. Denn erstens verfügt sie in Wahrheit über keinen Prinzipiensatz, von dem aus das ‘richtige’ Verhältnis und die ideale Architektonik der Rationalitätenwelt zu statuieren wäre. Und zweitens würde Vernunft sich, solcherart dekretorisch verfahrend, grundsätzlich mißverstehen, würde sich selbst zu einer Rationalitätsform neben anderen herabsetzen, denn die Dekretierung von Axiomen und die Durchsetzung inhaltlicher Prinzipien ist Sache von Paradigmen. Vernunft muß vielmehr ins Geflecht der rationalen Komplexe eintreten. Sie muß inmitten derselben operieren und zwischen ihnen ihr klärendes Geschäft betreiben. b. Übergänge als Bewegungsform der Vernunft Wie vermag sie das? Die eigentümliche Bewegungsform der Vernunft liegt in Übergängen. Vernunft geht - vergleichend und unterscheidend, nachforschend und verändernd, verbindend und trennend - zwischen den rationalen Komplexen hin und her. Sie vollzieht Seitenblicke, Durchquerungen, Gegenzeichnungen. Übergänge bilden die spezifische Vollzugsform der Vernunft in all ihren Tätigkeiten. Diese Übergänge sind das Proprium -die Domäne und die zentrale Tätigkeit- der Vernunft. c. Übergänge - aber kein System Es ist fast überflüssig zu erwähnen, daß der zuvor hinsichtlich der Rationalität dargestellte Befund sich auch auf der Ebene der Vernunft wiederholt. Auch die Übergänge der Vernunft führen nicht zu einem abschließenden System. Denn die Vernunft entdeckt Verbindbarkeiten und bleibende Differenzen zumal. Die Verbindungen, die sie erreicht, sind nicht total, sondern partial, und sie sind nicht als irreversible Synthesen mißzuverstehen, sondern werden auch wieder brüchig werden. Vernunft knüpft neue Verbindungen, und dabei werden die vorherigen Verknüpfungen zwar ihre Gültigkeit behalten, aber andere werden sie neu gewinnen. Daher führen die Übergänge der Vernunft nicht zur Bildung eines Gesamtsystems, sondern gleichsam zum Gang durch unterschiedliche Gespinste.19 Vernunft wird bleibend zwischen mehreren Ausgriffen ins Ganze überzugehen haben. Eine abschließende Architektur kommt nicht in Sicht.
Vernunft heute
333
4. “Transversale Vernunft”: Konturen einer auf die geschilderte Situation der Rationalität zugeschnittenen Vernunft Im Blick darauf, daß Vernunft sich wesentlich in Übergängen vollzieht, bezeichne ich sie als ‘transversale Vernunft’. Solch transversale Vernunft ist, von den Rationalitäten aus gesehen, nötig, um zwischen deren diversen Formen Austausch und Konkurrenz, Kommunikation und Korrektur, Anerkennung und Gerechtigkeit zu ermöglichen. Umgekehrt ist diese Vernunft auf die rationalen Konfigurationen als ihr Operationsfeld angewiesen. Beides zusammen - daß Rationalität einer Vernunft der Übergänge bedarf und daß die Tätigkeit der Vernunft sich wesentlich auf die Rationalität bezieht - kommt im Konzept transversaler Vernunft zum Ausdruck. Natürlich handelt es sich bei dieser transversalen Vernunft nicht um ein schlechthin neues Vermögen. Das Konzept transversaler Vernunft akzentuiert nur ein Moment, das immer schon zu Vernunft gehörte, das heute aber besondere Bedeutung erlangt - das Moment der Übergänge - neu und nachhaltig. Solch transversale Vernunft ist von Vernunfthybris, der Unterstellung autonomer Prinzipienvernunft, und Vernunftdefaitismus, der Preisgabe der Vernunft angesichts der Vielzahl von Rationalitäten, gleich weit entfernt. III. Leistungen der transversalen Vernunft Worin liegen die spezifischen Leistungen solcher Vernunft? Denn daran, daß auf solche Leistungsfähigkeit weiterhin Wert zu legen ist, kann kein Zweifel sein. Stärke im Sinn von Leistungsfähigkeit - funktionale Stärke - wird man weiterhin von Vernunft verlangen müssen. Allerdings wird unter den neuen Bedingungen nur noch eine ihrem Zuschnitt nach schwache - eine strukturell ‘schwache’ Vernunft - funktional stark sein können. Strukturelle Schwäche und funktionale Stärke - das ist ein Charakteristikum der gebotenen Vernunftform. Oder anders gesagt: Die heute gebotene Vernunft wird sich zwar, an der traditionellen Vorstellung von Vernunft gemessen, als schwach ausnehmen, aber es gilt, diese veränderte Struktur als Ermöglichung einer neuen, zeitgemäßen Art von Stärke zu begreifen.
334 1. Exposition der neuartigen Realverfassung der Rationalität Die erste Leistung transversaler Vernunft besteht in der Exposition der neuartigen Verfassung der Rationalität. So war deren im I. Teil gegebene Darstellung natürlich eine Darstellung aus dem Blickwinkel dieser Vernunft, nicht aus der Perspektive einer der beteiligten Rationalitäten. Vernunft analysiert die diversen rationalen Strukturen, macht die generativen Mechanismen der Unordentlichkeit deutlich und legt deren Konsequenzen im ganzen offen. Vernunft beseitigt die ‘Unordentlichkeit’ nicht, sondern gibt uns die Gründe für die Realverfassung der Rationalität allererst zu erkennen. Daraus erwächst zugleich eine Art pädagogischer Wirkung. Vernunft macht uns die neuartige Verfassung zugänglich und führt uns in sie ein. Sie zeigt nicht nur das Faktum und die Unausweichlichkeit dieser Situation auf, sondern verleiht uns auch Kompetenzen für den rechten Umgang mit ihr. Sie lehrt, wie man sich inmitten dieser komplexer gewordenen Situation - also auf schwankenden Fundamenten und in einer Gesamtsituation der Unordentlichkeit - richtig bewegen kann. 2. Leistungen entsprechend der Leitidee Gerechtigkeit An zweiter Stelle sind, der zuvor genannten neuen Leitidee der Vernunft entsprechend, die gerechtigkeitsbezogenen Leistungen zu nennen. a. Interventionen im Feld der Rationalität zum Zweck diskursiver Gerechtigkeit Die Gerechtigkeitsarbeit der Vernunft beginnt mit Interventionen auf der Elementarebene der Paradigmen. Eine vernünftige Betrachtung nimmt die Paradigmen nicht einfach so hin, wie sie sich selbst darstellen. Sie setzt sie vielmehr sowohl interner wie externer Kritik aus. Ebensowenig erfreut sich Vernunft einfachhin an der Vielzahl von Paradigmen - etwa mit dem Zusatzgedanken, es sei gut, daß es viele Paradigmen gebe, so könne jeder wählen, was ihm passe: anything goes. Die Position der Vernunft ist weder die simpler Identifikation noch die bequemer Permissivität. Vernunft kritisiert die Paradigmen, um sie allererst in ihre vernünftige Form zu überführen.
Vernunft heute
335
Dabei muß sie sowohl einer ungenügenden Selbstauffassung wie einem falschen Selbstbewußtsein der Paradigmen entgegentreten. Denn erstens neigen die Paradigmen in ihrer ‘naturwüchsigen’ Form dazu, ihren eigenen komplexen Charakter zu verkennen. Sie sind sich nur der Spitze, nicht auch des Sockels ihres ‘Eisbergs’ bewußt. Ihre Selbstauffassung ist borniert. Zweitens wohnt ihnen eine Tendenz inne, ihr Verhältnis zu den anderen Paradigmen zu verzeichnen. Sie tendieren zu Ausschließlichkeitsansprüchen. Ihr Selbstbewußtsein ist hypertroph. Vernunft geht sowohl gegen jene beschränkte Selbstauffassung wie gegen dieses unbeschränkte Selbstbewußtsein, also gegen das doppelte Scheuklappensyndrom der Paradigmen an. Sie tut dies, indem sie die Paradigmen über ihren intern komplexen Charakter aufklärt und sie zugleich dazu anhält, sich auch der externen Komplexität - der Legitimität anderer Paradigmen und kontroverser Ansprüche - zu stellen. Dies geschieht auf dem Weg einer eindringlichen Analyse und umfassenden Rekonstruktion der Paradigmen. Wie im Röntgenlicht wird deren Struktur durchleuchtet und das Geflecht von Anleihen und Begründungen aufgedeckt, inmitten derer das jeweilige Paradigma operiert und von dessen Tragfähigkeit, Elastizität und Regenerationsfähigkeit es profitiert. Dadurch werden die Paradigmen genötigt, bereits zur rechten Reflexion ihrer selbst über ihre vordergründige Abschottung hinauszublicken und ihre interparadigmatische Struktur ins Auge zu fassen. Schon im Interesse eines zureichenden Selbstverständnisses sind sie genötigt, sich der Paradigmenvielfalt und -konkurrenz zu stellen. So bahnt der Wegfall der inneren Scheuklappen zugleich den der äußeren an. An die Stelle der restringierten Selbstauffassung der Paradigmen tritt das Bewußtsein ihrer Komplexität. Zudem zeichnet sich die Begrenztheit und Fragilität des jeweiligen Paradigmas ab. Dadurch werden Ausschließlichkeitsansprüche abgebaut. Die Relativität des Paradigmas Bedingung seiner Geltung - wird offenbar. Ein nächster Punkt liegt im Einspruch gegen Majorisierungen. Allerdings gilt es - im Unterschied zur üblichen Auffassung - zu beachten, daß solche Majorisierungen nicht dort schon vorliegen, wo ein Paradigma auf Elemente, Gehalte und Ansprüche anderer Paradigmen übergreift. Solche Ausgriffe sind
336 vielmehr unvermeidlich, gehören zur konstitutiven und legitimen Struktur der Paradigmen. Zu kritisieren ist allein ein damit verbundener Ausschließlichkeitsanspruch, also der willkürliche, allenfalls scheinbar selbstverständliche und mit ungenügenden Argumenten vollzogene Ausschluß gegenläufiger Paradigmen. Die Durchsetzung müßte, wenn schon, argumentativ gerechtfertigt, nicht einfachhin dekretiert werden. Schließlich wird die Leitidee der Gerechtigkeit insbesondere für die äußerste Frage, die Frage nach den Verhältnissen im Ganzen, bedeutsam. Gerade ein Ganzes, welches durch rationale Unordentlichkeit gekennzeichnet ist, bedarf der Gerechtigkeit als letzter Ordnungsvorstellung. Nur durch sie lassen sich die legitimen Ansprüche der Rationalitäten sichern und vor internen und externen Übergriffen sowie vor latenten und offenkundigen Verabsolutierungen bewahren. Nur eine Vernunft, die sich der Spezifität der Paradigmen, Paradigmenverbände und Paradigmennetze bewußt ist und die Vielfalt und Gegenwendigkeit der Optionen im ganzen zu verfolgen vermag, ist fähig, insgesamt für rationale Gerechtigkeit zu sorgen. Durch die bislang genannten Interventionen gibt Vernunft den Beständen der Rationalität - von der Mikroebene der Paradigmen bis zur Makroebene der Gesamtdeutungen - einen Zuschnitt, der die Existenz und Legitimität anderer rationaler Bestände nicht leugnet, sondern anerkennt. Sie gibt ihnen damit eine Form, die “vernünftig” genannt zu werden verdient. Deren Kriterium ist die Berücksichtigung anderer Optionen bis hin zum Blick ins Ganze. b. Kritik pseudovernünftiger Ansinnen Vernunft wird sich auch gegen Fehltendenzen wenden müssen, die Berufungen auf die Vernunft selber entspringen. Sie muß all denjenigen Strategien entgegentreten, die mit der Pluralität der rationalen Formen - vorgeblich im Namen der Vernunft - noch einmal nicht anerkennend, sondern tilgend, nicht exponierend, sondern eliminierend, nicht im Sinn von Gerechtigkeit, sondern mit dem Ziel der Auslöschung umzugehen beabsichtigen. Das Versprechen universaler Versöhnung, die Proklamation umfassender Einheit, das Fanal zur Tilgung der Pluralität zugunsten neuer Totalintegration sind Verlockungen, die durch ihr Pathos die Klarheit vernünftiger Betrachtung
Vernunft heute
337
außer Kraft zu setzen suchen. Gegen derlei Optionen, die an den heutigen Verhältnissen der Rationalität vorbeigehen, richtet sich der kritische Stachel der Vernunft. Stets war Vernunft gehalten, bestehenden alltäglichen wie professionellen Auslegungen der Vernünftigkeit entgegenzutreten. Das bleibt auch heute geboten. Die hyperbolischen Ansprüche sind nicht der Begeisterung der Herzen zu überlassen, sondern der Prüfung der Köpfe auszusetzen. 3. Entscheidungen Allerdings könnte man vermuten - und damit gehe ich zu einem weiteren Punkt über -, daß die Anforderungen der Gerechtigkeitsperspektive die Vernunft entscheidungsunfähig machen. Das wäre jedoch ein voreiliger Schluß. Denn zwar bringt die Perspektive der Vernunft ohne Zweifel Erschwerungen mit sich. Sie verlangt ja die Berücksichtigung sämtlicher relevanten Gesichtspunkte, wodurch sich die Komplexität von Entscheidungssituationen beträchtlich erhöht. Zudem gebietet sie, die unterschiedlichen Optionen im Licht ihrer eigenen Kriterien zu würdigen und nicht einfach nach fremden Maßstäben abzufertigen. Da es aber kein Metakriterium gibt, das nicht seinerseits dem Widerstreit der Positionen ausgesetzt wäre, scheint eine gerechte Entscheidung unmöglich zu werden. Auf der anderen Seite muß man sich aber entscheiden. De facto entscheidet man sich auch immer. Auch dann, wenn man die Entscheidung aufschiebt oder keine Entscheidung zu fällen gedenkt, laufen die Ketten der Wirklichkeit weiter. Nichtentscheidungen sind daher in Wahrheit gleichermaßen folgenreich wie Entscheidungen. Auch die epoche affirmiert - das ohnehin Geschehende. Was also vermag Vernunft, die Entscheidungssituationen einerseits schwieriger macht, andererseits an Entscheidungskapazität bereitzustellen? Als erstes macht die vernünftige Analyse die Weitläufigkeit und Komplexität von Entscheidungssituationen transparent. Sie garantiert dadurch Alternativenvollständigkeit, Prämissenbewußtsein und Konsequenzenklarheit. Dumpfe Entscheidungen werden so ausgeschlossen. Zweitens wird ein elementares Entscheidungskriterium zur Geltung gebracht: das der Konsistenz. Nachfolgende Entscheidungen sollen vorausgegangene ja nicht aufheben, sondern fortsetzen. Insofern ermöglicht das
338 Konsistenzkriterium bei Prämissenkonstanz begründete Selektionen. Von den gewählten Prämissen aus (die durch die vernünftige Analyse ihrerseits klarer geworden sind) wird den diese und nicht jene Entscheidung zu treffen sein. Aber wie steht es mit der grundsätzlicheren Wahl zwischen Prämissen? Auf dieser Ebene kommen Standards der Kultur ins Spiel. Eine Kultur der Reflexion (wie die unsere) wird sich von anderen Axiomen überzeugt finden als eine Kultur der Emotion. Eine Kultur der Individualität wird andere Prämissen setzen als eine Kultur der Sozialität. Eine religiöse Kultur wird andere Grundlagen anerkennen als eine wissenschaftliche Kultur. - Läuft dies nicht letztlich doch auf Arbitrarität hinaus? Immerhin gibt es vernünftige Gewohnheiten. Das hat Wittgenstein uns gelehrt.
Jedes
Sprachspiel
beruht
auf
solch
vernunftkonstitutiven
Gewohnheiten. Wenn man “will, daß die Türe sich drehe, müssen die Angeln feststehen”.20 Nun müssen solch kulturelle Prämissen müssen keineswegs bloß kulturwüchsig wirksam sein, sondern sielassen sich erhellen, lassen sich transparent machen. Wenn sich eine Entscheidung einer derartigen Erhellung der Grundprämissen verdankt, verdient sie, vernünftig genannt zu werden. Freilich: Absolut begründbar sind die Prämissen nicht. Denn alle Gründe werden
nur
in
bestimmten
Kontexten
oder
aufgrund
bestimmter
Voraussetzungen und in einem bestimmten Rahmen - eventuell gerade dem Rahmen der Prämissen, die man gerne begründen möchte - relevante Gründe sein. Daher kommt man im Rückgang der Begründungen auf keinen schlechthin unumstößlichen Grund der Akzeptanz. Man wird sich somit - trotz aller Transparenz - immer nur aus vergleichsweise vorletzten oder aus allenfalls praktisch, nicht aber theoretisch letzten Gründen entscheiden können. Allerdings ist dies, selbst theoretisch gesehen, kein spektakulärer oder peinlicher, sondern ein geradezu normaler Befund: Begründungsketten müssen einmal ans Ende kommen. Sie rekurrieren letzlich immer auf etwas, was nicht infolge von Herleitung oder Beweis, sondern auf andere Weise für begründet gilt - indem es einleuchtet oder indem es mit anderen Annahmen konkordant ist oder indem es sich durch seine Folgen empfiehlt oder indem es in der reflexiven Befragung standhält, usw.21
Vernunft heute
339
Eine wirkliche Letztanalyse ist schon aus Gründen der Komplexität nicht möglich. Gewiß ist sie es aufgrund ständig sich vollziehender realer Veränderungen nicht. Zudem wird man die Analyse irgendwann beenden müssen. Vita brevis - die Entscheidung aber drängt. Auch in über-endlicher Zeit wäre kein Ende der Analyse zu erreichen. Der Abbruch genügt vernünftigen Bedingungen dann, wenn durch einen Fortgang der Analyse keine Veränderung mehr zu erwarten stünde, weil alle überschaubaren Gründe, Konsequenzen und Alternativen berücksichtigt und alle absehbaren Querverbindungen und Nebeneffekte bedacht wurden. Dann ein Ende zu setzen, ist - zusammen mit dem Bewußtsein prinzipieller Vorläufigkeit - unumgänglich und pragmatisch vernünftig. Man hat sich der Aufgabe vernünftiger Reflexion im Maß des Möglichen gestellt. In diesem Sinn vermögen die Klärungsleistungen der Vernunft in Entscheidungssituationen weit zu reichen. Man entscheidet sich unter Prämissentransparenz und -vollständigkeit, und die vernünftige Betrachtung macht noch die Grenzen des Verfahrens und seiner Ergebnisse transparent. Freilich sind solche Entscheidungen gegenüber weiteren Befragungen oder objektiv eintretenden Veränderungen nicht zu immunisieren. Im Gegenteil: Man kann sicher sein, daß aus anderer Warte andere Optionen plausibel sein werden und daß real die Veränderung von Prämissen und damit auch von Begründungen und Entscheidungen geboten sein wird. Das Bewußtsein dieser Entscheidungsbedingungen verändert die Konturen des Handelns. Weitblick, Relativität und Alternativenbewußtsein treten an die Stelle absolutistischer Einäugigkeit. Die Praxis wird umsichtiger, rücksichtsvoller und flexibler. Man weiß, daß Alternativen und ungeahnte Potentialitäten bestehen. Hat man einmal die Erfahrung gemacht, daß etwas, was in einer Perspektive völlig klar ist, in einer anderen Betrachtungsweise ebenfalls - aber ganz anders - klar sein kann, und hat man diese Erfahrung nicht verdrängt, sondern reflektiert und ernst genommen, so wird man fortan nicht mehr mit dem Pathos der Absolutheit und der Einbildung der Endgültigkeit urteilen und verurteilen, sondern auch dem Anderen Wahrheit zuerkennen - noch gegen die eigene Entscheidung. Wo ausgreifende Analysen unangebracht sind oder unnötig erscheinen, wird eine vernünftige Betrachtung sich dadurch
340 auszeichnen, daß sie die situationsadäquaten Kriterien zu erfassen und zur Anwendung zu bringen vermag. Sie versteht sich darauf, ein Richtiges zu treffen, das nicht das unter allen Umständen, sondern das in dieser besonderen Situation Richtige ist. Vernunft verbindet ihre Sorge ums Ganze mit einem wachen Gespür für die Situation. 4. Transversale Vernunft und praktische Vernünftigkeit Das führt auf einen weiteren Punkt. Vernunft der skizzierten Art hat eine auffallende Nähe zu Strukturen praktischer Vernünftigkeit. Den Unterschied zwischen theoretischer und praktischer Vernunft kann man generell so fassen: Während theoretische Vernunft einem Ideal der Perfektion folgt und überlegene Distanz zur Bedingung hat, läßt sich praktische Vernunft auf Endlichkeit und Kontingenz ein und ist sich ihres Involviertseins bewußt. Die Eigenart - aus theoretischer Warte: die Unsicherheit - praktischen Wissens hat mit dieser anderen Ausrichtung zu tun: mit der Veränderlichkeit der Umstände, der Komplexität der Verhältnisse, der Handlungsabhängigkeit der Gegenstände, der Diversität der Kulturen, usw. - Es mag theoretische Kalküle geben, einen Algorithmus der Praxis hat noch niemand gefunden. Wenn ich auf Affinitäten zwischen transversaler und praktischer Vernunft hinweise, so habe ich dabei vor allem strukturelle Gemeinsamkeiten im Sinn. Transversale Vernunft rückt von den klassischen Theorie-Idealen der Überlegenheit und Distanz sowie von den Positionen des Prinzipialismus, Fundamentalismus und Absolutismus ab. Stattdessen entspricht ihre Formtypik eher der praktischer Vernunft. Auch sie muß inmitten einer Vielheit von Ansprüchen operieren, Unterschiede beachten, und sie findet sich zu Umsicht und Übergängen genötigt. Auch sie weiß, daß angrenzend andere Möglichkeiten bestehen und daß nur alternativenwach das Richtige zu finden sein wird. Daher kommt es wohl nicht von ungefähr, daß ihre Leitidee, die Idee rationaler Gerechtigkeit, eine besondere Nähe zu praktischer Vernunft - gar zu deren höchster Idee, der Idee der Gerechtigkeit - aufweist. Die geschilderte Veränderung der Konturen der Vernunft enspricht einer generellen, in den letzten Jahrzehnten zu beobachtenden Verschiebung.
Vernunft heute
341
Praktische Vernunft ist gegenüber theoretischer Vernunft in den Vordergrund gerückt. Das hat nicht nur mit besonderen ethischen Problemen der Gegenwart zu tun, und es geht auch über eine “Rehabilitierung der praktischen Philosophie” hinaus. Praktische Vernunft ist - tendenziell - zum Modell von Vernünftigkeit überhaupt geworden, seit sich spezifische Charakteristika praktischer Vernunft als unumgehbare Konstituentien auch theoretischer Vernünftigkeit erwiesen haben. Sie sind in die Matrix von Vernunft überhaupt eingedrungen. Das Konzept transversaler Vernunft folgt dieser Linie. In die gleiche Richtung deutet die Nähe transversaler Vernunft zu Strukturen der Urteilskraft - insbesondere reflektierender Urteilskraft - sowie zu Strukturen der Weisheit. Ich will nun aber gleich zu einem letzten Komplex übergehen und beginne ihn mit der Frage nach dem Verhältnis von transversaler Vernunft und Vernunft überhaupt. 5. Transversale Vernunft und Vernunft überhaupt Meine Vermutung geht dahin, daß transversale Vernunft mehr als nur eine gegenwartsspezifische Vernunftform ist. Ich meine, daß sie einen der innersten Züge von Vernunft überhaupt artikuliert, daß sie geradezu Vernunft überhaupt - aber unter heutigen Bedingungen - ist. a. Transversalität als Vollzugsform jedweder Art von Vernunft Schon jede historische Form von Vernunft war gehalten, Einheit nicht einfach zu dekretieren, sondern an einer vorgefundenen und durch Vorauslegungen geprägten Vielheit aufzuweisen. Das war das Pensum der Vernunft von Parmenides und Heraklit über Kant und Hegel bis in unsere Tage. Jedesmal war dafür verlangt, zwischen unterschiedlichen Gesichtspunkten überzugehen und diese zu einer Gesamtorganisation zu verbinden, welche die Verschiedenheit nicht tilgt, sondern in eine höhere Form überführt - Einheit ohne Verschiedenheit wäre eben nicht Einheit, sondern bloß Einerlei. Selbst deduktive Systeme von Weltbeständen leben von einer doppelten Kenntnis ihrer Gegenstände: gemäß deren systematisch-deduktiver Ableitung sowie gemäß ihrer alltäglich-gewohnten Auslegung. Auch das Licht der episteme bedarf des Kontrasts der doxa. Insofern ist, zwischen verschiedenen Betrachtungsweisen
342 übergehen zu können, für die Tätigkeit der Vernunft seit jeher konstitutiv. Oder anders gesagt: Vernunft operiert stets transversal - zumindest: auch transversal. b. Transversalität als Vollzugsform von Vernunft in ihrer Bezugnahme auf unterschiedliche Vernunftkonzepte Natürlich gilt auch heute: Wenn man nicht nur eine bestimmte Konzeption ausarbeiten und durchsetzen will - wie die Freunde der Rationalität dies versuchen -, sondern wenn man sich - wie es sich unter dem Titel “Vernunft” gebührt - auf die unterschiedlichen Konzepte in ihrer Gesamtheit und ihrem Verhältnis bezieht, dann muß man eine Vernunft der Übergänge praktizieren. In unserer täglichen akademischen Tätigkeit bedienen wir uns denn auch ganz selbstverständlich dieser Prozeßform. Denn nur im Übergehen zwischen verschiedenen Positionen - indem wir sie in einer Art Wechselhermeneutik gegeneinander abwägen - vermögen wir die Diskussion unterschiedlicher Positionen angemessen zu führen. Wir sind zu solchen Übergangsprozessen offenbar nicht nur verpflichtet, sondern auch befähigt. Im einen folgen wir dem Imperativ der Vernunft, im anderen bedienen wir uns der Kraft der Vernunft. Das Vermögen der gleichgewichtigen und erhellenden Bezugnahme auf unterschiedliche Konzeptionen kann letztlich nicht mehr als Funktion einer dieser Konzeptionen, sondern nur noch als Leistung eines ihnen gegenüber reinen Vermögens gedacht werden, eben als Leistung transversaler Vernunft. Stets treffen wir, wenn wir nach der innersten Leistungsfähigkeit von Vernunft fragen, auf ein Vermögen der Übergänge. Übergänge bilden das Medium sämtlicher Operationen und die elementarste Potenz der Vernunft. Es mag sein, daß transversale Vernunft nicht die ganze Vernunft ist - aber sie scheint allenthalben deren grundlegender Modus zu sein. Vernunft ist elementar durch Transversalität bestimmt. 6. Die Wirklichkeit der Vernunft Transversale Vernunft verkörpert (ähnlich wie zuvor die neuzeitliche) die innere Struktur und Bedingung von Subjektivität unter heutigen Bedingungen. In einer Situation nicht nur äußerer, sondern auch innerer Pluralisierung
Vernunft heute
343
vermag allein Transversalität innere Identität zu gewährleisten und äußere Pluralitätskompetenz zu eröffnen.22 a. Vernunft und Vernünftigkeit Das führt zu der Vermutung, daß statt von Vernunft präziser von Vernünftigkeit - im Sinn einer spezifischen Kompetenz von Subjekten - zu sprechen wäre. Die alten Konzepte einer objektiven, kosmischen, einer Weltvernunft sind schwerlich noch haltbar. Aber auch in bezug auf die Subjekte hat die traditionelle Rede von ‘Vernunft’ etwas Antiquiertes und Irreführendes. Sagt man ‘die Vernunft’, so erscheint Vernunft dabei wie ein fester Bestandteil unserer geistigen Ausstattung, wie ein Seelenvermögen. Vernunft ist jedoch nicht von der Art eines Bestandes, sondern bezeichnet ein Vermögen im wörtlichen Sinn, und das heißt: eine Kompetenz, ein Können: eben die Fähigkeit, sich inmitten einer Vielfalt in Übergängen bewegen zu können. Daher spricht man besser - nämlich deutlicher - statt von ‘Vernunft’ von ‘Vernünftigkeit’.23 Nur als solche Vernünftigkeit von Individuen ist Vernunft wirklich. Die Welt mag so vernünftig geplant, konstruiert, verfaßt sein, wie sie will - ihre Vernünftigkeit hängt an der Vernünftigkeit von Individuen. b. Verständigung im Dissens Ich komme zu einem letzten Punkt meiner Charakterisierung transversaler Vernunft. Gewiß wird es unter den heutigen Bedingungen schwieriger, ein zentrales Ziel traditioneller Vernunfttätigkeit noch zu erreichen: das der Verständigung. Zwar hält auch transversale Vernunft an diesem Ideal der Verständigung fest aber sie tut es im Bewußtsein erschwerter Bedingungen und fälliger Modifikationen. Letztliche inhaltliche Übereinstimmung ist nicht mehr - wie traditionell ihr äußerstes Maß. Für die traditionelle Auffassung stehen Hegels eindringliche Worte aus der Vorrede zur Phänomenologie des Geistes: Wer sich “auf das Gefühl, sein inwendiges Orakel, beruft”, sagt Hegel - allgemeiner formuliert: wer sich auf nicht allgemein zugängliche Einsichten beruft -, der ist “gegen den, der nicht übereinstimmt, fertig; er muß erklären, daß er dem weiter nichts zu
344 sagen habe, der nicht dasselbe in sich finde und fühle; - mit anderen Worten, er tritt die Wurzel der Humanität mit Füßen. Denn die Natur dieser ist, auf die Übereinkunft mit andern zu dringen, und ihre Existenz nur in der zustande gebrachten Gemeinsamkeit der Bewußtseine”.24 Dieses Diktum Hegels bietet Gelegenheit, den Unterschied zum heutigen Vernunftverständnis zu markieren. Dem ersten Halbsatz von Hegels Humanitätsrekurs ist zuzustimmen, der zweite aber ist hyperbolisch. Der erste betont, daß Vernunft auf die Übereinkunft mit anderen dringen, Verständigung anzielen muß. Das ist zu bejahen. Der zweite behauptet, daß Vernunft nur dort realisiert sein könne, wo Übereinstimmung erreicht, wo Konsens erzielt sei. Das ist übertrieben. Unter heutigen Bedingungen müssen wir gerade mit der Möglichkeit rechnen, daß die Tätigkeit der Vernunft zuletzt nicht zu einem Konsens, sondern zur Artikulation grundlegender Dissense führt. Gewiß ist auch hierbei die Verständigungsintention leitend - aber sie endet mit der Verständigung über die Unmöglichkeit letzter inhaltlicher Einigung. Durch die Klärungsarbeit der Vernunft wird für beide Parteien deutlich, daß ihre Aussagen und Argumentationen auf unterschiedlichen Basiskonzepten beruhen; auch wird deren eigentliche Konfiguration allererst durch die angestrengte Klärungsarbeit der Vernunft transparent; aber wenn man zwischen diesen Basiskonzepten nicht mehr nach einem gemeinsamen Kriterium entscheiden kann - und damit ist bei solch unterschiedlichen Basiskonzepten systematisch zu rechnen -, dann stellt die Klärung des Dissenses die letzte Auskunft dar, dann ist darin die Tätigkeit der Vernunft vollbracht. Vernunft hat ihre Existenz dann nicht “in der zustande gebrachten Gemeinsamkeit der Bewußtseine”, sondern in der Transparenz der Gründe für die Unmöglichkeit einer solchen Gemeinsamkeit. - Für transversale Vernunft ist dies kein Skandal, sondern ein zunehmend erwartbarer Alltagsfall.
Anmerkungen 1 Ludwig Wittgenstein, Vorlesungen 1930-1935, Frankfurt a. M. 1984, 84. 2 Theodor W. Adorno, Minima Moralia. Reflexionen aus dem beschädigten Leben, in: ders., Gesammelte Schriften, Bd. 4, Frankfurt a.M. 1980, 79. 3 Ich bitte um Nachsicht, wenn die folgenden Ausführungen in einzelnen Punkten sehr knapp gehalten sind. Ich habe den - vielleicht allzu problematischen - Versuch unternommen, Explikationen
Vernunft heute
345
eines Buches in den Umfang eines Aufsatzes zu drängen. Vgl. Verf., Vernunft. Die zeitgenössische Vernunftkritik und das Konzept der transversalen Vernunft, Frankfurt a.M. 1995. 4 Der Versuch einer wohlkonturierten Abgrenzung der Rationalitätstypen voneinander scheitert sowohl in seiner Habermasschen Version (Bezugnahme auf Geltungsansprüche) als auch in seiner Wellmerschen Version (Über Ziele) an der zuvor dargestellten Paradigmenpluralisierung sowie an dem jetzt zu erörternden elementaren Verflechtungsbefund. 5 Das gilt sowohl für Habermas wie - mehr noch - für Lyotard. 6 Offenbar finden wir uns heute auch real durchweg mit Problemstellungen konfrontiert, die aus Verflechtungen resultieren. Selbst wenn Probleme regional entstehen, überschreiten ihre Wirkungen die Grenzen, werden global. Unsere alten, separatistischen Denkformen aber sind unfähig, darauf zu reagieren. Für sie sind solche Grenzüberschreitungen nur ‘unerwünschte Nebenfolgen’ - die man achselzuckend hinnimmt bzw. denen man hilflos gegenübersteht. Als ‘Nebenfolgen’ erscheinen solche Vernetzungseffekte aber nur, solange man separatistisch denkt. Die Kausalketten der Wirklichkeit jedoch halten sich an diese überholten Einteilungswünsche nicht. Wir sind gerade im Blick auf die Realität genötigt, zu Denkformen überzugehen, die von vornherein auf Verflechtungen achten und daher auch deren Konsequenzen Rechnung zu tragen vermögen. 7 Natürlich verlangt gerade die Gesamtdiagnose ‘Unordentlichkeit’, sich im einzelnen um größtmögliche Klarheit bzw. ‘Ordentlichkeit’ zu bemühen. Die Diagnose darf nicht selbst eine Folge von Ungenauigkeit sein. Im Gegenteil: Nur indem man sich im einzelnen mit äußerster Anstrengung um Präzision und Ordentlichkeit bemüht, kann zutagetreten, an welchen Stellen und aufgrund welcher Vorgänge Ordnung und Übersicht schließlich nicht mehr zu erreichen sind, sondern Unordentlichkeit die letzte Auskunft ist. 8 Theodor W. Adorno, Negative Dialektik, in: ders., Gesammelte Schriften, Bd. 6, Frankfurt a. M. 31984, 43. 9 Vgl. Verf., “Du vertige de la philosophie”, in: Jacques Poulain u. Wolfgang Schirmacher (Hrsg.), Penser après Heidegger. Actes du Colloque du Centenaire (Paris, 25-27 septembre 1989), Paris 1992, 1326. 10 Die Vernunft hat es Kant zufolge nicht mit Gegenständen, sondern mit Formen der Rationalität zu tun: “Die Vernunft bezieht sich niemals geradezu auf einen Gegenstand, sondern lediglich auf den Verstand [...]”. (Immanuel Kant, Kritik der reinen Vernunft, A 643) 11 Karl Jaspers, Von der Wahrheit, München 1947, Neuausgabe 1958, 116. 12 Immanuel Kant, Kritik der reinen Vernunft, A VII. 13 Immanuel Kant, “Was heißt: sich im Denken orientieren?”, A 310. 14 Für eine detaillierte Analyse der Argumentationen Kants verweise ich auf das VI. Kapitel des II. Teils meines Buches Vernunft, a.a.O. 15 Nicht, daß in jedem Punkt ein Konflikt bestehen müßte; natürlich gibt es auch Gemeinsamkeiten; aber in grundlegenden Punkten herrschen Dissense, sonst würde es sich nicht um unterschiedliche Paradigmen, sondern nur um unterschiedliche Versionen des gleichen Paradigmas handeln. 16 Nur im Sinn einer Übereinstimmung mit der Wirklichkeit sind sie nicht wahr zu nennen - aber dieser korrespondenztheoretische Wahrheitsbegriff ist auf dem Reflexionsniveau der Moderne ohnehin generell unhaltbar geworden. Man kann von Wirklichkeit gar nicht anders denn als Wirklichkeit-unter-einer-Beschreibung sprechen. Also handelt es sich bei der vermuteten Korrespondenz nie um eine mit ‘der Wirklichkeit’, sondern allenfalls um Übereinstimmung mit einer so oder anders gedeuteten Wirklichkeit. 17 Gewiß bedeutet eine solche Anerkennung noch nicht Übernahme oder Gefolgschaft. Diese Akte liegen auf einer anderen Ebene - nicht auf der der Vernunft, welche die Anerkennungsfähigkeit prüft, sondern auf der der Rationalitäten, für die Übernahme und Gefolgschaft ausschlaggebend sind. Anerkennung bewegt sich auf einer reflexiven, Übernahme auf der pragmatischen Ebene. Wenn die
346 Vernunft Anerkennung gebietet, heißt das nicht, daß sie riete, dieses oder jenes Paradigma zu übernehmen. 18 Das erinnert von fern an den Gedanken antiker, insbesondere bei Platon und Aristoteles faßbarer Konzepte, denen zufolge Gerechtigkeit die höchste Tugend ist. In ihr gelangen auch die anderen Tugenden erst zu ihrer vollen Entfaltung. 19 “Übergang” war auch für Hegel eine zentrale Kategorie. Bekanntlich kam für ihn alles darauf an, “den Gedanken dieses Übergangs zu haben und zu kennen” (vgl. Georg Wilhelm Friedrich Hegel, Vorlesungen über die Philosophie der Geschichte, in: ders., Werke in 20 Bänden, Frankfurt a.M. 1986, Bd. 12, 104). Aber bei Hegel hatten die Übergänge systematisierende und totalisierende Funktion. Sie waren von vornherein teleologisch angesetzt, bedeuteten die “Aufhebung” des Vorausgegangenen und ergaben insgesamt den Gang des Geistes. Sie fügten sich zu einer Reihe, die den vollständigen Aufbau des Systems ergab, weil in ihnen immer schon die Kraft der Totalität wirksam war. - Unter heutigen Bedingungen hingegen führen die Übergänge der Vernunft ebenso wie zu Verbindungen auch zu Trennungen. 20 Ludwig Wittgenstein, “Über Gewißheit”, in: ders., Werkausgabe, Frankfurt a.M. 1984, Bd. 8, 113257, hier 187 [343]. 21 Beweis ist nicht der einzige und nicht der elementarste Modus von Begründung - darauf hat schon Aristoteles hingewiesen. 22 Ausführlicher habe ich dies dargestellt in: “Subjektsein heute. Zum Zusammenhang von Subjektivität, Pluralität und Transversalität”, in: Vernunftnähe, Vernunftferne - La raison, proche et lointaine, Studia Philosophica 51, 1992, 153-182. 23 Ähnlich sagt Herbert Schnädelbach: “Was bleibt, ist Vernunft als ein menschliches Vermögen des Vernünftigseins; also sollte man besser von Vernünftigkeit sprechen als von Vernunft [...]” (Herbert Schnädelbach, “Philosophie als Theorie der Rationalität”, in: ders., Zur Rehabilitierung des animal rationale. Vorträge und Abhandlungen 2, Frankfurt a.M. 1992, 41-60, hier 47 f.). 24 Hegel, Phänomenologie des Geistes, a.a.O., 64 f.
Reviews
347
REVIEWS
Axel Wüstehube (Hrsg.), Pragmatische Rationalitätstheorien. Studies in Pragmatism, Idealism and Philosophy of Mind, Königshausen & Neumann, Würzburg 1995, 314 Seiten Andreas Vieth Der Band Pragmatische Rationalitätstheorien umfaßt eine Reihe von Beiträgen mit ganz unterschiedlichen Zielsetzungen und methodischen Vorgehensweisen und ermöglicht dadurch einen Einblick in die weitverzweigte Diskussion zum Thema Rationalität. Ein in der Rationalitätsdebatte durchgängiges Charakteristikum beschreibt Wüstehube in seiner Einleitung mit dem Verweis auf Max Weber: “Rationale Lebensführung ist nun nicht mehr durch die (religiöse, moralische, staatsrechtliche ...) Hingabe an oberste Vernunftwerte charakterisiert, sondern gerade durch deren formale Durchgestaltung und funktionale Indienstnahme” (Wüstehube 9). Die damit beschriebene Funktionalisierung der Vernunft verbindet sie durch ihre “Indienstnahme” mit der “Lebensführung” — der Praxis. Wie plural oder wie “pragmatisch” sind nun Modelle von Lebensgestaltung und wie stark ist das rationale Band zwischen ihnen? Der vorliegende Band versucht, die Diskussion durch die Kombination der Rationalitätsdebatten mit dem ebenfalls in Philosophie und Sozialwissenschaften bedeutsamen Begriff des Pragmatismus zu “fokussieren”. So einheitlich daher das generelle derzeitige Interesse am Thema Rationalität ist, so wenig ist ein gemeinsamer Nenner erkennbar. Der Grund hierfür dürfte nicht nur oberflächlich darin zu sehen sein, daß Rationalität im Kontext unterschiedlicher Gegenstandsbereiche thematisiert wird: Erkenntnistheorie & Begründungsstrukturen der theoretischen Philosophie (Teil I des Buches: Rationalität und Transzendentalpragmatik), rationale Begründungsstrukturen im
348 Bereich der politischen, moralischen und wissenschaftlichen Praxis (Teil II: Rationalität, “Pragmatischer Idealismus”, Plausible Argumentation) und die Begründung von Rationalität in bestimmten pragmatischen Formen (Teil III: Rationalität in moderner Epistemologie, “Philosophy of Mind” und Sprachphilosophie). Auch daß mit dem Rationalitätsbegriff in allen diesen Anwendungsfeldern auf die notwendigen und möglichen Begründungsstrukturen reflektiert wird, ist nur ein äußerliches Band. Vielmehr weist der bei Max Weber liegende Ursprung des Begriffes auf
eine
tieferliegende
Ursache
für
die
sehr
heterogene
Rationalitätsdebatte hin, daß die Divergenz der Rationalitätsdebatten den Diskussions- und Problemfeldern einer pluralistischen und vielfach untergliederten Gesellschaft korrespondiert. Der einheitliche Fokus des hier besprochenen Buches
kann daher wie folgt formuliert werden: Wie leistungsfähig kann
pragmatische Rationalität sein und was muß sie leisten können? Mit den transzendentalpragmatischen Überlegungen Karl-Otto Apels und Wolfgang Kuhlmanns hebt die Diskussion des Bandes an. Apels Bestreben ist es, die verschiedenen möglichen Formen von Rationalität durch ausweisbare Kriterien voneinander zu unterscheiden, um dadurch alle Rationalitätstypen aufeinander beziehen und untereinander systematisieren zu können. Aufgabe dieses Systems ist die Letztbegründung von Erkenntnis- und Handlungsprinzipien (Apel 29, Kuhlmann 82f), so daß die Einheitlichkeit und Vollständigkeit der möglichen Bereiche rationaler Argumentation gesichert werden können. Dies — so die zentrale These Apels und Kuhlmanns — kann nicht ausschließlich mit den Mitteln der abstrakten Vernunft erreicht werden, deren formal starkes Rationalitätskriterium (d.h. der “Satz vom Widerspruch”) vollkommen inhaltsleer und irreflexiv ist (Apel 29, 31, vgl. Kuhlmann 76f). Sie ziehen daher den performativen Selbstwiderspruch als zweites Rationalitätskriterium hinzu, um sowohl die Inhalte des Reflektierens als auch den Reflexionsprozeß selbst den Überlegungen rationaler Argumentation zugänglich zu machen. Argumentieren als solches verpflichte — so die beiden Autoren — nicht nur auf eine bestimmte Form (sc. logische Richtigkeit), sondern auch auf eine bestimmte Praxis: man darf gewisse Dinge nicht behaupten, wenn man argumentiert (z.B. “Ich behaupte hiermit, daß ich jetzt lüge”, vgl. Apel 38). Der
Reviews
349
Akt des Argumentierens mache als solcher bestimmte Verpflichtungen für den Argumentierenden verbindlich. Indem jemand bestimmte Wahrheitsansprüche erhebe, sei er zu formallogischer Richtigkeit genötigt, und indem er Wahrhaftigkeits-, Richtigkeits-, Existenz- und Sinngeltungsansprüche erhebe, verpflichte er sich auf Geltung, syntaktisch-semantische Richtigkeit, Faktizität und Verständlichkeit der Inhalte. Die Vermeidung des performativen Selbstwiderspruchs verpflichte uns also auf diese inhaltlichen Voraussetzungen. Kuhlmann verdeutlicht mit Bezug auf Wittgenstein diesen Gedanken dadurch, daß er Argumentieren und Sprechen allgemein als Handeln auffaßt, dem ein spezifisches Können zugrundeliege
(Kuhlmann 77, 80-82). Dieses im
“Argumentieren-Können” abgerufene Handlungswissen begleite und vervollständige die theoretische Vernunft, indem es ihre unhintergebaren Grundlagen reflektiere, aber selber nicht hinterfragbar sei. Die Tätigkeit des logischmathematischen Verstandes auf der einen Seite gebe “auf gewisse Fragen der menschlichen Weltorientierung überhaupt keine Antwort” (51) und bedürfe daher auf der anderen Seite der Ergänzung durch diskursive Rationalität. Das Ziel Apels und Kuhlmanns ist es, die “Selbsteinstimmigkeit der Vernunft” durch Letztbegründung zu sichern (Apel 54, Kuhlmann 79f), indem sie ihre reflexiven und pragmatischen Aspekte konzeptionell fruchtbar machen. Problematisch ist der skizzierte Ansatz jedoch in zweierlei Hinsicht: erstens bezüglich seines Ziels: Transzendentalpragmatische Letztbegründung zielt — zumindest als Ideal — auf einen allgemeingültigen überzeitlichen Konsens; zweitens bezüglich der Inhalte: Wenn die transzendentalpragmatische Letztbegründung der Vernunft eine vollständige Theorie rationaler Argumentation darstellt, muß sie alle normativen Konflikte lösen können. Ob allerdings aus den von Apel angeführten abstrakten inhaltlichen Voraussetzungen jedes Argumentationsaktes Kriterien zur Lösung einzelner konkreter Konflikte abgeleitet werden können, bleibt fraglich. Während
der
Pragmatismus
der
transzendentalphilosophischen
Überlegungen darin besteht, die praktische Dimension der Rationalität für sie fruchtbar zu machen, ist Nicholas Rescher in seinem Beitrag pragmatischer. Er wendet sich gegen einen uniformen Konsens, in dem die auf der transzendentalpragmatischen Argumentation beruhende idealtypische Situation des
350 Diskurses handlungsleitend wird, und plädiert für eine grundsätzlich plurale Lebensform (Rescher 113f), deren theoretische Grundlage er im Gespräch mit Axel Wüstehube folgendermaßen schildert: “Die Schwierigkeit ist natürlich, daß wir uns in der wirklichen Welt nicht alle in derselben Situation befinden, daß wir über unterschiedliche Evidenzen, Daten und Informationen verfügen, oder auch, daß wir unterschiedliche Werte, wie etwa ein sinnvolles Leben zu führen sei, angenommen haben” (Rescher/Wüstehube 162). Rescher lehnt also gerade ab, daß das individuelle “Handlungswissen” als Grundlage für einen allgemeinen und universalen Konsens dienen kann. Sein zentraler Begriff ist acquiescence (Rescher 117), mit dem er eine bestimmte individuelle Erwartungshaltung bezeichnet, die nicht darin besteht, Übereinstimmung mit anderen anzustreben, sondern eingeschränkten Dissens gelten zu lassen (ib.). Doch — so muß sich Rescher fragen lassen — Dissens bezüglich welcher Ziele und wie weitgehend eingeschränkt? Die Vielfalt möglicher Handlungsorientierungen wird für ihn theoretisch dominant, wenn er von den Individuen eine Haltung der Bereitschaft fordert, gegebenenfalls auch ohne Übereinstimmung mit anderen auszukommen: “we avoid letting our differences become a casus belli between us” (Rescher 116). Problematisch ist Reschers Vergleich von acquiescence und Toleranz (Rescher 117), da eine tolerante Haltung in gewissem Sinne andere Ziele als solche gerade nicht gelten läßt, vielmehr Gründe zu haben meint, diese Ziele nicht zu verfolgen. Acquiescence billigt divergierenden Interessen Gleichberechtigung zu. Toleranz in dem genannten Sinne fügt (acquiesce) sich nicht gegenüber anderem, sondern enthält sich lediglich aus wiederum guten Gründen sanktionierender Maßnahmen. Sie ist also eine passive Haltung; und es ist fraglich, ob eine funktionierende Gesellschaft ausschließlich auf dem Prinzip des “leben und leben lassen” begründet werden kann. Doch wird man Rescher nur gerecht, wenn man seine Ausführungen vornehmlich als Opposition gegen einen idealisierten Konsens betrachtet, der auf überindividuellen und einheitlichen rationalen Begründungsstrukturen beruht. Die Ausführungen Axel Wüstehubes ergänzen den Ansatz Reschers durch Überlegungen zum Zusammenhang von “Rationalität und Moralität bei Nicholas Rescher” (Wüstehube 113), indem sie seine positiven Leistungen für
Reviews
351
die Rechtfertigung moralischen Handelns herausstellen und konzeptionell erweitern. Der hier besprochene Band schließt im dritten Teil mit drei Beiträgen zu ganz unterschiedlichen Rationalitätskontexten. Als Fazit kann im voraus festgestellt werden, daß Rationalität nicht als isoliertes Phänomen betrachtet und untersucht wird, sondern daß die Autoren pragmatisch verfahren. Sie erörtern Grenzbereiche und Verbindungen von Rationalität mit anderen philosophischen Problemen und gewinnen dadurch wichtige Erkenntnisse über sie selbst. Thomas Spitzley kompiliert und systematisiert aus verstreuten Veröffentlichungen Donald Davidsons dessen Konzept von Rationalität. Sie wird im wesentlichen verstanden als ein Habitus, die Konsistenz seiner propositionalen Einstellungen herzustellen und zu erhalten. Spitzley prägt hierfür den Begriff der habituellen Rationalität, die ihrerseits Grundlage für die Zuschreibung bestimmter propositionaler Einstellungen ist. Eine für den Kontext des Buches interessante These ist, daß einzelne propositionale Einstellungen — und zwar sowohl rationale wie auch irrationale — nur vor dem Hintergrund anderer propositionaler Einstellungen zugeschrieben werden können, die eine grundsätzlich konsistente Menge von Überzeugungen einer Person darstellen. Relativ zu dieser Menge können einzelne Propositionen konsistent (d.h. rational) oder inkonsistent (d.h. irrational) sein. Diese Überlegungen werden in dem Beitrag von Michael Quante auf den Bereich der mentalen Eigenschaften überhaupt erweitert. In Auseinandersetzung mit der Philosphie Daniel C. Dennetts untersucht er die Theorie der Intentionalen Einstellung. Intentionale Einstellungen als Kern unserer alltäglichen Zuschreibungen von mentalen Zuständen beinhaltet Rationalitätsunterstellungen, durch die wir Verhaltensregeln aufstellen können, anhand derer wir Prognosen über Verhalten anstellen. Quante erörtert in seinem Beitrag u.a. den Charakter und die Rolle dieser Rationalitätsunterstellungen (ideale vs. minimale Rationalitätsunterstellung). Joachim Leilich beschließt den Band mit Erörterungen zu Wittgensteins Thesen über den Zusammenhang von Begriffen, Regeln und sprachlicher Praxis. Das zentrale Problem ist die Begründung unseres Gebrauchs von Begriffen, für
352 die Regeln und regelgeleitetes Verhalten von besonderer Wichtigkeit sind. Die Untersuchung von Sprachregeln und Sprachverhalten ist daher für rationale Begründungen ein wichtiges Arbeitsfeld, insofern Regelbefolgungen und Regelverstöße das begriffliche Netz unseres Verstandes und unsere Verstehbarkeit beeinflussen.
Martina Herrmann, Identität und Moral. Zur Zuständigkeit von Personen für ihre Vergangenheit, Akademie Verlag, Berlin 1995, 193 Seiten Michael Quante Durch Parfits Reasons and Persons (Oxford 1984) ist in der gegenwärtigen sprachanalytischen Philosophie das Problem personaler Identität zu einer nahezu selbständigen Disziplin geworden, die Problemstellungen aus dem Bereich der Philosophie des Geistes, der Logik und Semantik von Identitätsaussagen und auch der Ethik umgreift. Parfit entwickelt eine “schwache” Theorie personaler Identität, derzufolge die Identitätsrelation auf eine Kontinuitätsrelation zwischen Personenstadien reduziert werden muß. Personale Identität ist, so die Verfechter dieser Theorie, kein - wie traditionell und im Common Sense unterstellt - tiefes metaphysisches Faktum, sondern kontingent und fragil. Dies hat, so argumentiert Parfit, Konsequenzen für unser Moralverständnis: Da wir im metaphysisch-ontologischen Sinne nicht sind, was wir zu sein glauben, sind auch die Fundamente unseres Moralverständnisses und unserer moralischen Praxis und deren Institutionen nicht so fest, wie gemeinhin angenommen. Parfit zufolge muß daher aufgrund der Ergebnisse im Bereich der personalen Identität mit einer tiefgreifenden Revision im Bereich der Moral gerechnet werden. Umgekehrt sehen Anhänger einer “starken” Theorie personaler Identität, denen zufolge die Identität der Person in einem metaphysischen Faktum der Identität des Selbst besteht oder zumindest ein nicht weiter analysier- und reduzierbares Faktum darstellt, in den ihrer Meinung nach desaströsen ethischen Konsequenzen einer schwachen Theorie personaler Identität für die Moral gerade ein Argument gegen diesen Reduktionsvorschlag. Was dem einen
Reviews
353
Philosophen ein Befreiungsschlag ist, ist dem anderen ein Irrweg, der die Grundfeste unserer Moral ins Wanken bringt. Vor dem Hintergrund dieser Opposition ist die “konditionale Fragestellung” (15) der Untersuchung Herrmanns, die auf eine Heidelberger Dissertation aus dem Jahre 1992 zurückgeht, zu verstehen. Sie greift die beiden Parteien gemeinsame Überzeugung auf (und an), daß ein direkter Zusammenhang bestehe zwischen einer philosophischen Analyse der diachronen Identität von Personen und den Grundlagen unserer Moral. Herrmann thematisiert die Relation zwischen einer schwachen Theorie personaler Identität und der Moral und grenzt den Sinn der Rede von personaler Identität ein auf die “Identitätsbedingungen von Personen über Zeiträume hinweg” (15). Die leitende Fragestellung lautet daher: “Wenn man eine bestimmte Analyse der Identität der Person trotz Veränderung akzeptiert, werden damit auch Voraussetzungen unserer moralischen Überzeugungen betroffen?” (15) Ein zentrales Motiv für das von Herrmann gewählte Vorgehen ist ihre Skepsis hinsichtlich der Leistungsfähigkeit philosophischer Modelle personaler Identät, welche sich in der Vermutung zusammenfassen läßt, daß “eine wirklich befriedigende Lösung des Identitätsproblems nicht gefunden werden kann” (12). Entschieden für die Gefährdung unserer moralischen Überzeugungen durch schwache reduktionistische Theorien personaler Identität argumentieren die Verfechter der Unanalysierbarkeitsthese. Ihnen zufolge geht bei den Reduktionsvorschlägen etwas verloren, so daß der reduzierte Begriff nicht dem von uns tatsächlich verwendeten Begriff entspricht. Dieser Verlust führe aber zu entscheidenden Konsequenzen, da unser Moralverständnis einen Begriff personaler Identität voraussetze, der gerade nicht auf Kontinuität reduzierbar sei (vgl. 42). Zurechnendes Verhalten wie Lob, Tadel, Strafe oder Auszeichnungen, Verpflichtungen und Kompensation von Schaden sind die drei Bereiche der Moral, die Herrmann untersucht, weil diese von der Unterstellung personaler Identität abhängen. Sie werden von ihr unter der Perspektive diskutiert, ob sie auch unter Voraussetzung einer schwachen Theorie personaler Identität weiterbestehen können, oder ob sie, wie Vertreter der Unanalysierbarkeitsthese behaupten, unter solchen Bedingungen kollabieren müssen. In
354 der Alltagsmoral wird zwar die Bedingung der Identität derjenigen Person, die Gegenstand moralischer Bewertung ist, “in den allermeisten Fällen höchstens gerade am Rande mitüberprüft” (45). Daraus folgt aber nicht, daß diese Bedingung nicht notwendig ist, sie wird nur in der Regel als trivialerweise erfüllt vorausgesetzt. Für die Belange der Alltagsmoral muß die Identitätsbedingung eindeutig und einfach sein: Fragen nach der diachronen Identität müssen sich mit einem klaren Ja oder Nein beantworten lassen und die Identitätsrelation selbst nicht graduell vorliegen, sondern ganz oder gar nicht. Folgt aber, so Herrmanns Frage, aus dieser Anforderung an die Identitätsrelation “für moralische Belange” (45) zwingend, daß sie unanalysierbar sein muß? Auf den ersten Blick könnte man entgegnen, daß auch eine psycho-physische Kontinuitätsrelation eindeutig und einfach ist. Bei näherem Hinsehen zeigt sich aber, daß im Rahmen der Kontinuitätsrelation Veränderungen der Persönlichkeit bei Bewahrung der Identität auftreten können, die unsere moralischen Urteile beeinflussen. Daher kommt Herrmann zu dem Schluß, daß “die Komplexität der Kontinuität ... prima facie nicht mit unserer Alltagsmoral in Einklang zu bringen” (47) ist. Anhänger der Revisionismusthese bringen damit die alltägliche Moral unter einen “Rechtfertigungsdruck” (52), auf den es verschiedene Reaktionsmöglichkeiten gibt, die Herrmann in den folgenden Teilen ihrer Untersuchung darstellt. Im zweiten Teil ihrer Arbeit untersucht Herrmann anhand des Phänomens der moralischen Zurechnung, in dem offenkundig die Annahme personaler Identität wirksam ist, ob sich diese moralische Praxis bzw. Teile derselben unter Voraussetzung einer reduktionistischen Analyse personaler Identität noch zureichend begründen lassen. Hauptargument der Kritiker ist, daß es unter Voraussetzung einer Kontinuitätstheorie eine Frage der Konvention wird, ab wann zwischen Personenstadien keine hinreichenden Beziehungen für die Zurechnung von Handlungen mehr bestehen. Es sei daher aufgrund der strikten Nichtidentität der Personenstadien untereinander nicht zu sehen, wer das Subjekt der Zurechnung sein könne. Gegen dieses Argument betont Herrmann mit Recht (vgl. II.2), daß Konventionen weder beliebig noch willkürlich sein müssen, sondern selbst durchaus einer rationalen Begründung fähig sind.
Reviews
355
Auch wenn sich damit ein genereller Zusammenbruch der Praxis moralischer Zurechnung nicht plausibel machen läßt, bleibt der Einwand, daß bestimmte Bereiche dieser Praxis nicht mehr zureichend begründbar sind (vgl. II.3). Diese auf Parfit zurückgehende These wird von Herrmann dahingehend präzisiert, daß nicht das rein quantitative Abnehmen der Kontinuität zurechnungsmindernd ist, sondern die Minderung der “im zu beurteilenden Fall für moralisch relevant” (80) gehaltenen Eigenschaften. Im weiteren Verlauf (II.4) ihrer Darstellung belegt Herrmann die These, daß nicht alle für die Rechtfertigung zurechnender Reaktionen herangezogenen moralischen Prinzipien und Überzeugungen personale Identität voraussetzen (vgl. 82). Versteht man diese zurechnenden Reaktionen als symbolische Handlungen, um einer “Bewertung Ausdruck zu verleihen” (84), oder achtet man darauf, daß sie die Funktion sozialer Regulation übernehmen, dann hat man zwei Begründungsebenen zurechnender Reaktionen gefunden, die von Unterstellungen hinsichtlich personaler Identität unabhängig sind, weil der Adressat der Zurechnung gar nicht in den Blick kommt. Anders liegt der Fall bei “Strafe und Verdienen” (88) also bei retributiven Rechtfertigungen. Hier formuliert Herrmann als Adäquatheitsbedingung, daß “Unschuldige nicht Adressaten zurechnender Reaktionen sein” (91) dürfen, damit eine Zurechnung als retributiv gelten kann. Diese Forderung, die als “die eigentliche Crux” (93) im Kontext der vorliegenden Fragestellung eingeschätzt wird, bleibt eingebettet in weitere Adäquatheitsbedingungen (vgl. 91), die ohne eine starke Theorie personaler Identität aufrechterhalten werden können, wie Herrmann im folgenden zeigt (II.5). Trotzdem bleibt als negative Konsequenz, daß weder das Sühne- noch das Genugtuungsprinzip unter Annahme einer reduktionistischen Konzeption personaler Identität zureichend begründet sind (vgl. 108). Herrmann schlägt zur Rechtfertigung der Beibehaltung beider Prinzipien folgendes Argument vor. Da es generell eine Notwendigkeit gibt, “Verhalten gesellschaftlich zu ordnen” (110), läßt sich über die Dimension sozialer Konventionalität eine Rechtfertigung finden. Personale Identität ist keine metaphysische Basis für Retribution, sondern eine durch das Interesse der Gesellschaft an “Berechenbarkeit und Gleichartigkeit von Verhalten” (110) geforderte Lebensform, die in libertären Gesellschaften zusätzlich mit den
356 Werten “Autonomie und Selbstbestimmung” (110) verknüpft wird. Sich als eine Person durch die Kontinuität von Personenstadien hindurch zu begreifen, ist damit eine sozial und moralisch erwünschte Weise der Selbstbeschreibung und Lebensführung. Mit diesem argumentativen Schachzug leitet Herrmann auf den dritten Teil ihrer Untersuchung über, in dem “Identität als normative Forderung” (112) diskutiert wird. An die Stelle eines metaphysisch-ontologischen Fundamentes tritt nun die soziale und moralische ‘Schablone’ eines bestimmten Lebensideals, d.h. ein sozialpsychologischer und praktischer Identitätsbegriff. Beweisziel dieses abschließenden dritten Teils der Untersuchung ist es zu zeigen, “daß bestimmte moralische Überzeugungen eine gute alternative Begründung dafür abgeben, auch eine Abfolge bloß kontinuierlich zusammenhängender Personenstadien in moralischer Hinsicht so zu behandeln wie Personen, die die Kriterien einer starken Theorie personaler Identität erfüllen” (112). Diese moralischen Prinzipien sind “faire Kooperation und Selbstbestimmung” (113). Anhand der Frage, ob Personenstadien zur Einhaltung von Verträgen und Versprechen gebracht werden können, die von ihren ‘Vorgängerstadien’ eingegangen worden sind, zeigt Herrmann (III.1), daß “eine moralische Institution, die festlegt, daß einmal durch Verträge und Versprechen eingegangene
Verpflichtungen
spätere
Personenstadien
ohne
weitere
Qualifikation binden, rechtfertigbar ist” (117). Dies gilt zumindest dann, “wenn und solange Selbstbestimmung und faire Kooperation handlungsleitende Werte sind” (117). Die Institutionen Vertrag und Versprechen sind für kooperationswillige Personenstadien von Nutzen, so daß eine Übernahme von Verpflichtungen vergangener Personenstadien als Bedingung der Aufrechterhaltung dieser Institutionen gut begründbar ist. Herrmann zeigt somit, daß es im Selbstinteresse von an diesen Werten interessierten Personenstadien ist, diese Verpflichtungen zu übernehmen und entwickelt ein vertragstheoretisches Rechtfertigungsmodell, dessen Begründungsprobleme unabhängig von Fragen personaler Identität sind (vgl. 137 f.). In analoger Weise werden die moralischen Institutionen “Entschädigung und Haftung” (143) gerechtfertigt, wobei nicht das Eigeninteresse, sondern “das soziale Interesse an der Stabilität” (154) als Rechtfertigungsgrund dient. Eine Prämisse dieser Argumentation ist dabei, daß
Reviews
357
utilitaristische Begründungen moralischer Institutionen als adäquat anerkannt werden. Im abschließenden Teil ihrer Untersuchung zeigt Herrmann, daß die “Einheit des Lebens als normative Forderung” (154) zu begreifen und zu begründen ist. Es wird gezeigt, “daß in einer Gesellschaft, in der bereits Kooperationsnormen gelten, eine gewisse Grundlage dafür besteht, daß Personenstadien mit ihrer Vergangenheit identifiziert werden und sich identifizieren” (156). Diese Grundlage umfaßt sowohl individualpsychologische wie soziale Aspekte und beruht darauf, “daß es für Personenstadien attraktiv ist, sich in einer Vielzahl moralischer Institutionen so zu organisieren wie Personen” (169). Herrmann versteht moralische “Normen als soziale Mechanismen, die geeignet sind, aus einer Kette psychophysisch miteinander verbundener Personenstadien eine soziale Einheit herzustellen” (176). Der Nutzen, den solche Normen und Institutionen auch für die jeweiligen Personenstadien selbst haben, kann dann als zureichender Rechtfertigungsgrund für Sanktionen, Zurechnung oder Lob und Tadel gelten. Damit ist abschließend gezeigt, daß auch unter Voraussetzung einer schwachen Theorie personaler Identität für die faktisch bestehenden moralischen Institutionen eine befriedigende Rechtfertigung gefunden werden kann, so daß eine revisionistische Theorie personaler Identität bei weitem weniger gravierende moralische Konsequenzen erzwingt, als dies z.B. von Parfit behauptet wird.
358
Wulf Kellerwessel, Referenztheorien in der analytischen Philosophie, frommann-holzboog, (problemata 136), Stuttgart-Bad Cannstatt 1995, 480 Seiten Achim Berndzen Mit seinem Buch hat Wulf Kellerwessel eine umfassende Studie zu einem zentralen Themengebiet der (analytischen) Sprachphilosophie vorgelegt, die sich selbst als kritische Aufarbeitung der Referenzdebatte hinsichtlich ihres Erklärungs- und Begründungsgehaltes versteht und auf der Basis der erarbeiteten Ergebnisse eine eigene Referenztheorie vorschägt. Die Studie besteht aus drei Teilen, deren erster der Entwicklung allgemeiner Kriterien zur Beurteilung von referenztheoretischen Positionen gewidmet ist. Im zweiten Teil werden die referenztheoretischen Positionen von Frege, Russell, Geach, Ryle, Strawson, Searle (in ‘Proper Names’), Wittgenstein, Ziff, Quine, Donnellan, Kripke, Putnam, Austin und Searle (u.a. in ‘Speech Acts’) und Katz anhand des erarbeiteten Analyse- und Bewertungsschemas dargestellt bzw. rekonstruiert und auf ihre formale und sachliche Haltbarkeit hin untersucht. Im dritten Teil wird eine Referenztheorie und deren Begründung entwickelt,
die
Semantik
und
Pragmatik
sprachlicher
Bezugnahme
gleichermaßen zu berücksichtigen beansprucht und so die herausgearbeiteten Defizite der behandelten Referenztheorien korrigieren soll. Ausgangspunkt der im ersten Teil der Studie entwickelten Systematik ist die These, daß die Referenz auf Konkreta, d.h. auf raum-zeitlich individuierbare Einzelgegenstände, den Kern der Referenzproblematik darstellt, während unbestimmte Referenz, Referenz auf Ereignisse und sprachliche Entitäten sowie Referenz in Metaphern als “sekundäre Phänomene” (16f.) erwiesen werden. Unberücksichtigt bleibt wegen der zuvor zu führenden Universaliendebatte die Referenz auf Abstrakta. Kellerwessel unterscheidet grundsätzlich zwischen vier Termarten, die die wesentlichen Mittel der sprachlichen Bezugnahme bilden: Eigennamen, allgemeine Namen (Gattungs-, Art- und Stoffnamen), Kennzeichnungen sowie indexikalische Ausdrücke (Personalpronomen und deiktische
Reviews
359
Terme). Obschon von einer Vollständigkeit beanspruchenden Referenztheorie zu erwarten ist, daß sie adäquate Lösungen für alle vier Termarten anbietet, plädiert Kellerwessel gleichwohl für eine getrennte Behandlung der die Termarten betreffenden Referenzfragen. Sein wesentliches Argument hierfür ist, daß die Referenz jeder einzelnen Termart einen spezifischen Problemhorizont aufspannt, der eine je spezifische Erklärung erfordert und je besonderen Adäquatheitskriterien zu genügen hat. Entsprechend werden in der kritischen Aufarbeitung der Referenzdiskussion die von den jeweils behandelten Autoren vertretenen Positionen zur Referenz von Eigennamen, allgemeinen Namen, Kennzeichnungen und indexikalischen Termen getrennt rekonstruiert und evaluiert, wodurch eine differenzierte Einschätzung der Erklärungskraft der Gesamttheorie möglich wird. Zudem erlaubt die erarbeitete Systematik auch solchen Leserinnen und Lesern, die nicht auf den behandelten Bereich spezialisiert sind, einen Überblick über den Gegenstand der Debatte zu gewinnen. Angesichts der Komplexität und Verzweigtheit der Debatte bleibt so der rote Faden ständig im Blick. Als weiterer entscheidender Punkt für die Haltbarkeit einer Theorie wird angesehen, daß sie plausible Lösungen für die sich im Rahmen der Referenzthematik ergebenden Probleme bei Prädikationen mit leeren Termen, (verneinten) Existenzsätzen, Identitätssätzen und epistemischen Kontexten anbietet. Entsprechend werden auch die sich aus den behandelten Referenztheorien ergebenden Konsequenzen für diese “problematischen Fälle” rekonstruiert und in die Bewertung der Theorie einbezogen. Die den zweiten Teil der Studie bildende Aufarbeitung der referenztheoretischen Diskussion ist in drei Gruppen aufgegliedert, wobei als primäres Kriterium der Klassifikation die referenztheoretische Grundposition fungiert. Entsprechend werden zunächst die klassischen deskriptiven Referenztheorien (Frege, Russell, Geach, Ryle, Strawson, Searle, Wittgenstein und Ziff) diskutiert, woran sich eine ausführliche Auseinandersetzung mit historischen bzw. kausalen Referenztheorien (Donnellan, Kripke, Putnam) sowie den von einem referenztheoretischen Skeptizismus geprägten Überlegungen bei Quine anschließt. Den Abschluß bilden die als “neuere deskriptive Theorien” bezeichneten Ansätze (Austin/Searle sowie Katz). Innerhalb der so
360 konstituierten Gruppen erfolgt die Behandlung nach Autoren, wobei zur Wahrung des Diskussionszusammenhangs, die historische Reihenfolge eingehalten wird. Für jeden Autor wird zunächst eine allgemeine Charakterisierung seiner Theorie entwickelt, woran sich eine Erarbeitung der vertretenen Thesen zur Referenz von Eigennamen, Allgemeinnamen, Kennzeichnungen und indexikalischen Ausdrücken sowie eine Behandlung der “problematischen Fälle” anschließt. Abgeschlossen wird jedes Kapitel durch eine ausführliche und sorgfältige Evaluierung der rekonstruierten Positionen, wobei wiederum zwischen den verschiedenen Termarten und den problematischen Fällen unterschieden wird. Diese Vorgehensweise ermöglicht es dem Autor, die für eine den Anspruch auf inhaltliche Adäquatheit und formale Korrektheit zu recht erhebende Referenztheorie verwendbaren Punkte eindeutig
zu
identifizieren
und
die
Reichweite
von
identifizierten
Erklärungsdefekten in den diskutierten Theorien genau zu bestimmen. Wünschenswert wäre hier allerdings ein analytisches Inhaltsverzeichnis gewesen, das es erlaubt hätte, spezifische Aspekte der Behandlung einzelner Positionen (etwa “Geach über leere Eigennamen”) direkt aufzufinden. Aus der Fülle der im zweiten, beinah vierhundert Seiten einnehmenden Teil der Studie in der Auseinandersetzung mit der Referenzdebatte in der analytischen Philosophie gewonnenen Ergebnisse seien hier nur die wesentlichen genannt: Den für Kellerwessel zentralen Anknüpfungspunkt in der klassischen Debatte im Rahmen des deskriptiv/semantischen Paradigmas bilden die sog. Bündeltheorien, wie sie von Searle (in ‘Proper Names’) und vom mittleren bzw. späten Wittgenstein vertreten wurden, während die Bündeltheorie von Ziff, “deren Widersprüchlichkeit und deren Erklärungsdefizite in erster Linie zu kritisieren sind, [...] weitgehend abzulehnen” (203) sei. Kritisch beurteilt Kellerwessel neben den referenztheoretischen Überlegungen Freges auch
die
Referenztheorie
Russells,
deren
Erklärungsgehalt
nicht
zufriedenstellend und deren Begründung nicht logisch einwandfrei seien. Defizite werden auch in den Theorien von Geach und Ryle aufgewiesen. Demgegenüber
kommt
Kellerwessel
zu
einer
weitgehend
positiven
Einschätzung der Theorie Strawsons, der als “ein Bündeltheoretiker in einem weiteren Sinne des Wortes” (412) zu betrachten sei, wobei sich dessen
Reviews
361
Lokalisierung der Referenzfunktion im Äußerungsvollzug als wesentlich erweist. Ausgehend von den so gesicherten Ergebnissen und Anknüpfungspunkten zur Referenzthematik aus dem semantisch/deskriptiven Paradigma schließt sich eine umfangreiche Auseinandersetzung mit der Kritik an der deskriptiven Zugangsweise an, wie sie von Quine und im Rahmen der kausalen Referenztheorie formuliert wurde. Sowohl gegen Quines Eliminierbarkeitsthese als auch gegen seine These von der “Unerforschlichkeit der Referenz” werden schwerwiegende Bedenken angemeldet. Die Elimination von singulären Termen und damit der Übergang von Referenzfragen zu Fragen hinsichtlich der Extension von Prädikatausdrücken, wie Quine sie vorgeschlagen hat, sei “als Teil der Formalisierung der (nicht für bestimmte Zwecke vereinfachten) normalen Sprache nicht zu akzeptieren” (220), weil dabei die wesentliche Verbindung zwischen Namen und Namensträgern verloren gehe und der Funktionsunterschied zwischen Eigennamen und deiktischen Termen nicht berücksichtigt werde. Die Diskussion der Unerforschlichkeitsthese kommt zu dem Ergebnis, daß diese schwerwiegende Inkonsistenzen aufweise. Insbesondere gelinge es Quine nicht wie beansprucht, den unendlichen Regreß in der Referenzfestlegung zu stoppen, da die ein praktisches Ende des Regresses sicherstellenden Zeigehandlungen gemäß Quines eigenen Überlegungen dies eben nicht leisten könnten und der Rekurs auf das wörtliche Verstehen in der Muttersprache innerhalb dieser Theorie keinen Platz haben könne. Zudem wird in der Unerforschlichkeitsthese ein pragmatischer Widerspruch identifiziert, denn die Formulierung dieser These setze voraus, “daß bestimmte Terme mit gewußten verschiedenen Referenten vorhanden sind. Und demzufolge sind die Referenten nicht unerforschlich.” (224) Ebenso wie Quine haben auch Donnellan, Kripke und Putnam Einwände gegen die Möglichkeit einer Klärung der Referenz im Rahmen einer deskriptiv/semantischen Zugangsweise formuliert und als Konsequenz aus den von ihnen behaupteten Schwierigkeiten des klassischen Ansatzes für eine kausale Referenztheorie plädiert. Entsprechend nimmt neben der Behandlung der von den drei Autoren vorgeschlagenen Referenztheorien gemäß dem oben skizzierten Analyseschema die kritische Diskussion ihrer Einwänden gegen
362 deskriptive Theorien einen breiten Raum ein. Kellerwessel setzt sich dabei detailiert mit der wesentlich auf Beispielfälle gestützten Kritik auseinander, wobei er insgesamt zu dem Ergebnis gelangt, daß die Argumente zum Teil erhebliche Begründungsmängel aufweisen, zum Teil diejenigen deskriptiven Theorien, die zuvor als haltbar erwiesen wurden, nicht zu treffen vermögen. Zudem ließen sich prima facie zutreffende Argumente durch eine Modifikation der deskriptiven Theorieansätze entkräften, so daß die aus der Kritik gefolgerte These von der Notwendigkeit einer kausalen Explikation von Referenz zurückgewiesen werden könne. Allerdings sei, so Kellerwessel, entgegen den ursprünglich im Rahmen der deskriptiven Theorien vertretenen Thesen zuzugestehen, daß “Bestimmungen mittels Kennzeichnungen (zumindest zu einem bestimmten Grade) als fallibel bzw. im Prozeß der Forschung als revidierbar zu betrachten sind.” (263) Die Auseinandersetzung mit den kausalen Theorien der Referenz führt im wesentlichen zu deren Ablehnung, wobei allerdings einzelne Elemente von Kellerwessel aufgegriffen und in den Rahmen eines deskriptiven Ansatzes integriert werden. Zu nennen sind hier neben Donnellans Unterscheidung zwischen
referentiellem
und
attributivem
Kennzeichnungsgebrauch,
insbesondere das von Putnam eingeführte Prinzip der Nachsichtigkeit sowie seine Idee der sprachlichen Arbeitsteilung. Kritisch wendet Kellerwessel gegen die Argumentationen der kausalen Referenztheorien ein, daß diese zahlreiche pragmatische Widersprüche aufweisen. Insbesondere hält er diesen Theorien insofern ein Reflexionsdefizit vor, als “die Vertreter der kausalen bzw. historischen Theorie der Bezugnahme bei der Entwicklung ihrer Theorien Standpunkte ein[nehmen], die menschlicher Erkenntnis nicht offenstehen.” (412) Während entsprechend die Bilanz der Diskussion der kausalen Theorien weitgehend negativ ausfällt, ergeben sich für Kellerwessel im Rahmen der als “Neuere
Deskriptive
Theorien”
bezeichneten
Ansätze
zahlreiche
Anknüpfungspunkte. Inbesondere sei die von Katz vertretene Unterscheidung zwischen “type reference” und “token reference” geeignet, eine deskriptiv orientierte Theorie der Referenz zu formulieren, die den von den kausalen Referenztheoretikern vorgebrachten Argumenten nicht ausgesetzt sei. Sie
Reviews
363
erlaube zudem, “Referenz in der Sprache (“type reference”) und im Sprachgebrauch (“token reference”) anzunehmen.” (403) So ließe sich auch die erfolgreiche Bezugnahme mittels eines falschen Eigennamens sowie die Bezugnahme
durch
unzutreffende
und
sogar
widersprüchliche
Kennzeichnungen klären. Kritisch sieht Kellerwessel hingegen die von Searle seit ‘Sprechakte’ vorgenommene Erläuterung von Referenzfragen durch Sprecherintentionen. Auf der Basis der herausgearbeiteten Anknüpfungspunkte aus der referenztheoretischen Debatte in der analytischen Philosophie unternimmt es Kellerwessel anschließend, eine Referenztheorie zu entwickeln, die die Vorzüge der diskutierten Theorien vereint, ohne ihre Nachteile zu übernehmen, und die zugleich den geforderten Begründungsansprüchen gerecht wird. Ausgangspunkt dafür ist die von Katz übernommene Unterscheidung zwischen pragmatisch erfolgreicher und semantisch korrekter Referenz, wobei wesentlich der Gedanke im Vordergrund steht, daß auch mit die semantischen Regeln verletzenden Termgebräuchen erfolgreich referiert werden kann. Das Bezugnehmen erweise sich “pragmatisch als vierstellige Relation; Relationsglieder sind neben dem Referenten als Objekt der in der Situation gebrauchte Term sowie Sprecher und Hörer.” (413) Pragmatisch erfolgreiches Bezugnehmen wird nicht mit “speaker’s reference” gleichgesetzt, sondern vielmehr an einen kommunikativ erzielten Erfolg geknüpft, d.h. daran, daß es dem Hörer gelingt, den vom Sprecher intendierten Gegenstand anhand des geäußerten Ausdrucks zu identifizieren. Die semantische Referenz wird nach Kellerwessel durch Abstraktion aus der pragmatisch erfolgreichen Referenz gewonnen. Sie gebe an, “auf welches Einzelding bei korrektem, also regelgerechtem Gebrauch des Terms Bezug genommen wird.” (414) Diese Unterscheidung erweist sich, so bemüht sich Kellerwessel zu zeigen, als ein zentraler Schlüssel zur Klärung von Referenzfragen, die insgesamt eine adäquatere Problemlösung ermögliche, als dies in den klassischen semantischen Referenztheorien, die pragmatische Aspekte häufig vernachlässigt hätten, möglich gewesen sei. Kritisch anzumerken ist allerdings, daß man sich angesichts der notorischen Schwierigkeiten der Unterscheidung zwischen Pragmatik und Semantik und bei der Bestimmung des
364 Begriffs
“regelgerechten
Gebrauchs”
weitere
Ausführungen
zu
der
vorgeschlagenen Unterscheidung gewünscht hätte. Zur Klärung der Referenz von Eigennamen schlägt Kellerwessel eine Bündeltheorie vor, die sich allerdings dadurch von den klassischen Ansätzen unterscheidet, daß die im Bündel enthaltenen Kennzeichnungen als gewichtet betrachtet werden, wobei auch Änderungen innerhalb des Bündels im Laufe des Erkenntnisfortschritts nicht ausgeschlossen seien. Die Referenten von Allgemeinnamen würden durch semantische Bestimmungen in Form von hierarchischen Zuordnungen und durch weitergehende Hypothesen bestimmt, wobei pragmatisch erfolgreiches Bezugnehmen auch mit leeren Allgemeinnamen möglich sei. Darüberhinaus kommt der Autor zu dem Ergebnis, daß die Referenz von indexikalischen Termen wie “ich” und “dies” keine Abweichung zwischen semantischer und pragmatischer Referenz zulasse, weil für diese Terme überhaupt kein semantischer Referent festgelegt werden könne. Auch für die “problematischen Fälle” glaubt Kellerwessel auf der Grundlage seiner Überlegungen zur Referenztheorie haltbare Lösungen vorlegen zu können. Abschließend wird dieser Ansatz im Anschluß an Strawson und Apel in den Rahmen einer transzendentalen Sprachpragmatik eingeordnet, woraus sich weitere Argumente gegen einen Referenzskeptizismus (Quine, Rorty) und die modelltheoretische Umdeutung des Referenzschemas (Putnam) ergeben. Zusammenfassend ist festzuhalten, daß Kellerwessels Buch als wesentlicher Beitrag zur referenztheoretischen Debatte anzusehen ist. Hervorzuheben ist dabei neben dem inhaltlichen Umfang der Studie, die sich auf alle (wesentlichen) Referenztheorien in der analytischen Philosophie stützt, insbesondere die problem- und begründungsorientierte Methodik, mit der der Autor die zu klärenden Fragen behandelt, sowie die als Konsequenz aus der Diskussion entwickelte, pragmatische und semantische Aspekte umfassende Referenztheorie. Versteht man unter analytischer Philosophie insbesondere eine Methode des Philosophierens, die den Prinzipien der methodischen Transparenz, der argumentativen Klarheit und Strenge sowie der sachlichen Angemessenheit verpflichtet ist, so kann Kellerwessels Buch nur als analytische Philosophie in ihrer besten Form bezeichnet werden.
Reviews
365
John McDowell, Mind and World, Harvard University Press, Cambridge Mass. 1994, 191 Seiten Wolf-Jürgen Cramm Hilary Putnam hat sich in der jüngsten Version seiner nimmermüden Verteidigung des ‘Realismus’ (“The Dewey Lectures”, 1994, in: Journal of Philosophy, Vol. XCI, No. 9) unter anderem auf Überlegungen in John McDowells’ Mind and World, einer Ausarbeitung seiner Oxforder John Locke Lectures von 1991, berufen; - zu Recht: Denn zwischen beiden Philosophen bestehen offenkundige Übereinstimmungen, vor allem hinsichtlich des Bestrebens, die vorgeschlagene Überwindung der Dichotomie von Fakten und Werten (oder Normen), bzw., von Welt und Geist als eine Form von philosophisch unprätentiösem Realismus zu deuten. Den Versuchen, die Kluft zwischen diesen vermeintlich gegensätzlichen Bereichen zu überwinden, wird der Vorschlag entgegengehalten, jenes Gefühl der Gegensätzlichkeit abzubauen, welches
die
Möglichkeit
einer
solchen,
vermeintlich
notwendigen,
Überwindung erst als philosophisches Mysterium erscheinen lassen kann. Diese Diagnose trifft sicherlich insofern zu, als sich die Geschichte der Philosophie der Neuzeit in weiten Bereichen im Sinne unterschiedlicher Versuche verstehen läßt, eine diagnostizierte Spannung zwischen Geist und Welt, zwischen dem Bereich von Normen und Werten, Regeln und Bedeutungen und dem Bereich der ‘entzauberten’ Natur, bzw. dem gesetzmäßig sich Ereignenden und Faktischen, nach der einen oder anderen Richtung hin aufzulösen. Es wird noch zu fragen sein, ob McDowell selbst der Versuchung wirklich wiederstehen kann, sich letztlich doch auf eine der beiden Seiten zu schlagen, und damit die eigentliche Frage wiederum zu unterlaufen. Auf jeden Fall vermeidet er aber sowohl ein reifizierendes Verständnis von Geist als psychischer Zustände von Individuen, wie es meist auf Seiten naturalistisch gesinnter Philosophen vorausgesetzt wird, als auch die Analogisierung des Verhältnisses von Geist und Welt mit einem Unterschied zwischen subjektiven und objektiven Bereichen
366 der Wirklichkeit, welche deren Kritiker oft zu unterstellen scheinen (wie z. B. Nagel, McGinn oder Searle). McDowell sieht die Voraussetzungen für einen Abbau der genannten Kluft durch die Sellarsche Kritik am ‘Mythos des Gegebenen’ (in: “Empiricism and the Philosophy of Mind”) einerseits und eine durch Aristoteles und Hegel inspirierte Erweiterung des Naturbegriffs andererseits gegeben. Man wird unweigerlich an Rortys Kritik an der Möglichkeit einer apriorischen Rekonstruktion ‘epistemischer tertia’ als dem Paradigma aussichtsloser, philosophischer Versuche einer Vermittlung zwischen Geist und Natur (als eines ‘Spiegels der Natur’) erinnert. Doch Rorty übernimmt, wie wir noch sehen werden, für McDowell eher die Rolle des Schurken. Eigentlich gilt für alle zentralen Figuren, mit denen McDowell sich mehr oder minder ausführlich auseinandersetzt, daß sie in einer Doppelrolle auftreten: als gefeierte Helden bahnbrechender
Einsichten
einerseits,
als
Opfer
ihrer
halbherzigen
Inkonsequenz andererseits. Dies trifft vor allem auf Davidson, Gareth Evans, Sellars und Kant zu. Neben Sellars Kritik am ‘Mythos des Gegebenen’ und ähnlichen Überlegungen bei Davidson bildet vor allem Kant mit seiner berühmten Bemerkung in der Kritik der reinen Vernunft, Begriffe ohne Inhalt seien leer, Anschauungen ohne Begriffe dagegen blind, den Ausgangspunkt für McDowells wesentliche Überlegung, daß der Bereich des Rechtfertigens, der Vernunft Sellars’ ‘logical space of reason’ - nicht weiter reichen kann als die Sphäre des Begrifflichen. Erfahrung, sinnliche Rezeptivität, ist begrifflich strukturiert durch und durch, sonst könnte sie nicht als Grundlage der Rechtfertigung empirischer Überzeugungen dienen. Allerdings sah Kant sich genötigt, einen wie Strawson in The Bounds of Sense gezeigt habe - unnötigen und unhaltbaren Transzendentalismus heraufzubeschwören, der eine ‘Welt-an-sich’, also außerhalb des Bereichs jeder erfahrungsmäßig zugänglichen Wirklichkeit, postulieren muß. Am Beispiel von Davidsons Ansatz in”A Coherence theory of truth and knowledge” will McDowell andererseits die Probleme einer einseitigen Betonung des “internen” Charakters der Rechtfertigungsbeziehungen zwischen empirischen und anderen Überzeugungen verdeutlichen, die die Welt nur in einen kausalen Kontakt mit unseren Überzeugungen bringt. Weil
Reviews
367
Davidson an einer zu kruden Dichotomie vom Bereich des Normativen und dem Bereich des Faktischen, bzw. der Kausalität festhalte, verliere die direkte sinnliche Erfahrung jegliche normative (rechtfertigungsmäßige) Signifikanz. Diese Interpretation Davidsons halte ich für zumindest problematisch, aber es geht mir hier vor allem um die eigentlich Pointe der McDowellschen Argumentation. Wenn ich ihn richtig verstehe, kann die Welt in nichts anderem bestehen, als der Gesamtheit ausdrückbarer Tatsachen, wobei aber Tatsachen bereits in den normativ ‘imprägnierten’ Bereich des Begrifflichen fallen. Der Beitrag der Welt, durch den der aktiven ‘Spontanität’ unserer Überzeugungen Beschränkungen auferlegt sind, besteht aber dann bei McDowell lediglich in dem passiven, doch gleichwohl ‘rationalen’ Charakter unserer (begrifflich strukturierten) ‘Rezeptivität’: “The constraint comes from outside thinking, but not from outside what is thinkable” (S. 28). Den Kantischen Begriff der Spontanität will er als aktive Ausübung einer Kompetenz verstanden wissen, bei der sowohl Bewußtsein als auch die damit einhergehende Fähigkeit kritischer Revisionen oder Anpassungen unseres Überzeugungssystems und seiner Maßstäbe zu den Bedingungen einer umfassenden Kenntnis dessen gehören, was als möglicher Grund für was gelten kann. Eine Einschränkung der Spontanität ist notwendig, um den kontraintuitiven, idealistischen Konsequenzen zu entgehen, bei denen uns die Welt als ein eigenständiges Korrektiv abhanden käme. In einer solchen Gefahr schwebt für McDowell auch Davidsons ‘Kohärentismus’ in “A Coherence Theory of Truth” - von dem sich Davidson mittlerweilen selbst distanziert hat1-, der es deshalb attraktiv erscheinen läßt, doch wieder auf die ein oder andere Variante des ‘Mythos des Gegebenen’ auszuweichen. Eine solche Variante verteidigt nach McDowell auch der jung verstorbene Gareth Evans in dessen von McDowell posthum herausgegebenem Buch Varieties of Reference (Oxford 1982). Auch wenn Evans’ Bemerkungen zu ‘informationsfundierten Gedanken’ nicht im Zentrum seiner Überlegungen stehen - einer Versöhnung der Einsichten, die in ‘Theorien direkter Referenz’ artikuliert werden, mit Freges Sinnbegriff - , bilden sie doch für McDowell ein gutes Beispiel für jene Motive, die ein Festhalten am ‘Mythos des Gegebenen’ unvermeidlich erscheinen lassen. Evans unterscheidet informationelle Zustände
368 von Systemen, im Sinne nicht-begrifflicher Wahrnehmung, von begrifflich strukturierter Erfahrung, die in Form von Urteilen im Bereich der Rechtfertigung eine Rolle spielen kann. Nur so können wir nach Evans der Intuition gerecht werden, daß es auch eine nicht-begriffliche, aber dabei zugleich auch nicht rein kausale Verbindung zur Welt geben muß, wie wir sie vor allem in Bezug auf höhere Tiere und Kleinkinder als gegeben unterstellen. Außerdem scheint uns auch ganz allgemein, z. B. bei Farben, eine graduelle Variationsbreite von Wahrnehmungsmöglichkeiten zugänglich zu sein, für die wir über kein entsprechendes begriffliches Repertoir verfügen. Solche Argumente will McDowell allerdings nicht gelten lassen. Denn auch ein demonstrativer Hinweis auf Farbschattierungen gehöre in den Bereich des Begrifflichen und läßt uns so jede mögliche Farbe erfahrbar machen. Es läßt sich allerdings bezweifeln, ob dieses Argument McDowells wirklich stichhaltig ist. Die Kenntis des Umgangs mit Demonstrativa gehört zu einer umfassenden Kompetenz hinsichtlich der Identifikationsfunktion singulärer Termini in ihrer ganzen Bandbreite. Eine Kompetenz aber, die einen bestimmten Begriff betrifft, also beispielsweise die Kenntnis möglicher Verwendungssituationen für einen prädikativen Ausdruck, setzt ein gewisses Mindestmaß an objektiven Reidentifikationsmöglichkeiten der entsprechenden Eigenschaft (ihrer Instantiierungen) voraus. Es gibt für unsere Begriffsausdrücke jeweils objektive Kriterien, die eine Standardverwendung stabilisieren. Dies scheint mir jedoch im Falle eines einmaligen und nicht weiter spezifizierbaren Hinweises wie “diese Farbschattierung” nur schwer vorstellbar. Wichtiger ist aber McDowells Einwand gegen Evans Unterstellung, Tiere und Menschen könnten auf der Ebene nicht-begrifflicher Wahrnehmung in gleichen
perzeptuellen
Zuständen
sein.
Erst
die
Möglichkeit
rechtfertigungsrelevanter Erfahrung sei eine zusätzliche Eigenschaft sprachbegabter Wesen und ihrer begrifflichen Kompetenz. Nach McDowells Ansicht sollten wir aber nicht sagen, daß wir etwas mit Tieren gemeinsam haben, und dann noch etwas Zusätzliches, dessen Möglichkeit dabei irgendwie mysteriös bleibt. Statt dessen sollten wir unsere Fähigkeit der Spontanität als eine spezielle Form dessen verstehen, was sowohl auf Tiere, als auch auf uns Menschen zutrifft, nämlich die wahrnehmungsmäßige Empfänglichkeit für Eigenschaften
Reviews
369
unserer Umwelt: “Exercises of spontaneity belong to our mode of living. And our mode of living is our way of actualizing ourselfs as animals” (S. 78). “Human live, our natural way of being, is already shaped by meaning” (S. 95). Natur fällt nach diesem Verständnis also nicht mehr einfach mit dem Bereich des Naturgesetzlichen zusammen. Damit kommt der für McDowell zentrale Begriff der ‘Zweiten Natur’ ins Spiel, mit dem er sich nicht nur in die Nähe Aristoteles’, sondern auch der Tradition der deutschen Romantik bringt. Durch einen Bildungsprozeß, der sich vor allem über den Spracherwerb und die damit gewonnene begriffliche Kompetenz vollzieht, werden wir in ein bestehendes System von Werten, Praktiken, Rechtfertigungen und Sichtweisen einsozialisiert. Die angeborene Fähigkeit zur Aneignung einer ‘Zweiten Natur’ gehört demnach, als eine Fähigkeit zur Spontanität, zu unserer Weise, uns als Tiere zu verwirklichen. Nach einem solchen Verständnis müßten wir nicht mehr von einer Bifurkation von Natur und Kultur ausgehen, die uns dann aber Kopfschmerzen bereitet, wenn wir uns fragen, in welchem Verhältnis beide stehen. In diesem Sinne läßt sich wohl die von McDowell und im angelsächsischen Raum ganz allgemein häufig benutzte Rede von moralischen oder ethischen Tatsachen verständlich machen: So wie es keine Tasachen gibt, die nicht mit Werturteilen imprägniert sind, so gibt es auch keine Werte, denen in ihrer sozialen Wirksamkeit und historischen Überlieferung nicht ein faktischer Status zukäme. Wenn ich auch die anti-szientistischen Grundintentionen McDowells teile, so scheint mir doch diese Argumentationsweise (die, wie gesagt, auch in den neueren Arbeiten Putnams vorgebracht wird) in die falsche Richtung zu gehen. Bei dem Versuch, den vermeintlichen Alternativen eines ‘zügellosen Platonismus’ (Frege), eines ‘Anti-Realistischen Behaviorismus’ (Dummett, C. Wright) und eines ‘kühnen Naturalismus oder Psychologismus’ (Quine) zu entgehen, will McDowell scheinbar alles zugleich und dabei einen ‘wittgensteinianischen Realismus’ in Kombination mit einem ‘naturalisierten Platonismus’ vertreten. Dabei wird er aber den Grundintuitionen, die hinter den jeweiligen Etiketten stehen, nicht mehr wirklich gerecht. Dies zeigt sich daran, daß McDowell, trotz gegenteiliger Beteuerungen, nun weder den intrinsischen Charakter einer vom Geist unabhängigen Natur oder Welt, noch
370 die sich nicht im Sinne von Relationen zwischen Ereignissen rekonstruierbaren Beziehungen innerhalb des ‘logischen Raumes der Vernunft’ wirklich verständlich machen kann. McDowell deutet den Unterschied zwischen ‘Zweiter’ und ‘Erster Natur’ letztlich als einen Unterschied zwischen bedeutungsvollen und ‘bloßen’ Ereignissen. Aber damit droht er den eigentlichen Witz der Frage nach dem Verhältnis von Natur und Geist am Ende doch wieder zu unterschlagen. Denn das Problem bestand ja in der Frage nach einem möglichen Verhältnis zwischen - im weitesten Sinne - normativen Beziehungen einerseits und kausalen oder gesetzesartigen Beziehungen andererseits. Redet man aber von bedeutungsvollen Ereignissen, so fallen diese von vorneherein unter letztere Art von Beziehungen, und dann ist es kein Wunder, daß das Gefühl einer Kluft zwischen den beiden Bereichen abhanden kommt; denn dann wurde die eigentliche Frage schlicht übergangen. Der sogenannte ‘Platonismus’ legt größten Wert auf die wirkliche Eigenständigkeit des Bereichs des Normativen und Bedeutungsvollen, aber kann dessen Verhältnis zur sinnlich erfahrbaren Natur nicht verständlich machen. Der Naturalismus will dieses Problem entschlossen angehen, doch dabei zerrinnt ihm die genannte Eigenheit jenes Bereichs unter der Hand. Zwischen den Hörnern dieses Dilemmas hat Wittgenstein versucht, das ‘Mysterium’ zu entkrampfen. Doch wenn, wie bei McDowell, Dichotomien vorschnell aufgelöst
werden
sollen,
verschmieren
Differenzierungsmöglichkeiten,
weswegen Dichotomien oft (und nicht ganz zufällig) jeden erneuten Anlauf zu ihrer ‘Überwindung’ mehr oder weniger unbeschadet überstehen. Ganz allgemein kann die Kritik an vermeintlich ‘überkommenen’ Dichotomien (wie z. B. ‘objektiv/subjektiv’, epistemisch/ontologisch, determiniert/spontan) allerdings den positiven Nebeneffekt haben, daß unwesentliche oder falsche Charakterisierungen einer Gegensätzlichkeit getilgt oder korrigiert werden. Daß McDowell jedoch an der falschen Stelle ansetzt, zeigt sich, wie ich denke, besonders an seiner Kritik an Rortys Davidson-Interpretation - “Afterword, Part I”. Rorty versteht in “Pragmatism, Davidson, and Truth” eine Davidsonianische Wahrheitstheorie als lediglich eine von zwei möglichen Geschichten, die menschliches Verhalten verständlich machen, nämlich als diejenige, die aus der Beobachterperspektive des (behavioristisch orientierten)
Reviews
371
‘Feldlinguisten’ erzählt wird. Wenn wir jedoch unser Bestreben als ‘aufrichtige Sucher nach der Wahrheit’ verständlich machen wollen, kämen wir, nach Rorty, mit einer solchen ‘Zitattilgungstheorie’ der Wahrheit nicht über die Runden.
Dann
interessierten
uns
nämlich
die
nur
aus
einer
Teilnehmerperspektive zugänglichen normativen Aspekte, also z. B. der, die Wahrheit als ein erstrebenswertes Ziel zu erachten. McDowell sieht in einer solchen Analyse jedoch das schädliche Arbeiten alter Dichotomien, die das Verhältnis jener beiden Perspektiven zueinander zu einem unlösbaren Rätsel werden lassen. Wie man auch immer zu Rorty sonstigen Überlegungen stehen mag, eine ‘Rätselaufhebung’ im Stile McDowells scheint mir dem berechtigten Sinn dieser Perspektivendifferenz nicht gerecht zu werden. Denn die Art und Weise, in der McDowell die prinzipielle Unterscheidbarkeit der genannten Perspektiven aufheben will, beläßt eigentlich keine überzeugende Möglichkeit mehr, dem Sinn unseres modernen Verständnisses einer ‘entzauberten Natur’ gerecht zu werden, deren Eigenschaften doch gerade als unabhängig von unseren Werten oder Interessen gegeben unterstellt werden. Etwas ganz anderes, als die Aufhebung dieser Differenz (oder ‘Dichotomie), ist die Feststellung, daß jede Möglichkeit der Beschreibung dieser Eigenschaften faktisch bestehenden Vorurteilen und Interessen unterliegt - vielleicht sogar unterliegen muß. Aber unser, wiederum nur aus einer Teilnehmerperspektive zugängliches, Ziel bei einer jeden Erfassung dessen, was der Fall ist, muß deren weitgehende Distanzierung sein, daß heißt, eine möglichst weitgehende (‘quantifizierbare’) Beschreibung der Welt aus der als Idealisierung in Anspruch genommenen Beobachterperspektive. Damit wird allerdings auch gleichzeitig die Grenze einer möglichen Naturalisierung deutlich: Der Wert dieses Zieles und die methodologischen Bedingungen seiner Erreichung können nicht wiederum selbst naturalistisch eingeholt werden, ohne dabei gleichzeitig in Anspruch genommen zu werden. Diese Selbstreflexivität der Vernunft ist ein wichtiger Aspekt jenes Bereiches des Normativen und der Bedeutung, kurz gesagt, des Geistes, dessen Eigenständigkeit McDowell gegenüber einer szientistisch verkürzenden, an (wie auch immer spezifizierten) Gehirnzuständen von Individuen ansetzenden Naturalisierungsstrategie ansonsten zu Recht betont.
372 Auch eine ‘davidsonianisch gedämpfte’ Variante des Naturalismus versteht unter Rationalität
nicht
den
auch
kritisch-reflexiven
Umgang
mit
Wertorientierungen und Normen, sondern nutzt einen lediglich entscheidungstheoretisch
verstandenen
Rationalitätsbegriff
für
eine
Rekonstruktion der Bedingungen der bestmöglichen theoretischen Systematisierbarkeit der Fakten im Hinblick auf individuelle Geister und ihre ‘bedeutungsvollen Handlungsereignisse’. Doch damit bleibt sie - anders als McDowell es gern hätte - in einer szientistisch-verkürzenden Analyse von Begriffen wie Bedeutung, Wahrheit, Handlung, Verstehen und Rationalität hängen, - bei einem unmöglichen Versuch der Beschreibung des Geistes (im vollen Wortsinne) aus der Beobachterperspektive. Auch deshalb gerät McDowell in gewisse Schwierigkeiten, seine gleichzeitige Sympathie für eine durch Gadamer inspirierte Hermeneutik einerseits und für Davidsons Kritik an der Verständlichkeit des Begriffs des Begriffsschemas andererseits, verständlich zu machen. Nach Davidsons Verständnis von ‘Verstehen’ und ‘Interpretation’ haben diese Begriffe - zumindest im Kontext einer Bedeutungstheorie - nichts mit einer ‘einfühlenden’ (virtuell oder tatsächlich wertend teilnehmenden), rekonstruktiven Erläuterung fremder Handlungspraktiken und der sie leitenden Normen und Werte zu tun. Sonst könnte ein (‘behavioristischer’) Naturalist wie Davidson solche Begriffe nicht mehr im Sinne einer Theoriebildung zu beobachtbaren Fakten hinsichtlich der Verhaltensereignisse oder -Dispositionen ‘rationaler’ Tiere verstehen. Der Bereich des Rationalen und der Bereich des Nicht-Rationalen sind bei Davidson nur durch eine unterschiedliche (inkompatible) Methodologie für ihre theoretische Erfassung getrennt. Der Bereich des Rationalen und der Bedeutung, den McDowell im Auge hat, soll aber, wenn ich richtig sehe, auch durch den Unterschied zwischen ‘Regeln’ der Beschreibung und der bloßen Regelmäßigkeit des Beschriebenen charakterisiert sein. Seine inspirierenden Überlegungen leiden aber darunter, daß ihm der schwerwiegende Unterschied zwischen diesen Unterscheidungsebenen offenbar entgeht: Gezeigt zu haben, daß der Unterschied zwischen normativen und deskriptiven Fragen nicht klar abzugrenzen ist, daß jede Beschreibung ein ‘normatives’ Unternehmen ist, heißt nicht, die Kluft zwischen Geist und
Reviews
373
natürlicher Welt, verkürzt gesagt, zwischen Beschreibung und Beschriebenem, zum Verschwinden gebracht zu haben. 1 vgl. D. Davidson, “Reply to Richard Schanz”, in: R. Stoecker, Reflecting Davison. Donald Davidson Responding to an International Forum of Philosophers, Berlin 1993.
Peter Clark & Bob Hale (eds.), Reading Putnam, Blackwell, Oxford 1994, 302 Seiten Christopher S. Hill (ed.), The Philosophy of Hilary Putnam, Fayetteville, Arkansas 1992 (= Philosophical Topics 20,1), 408 Seiten Michael Quante Es gibt nur wenige Philosophen der Gegenwart, deren Werk eine derartige Themenvielfalt aufweist wie das von Hilary Putnam. Er hat eine Vielzahl diskussionsbestimmender Arbeiten im Bereich der Sprachphilosophie, der Wissenschaftstheorie, der Philosophie des Geistes und der praktischen Philosophie verfaßt, in denen er zentrale philosophische Probleme behandelt und eigene Antworten auf sie entwickelt. Putnam kann als der ‘Erfinder’ zweier gegenwärtig dominanter Konzeptionen des Geistes (Funktionalismus und Externalismus) gelten und er ist - unabhängig von und gleichzeitig mit Kripke der Gründungsvater der kausalen Theorie der Referenz. Seit den 70er Jahren entwickelt er eine umfassende Antwort auf das Problem des Verhältnisses von Denken und Welt, die sowohl die Deutung der Wissenschaften wie den Status moralischer Aussagen umfaßt (einen guten Überblick über Entwicklung und gegenwärtigen Stand des Putnamschen Denkens gibt der Beitrag von M. Willaschek in “Metzlers Philosophen Lexikon”). Die in diesem Kontext von Putnam entwickelte philosophische Position trug den Namen ‘interner’ Realismus, entwickelt sich gegenwärtig zu einer Position des “natural realism” (Hill 356) und wird von ihm als Realismus mit menschlichem Antlitz bezeichnet.
374 Angesichts der Bedeutung und thematischen Breite des Putnamschen Werkes ist es nicht verwunderlich, daß seine Philosophie Gegenstand zahlreicher Untersuchungen und Beiträge ist. “Reading Putnam” und “The Philosophy of Hilary Putnam” sind nicht die einzigen Bände ihrer Art (ein weiterer, hier nicht berücksichtigter Sammelband ist G. Boolos (ed.): Meaning and Method: Essays in Honor of Hilary Putnam. Cambridge UP 1990). Der von Clark & Hale edierte Band “Reading Putnam” geht zurück auf Beiträge, die anläßlich von Putnams Gifford Lectures (mittlerweile publiziert als “Renewing Philosophy”, Cambridge 1992) auf einer Konferenz im November 1990 zur Diskussion gestellt worden sind. Hills Band “The Philosophy of Hilary Putnam” wurde erst im Jahre 1993 publiziert. Die Themenvielfalt von Putnams Arbeiten ist allerdings auch eine der Schwierigkeiten, die solche seiner Philosophie gewidmeten Sammelbände bewältigen müssen. Seine Beiträge zu einzelnen Themen wie der philosophischen Deutung der Quantenphysik, der Wahrscheinlichkeitstheorie oder der Logik und Mathematik sind derart speziell, daß sie für einen Leser mit einer durchschnittlichen philosophischen Allgemeinbildung nur noch schwer nachvollziehbar sind. Und gleiches gilt natürlich auch für die jeweiligen Diskussionsbeiträge, deren Lektüre ebenfalls erhebliche Spezialkenntnisse voraussetzt. Diese Breite des Spektrums hat zur Konsequenz, daß die vorliegenden Diskussionsbände nicht sehr homogen sind und die Gesamtheit der Philosophie Putnams weder in den einzelnen Beiträgen noch in den Bänden als ganzen in den Blick kommen kann. So wird von den Herausgebern des Bandes “Reading Putnam” z.B. zugestanden, daß “perhaps the most conspicious omission ... is any systematic discussion of his [Putnams, M.Q.] work in the philosophy of mind” (C&H 1 f.). Eine weitere Schwierigkeit besteht darin, daß Putnam seine philosophische Position seit den 50er Jahren fortwährend verändert hat und auch - wie seine Entgegnungen zeigen - gegenwärtig modifiziert und weiterentwickelt. Es ist daher weder für die Beiträger noch für den Leser immer leicht zu entscheiden, ob eine These oder eine Konzeption Gegenstand der Diskussion ist, die Putnam aktuell (noch) vertritt oder nur in einem Abschnitt seines philosophischen Werdeganges vertreten und mittlerweile aufgegeben hat. Auch diese
Reviews
375
Schwierigkeit läßt sich anhand einiger seiner Antworten auf die Beiträge in den beiden Sammelbänden deutlich aufweisen. Simon Blackburn z.B. versucht in seinem Beitrag “Enchanting Views” (C&H 12-30) zu zeigen, daß der ‘interne Realismus’ von den Problemen der Semantik und den modell-theoretischen Argumenten, die Putnam gegen den metaphysischen Realismus vorbringt, genauso betroffen ist, um dann anschließend seine eigene Konzeption des ‘Quasi-Realismus’ als überlegene Position darzustellen. Die Antwort Putnams darauf besteht unter anderem darin, zwischen den Thesen seines internen Realismus, die er mittlerweile aufgegeben hat, und denen, die er weiterhin beibehält, zu unterscheiden (C&H 242 ff.), so daß Blackburns Kritik teilweise ins Leere läuft (vgl. auch die Antwort auf Dummett C&H 256 f.). Es bleibt dabei sowohl in den Beiträgen als auch in Putnams Antworten in der Schwebe, ob er weiterhin an einer Form des internen Realismus festhalten will, oder nicht (C&H 288 vs. Hill 356). Der Beitrag von Gary Ebbs zum Thema “Realism and Rational Enquiry” und die Antworten Putnams unter dem Titel “Notes Towards an Intellectual Autobiography” (Hill 347-357) enthalten allerdings Informationen, die diese Schwierigkeit zumindest teilweise zu beheben helfen. Auch in den Antworten auf die Beiträge von John McDowell und David Anderson finden sich weitere Bemerkungen Putnams zu der Genese seiner Philosophie (Hill 358-369). Neben diesen Texten nennt Putnam als weitere Quelle für eine Darstellung der historischen Entwicklung seiner Realismuskonzeption die Dewey Lectures, die mittlerweile unter dem Titel “Sense, nonsense, and the senses: an inquiry into the powers of the human mind” (Journal of Philosophy 91 (1994), S.445-517) erschienen sind. Vor allem die erste Vorlesung kann als Darstellung der Entwicklungsgeschichte von Putnams Realismuskonzeption gelesen werden, die von ihm selbst als “a long journey from realism back to realism” (JoP 494) bezeichnet wird. Ausgehend vom wissenschaftlichen Realismus führte diese Reise über die Zwischenstation des internen Realismus hin zu einer Konzeption des natürlichen Realismus. Die treibende Kraft in Putnams Realismuskonzeption ist “the search for a middle way between reactionary metaphysics and irresponsible relativism” (JoP 447), wobei er von der Hoffnung getragen wird, daß “there is a way to do justice to our sense that knowledge claims are responsible to reality without
376 recoiling into metaphysical fantasy” (JoP 446). Seine frühe Konzeption des wissenschaftlichen Realismus, die Putnam selbst als eine Variante des von ihm attackierten metaphysischen Realismus betrachtet, war angewiesen auf seine funktionalistische Theorie des Geistes, in der mentale Zustände in einer mit einem physikalischen Weltbild vereinbaren Weise erfaßt werden sollten. Im Zuge der Preisgabe dieses reduktiven Ansatzes bezüglich der Seite der Intentionalität in der Geist-Welt-Beziehung gibt Putnam auch die Hoffnung auf die Durchführbarkeit eines metaphysisch-wissenschaftlichen Realismus auf (Hill 356). Das Bild des internen Realism, mit der von Ebbs (in Hill) und im nachhinein auch von Putnam als irreführend eingeschätzten Kennzeichnung, war gedacht als Selbstkorrektur der eigenen (und jeder anderen) Variante eines wissenschaftlichen Realismus. Es enthielt, wie Putnam in seiner Entgegnung auf Blackburn anführt (C&H 242 f.), zum einen die These, daß Wahrheit nicht unabhängig von epistemischen und normativen intentionalen Leistungen sowie des Gebrauchs von Sprache zu analysieren ist, zum anderen die These, daß solche Begriffe wie “object”, “entity”, “property” oder auch “existence” nicht einen konstanten Sinn haben, sondern in verschiedenen Verwendungsbereichen wie z.B. im Alltag oder aber im Rahmen einer physikalischen Theorie unterschiedliche Bedeutung haben. Putnam hält am zweiten Bestandteil, der das Projekt einer Einheitswissenschaft und die Strategien der Reduktion und Naturalisierung als illusorisch erweist, nach wie vor fest. Dies impliziert aber nicht, wie auch Ebbs herausstellt, daß gar keine Form intertheoretischer Identifikation möglich ist (Hill 33 Anm. 50). Die ursprünglich mit dem ersten Punkt verbundene Idee einer verifikationistischen Theorie der Wahrheit hat Putnam mittlerweile aufgegeben und den Bezug auf eine als denkunabhängig vorausgesetzte Realität als notwendigen Bestandteil des Wahrheitsbegriffs herausgestellt, obwohl er daran festhält, daß die Begriffe “rationale Akzeptierbarkeit” und “hinreichend gute epistemische Bedingungen” mit dem Wahrheitsbegriff unauflöslich verwoben sind (vgl. C&H 242). Diese epistemischen Bedingungen sind aber nicht die idealen Bedingungen, wie sie aus verifikationistischen Bedeutungstheorien oder, im Rahmen von Begründungen, aus Theorien idealer Diskurse bekannt sind, sondern bezeichnen die in unserer alltäglichen Praxis unterstellten und zumeist erfüllten Bedingungen von
Reviews
377
Wahrnehmbarkeit, Beobbachtbarkeit etc. Diese Hinwendung zum common sense und zur Pragmatik alltäglicher Erhebung von Wahrheitsansprüchen bzw. den darin enthaltenen Erfüllungsstandards ist ein Element, das die Weiterentwicklung der Philosophie Putnams zum natürlichen Realismus ausmacht. Ein weiterer, auf die Arbeiten McDowells zurückgehender Bestandteil ist die (Wieder-)Entdeckung des natürlichen Realismus in der Erkenntnistheorie, derzufolge es zwischen dem Geist und der Welt keinerlei vermittelnde Zwischeninstanz gibt. Vielmehr muß man Wahrnehmen so analysieren, daß eine Kluft, in die ein Skeptizismus seinen Zweifel treiben kann, gar nicht erst entsteht. Dies impliziert auch, daß man das Verhältnis zwischen den zu erkennenden Dingen und dem erkennenden Subjekt nicht als einen zweigeteilten Prozeß kausaler Beeinflussung und anschließender rationaler Verarbeitung der erhaltenen Daten interpretiert. Vielmehr muß man, wie Putnam auch im Rückgriff auf die Erkenntnistheorie von James herausstellt, davon ausgehen, daß der rational erkennende Geist direkt mit den Dingen und ihren Eigenschaften in Kontakt steht. An dieser Stelle sieht man zum einen, welchen Beitrag Putnams externalistische Konzeption mentaler Zustände hier leistet, obwohl auch ein Externalismus im Sinne Davidsons denkbar ist, in dem das zweistufige Modell (extern kausaler und intern rationaler Anteil im Wahrnehmungsakt) wirksam bleibt. Daher betont Putnam ausdrücklich, daß man zu einer veränderten Auffassung des Mentalen übergehen muß, zu der “idea that the mind is neither a material nor an immaterial organ but a system of capacities” (JoP 453 Anm.18). Dieses von McDowell vorgeschlagene Bild (in Hill) entspricht auf der Seite des Geistes dem Bild, das Putnam als zweiten entscheidenden Punkt bereits in den internen Realismus aufgenommen hatte: Sowenig wie es die eine übergreifende Verwendung der Begriffe Objekt, Entität, Existenz oder Eigenschaft gibt, genauso wenig gibt es die eine Geist-WeltRelation von Intentionalität oder Referenz. Es gibt eine Vielzahl geistiger Vermögen, mittels derer Organismen mit ihrer Umwelt in Kontakt treten. Die Wirkungsweise dieser Vermögen weist möglicherweise so etwas wie Familienähnlichkeit im Sinne Wittgensteins auf, keinesfalls aber läßt sich hier die eine Natur der Intentionalität herausfiltern, deren philosophische Analyse dann die einzig korrekte Antwort auf das Verhältnis von Denken und Welt
378 ermöglichte. Sowohl auf der Seite der Dinge wie auf der Seite des Denkens gibt es eine Vielzahl von unterscheidbaren Bereichen mit jeweils spezifischen Relationen sowie eine Vielzahl von Geist-Welt-Relationen. Unsere alltägliche Praxis des epistemischen Umgangs mit den Dingen des gewöhnlichen Lebens, die weitgehend frei ist von skeptischen Zweifeln, enthält in den in ihr wirksamen Standards bezüglich der Rechtfertigung von Wahrnehmungs- und Erkenntnisansprüchen alles, was man zur Beantwortung der Frage nach dem Realismus benötigt. Das Geheimnis besteht nicht darin, die skeptischen Zweifel zu beseitigen, sondern darin, sie gar nicht erst als sinnvolle Redeweise zuzulassen. Putnams Strategie, so wie sie sich in seinen neueren Arbeiten abzeichnet, besteht darin, im Geiste Wittgensteins und James darauf zu bestehen, daß es nicht die Realität und den Geist gibt, deren Wesen zuerst philosophisch zu bestimmen wäre, um von dieser Bestimmung aus die Relation zwischen beiden zu erhellen. Jeder dieser Versuche, sei es der des naturalisierenden wissenschaftlichen Realismus oder der des idealisierenden Antirealismus, erzeugt als Folgeproblem eine Kluft zwischen Denken und Welt, die im Rahmen der Formulierungsbedingungen dieses Problems nicht mehr zu überwinden ist. Es kommt daher alles darauf an, die immer schon geltenden Unterstellungen hinsichtlich der Denkunabhängigkeit und Erkennbarkeit der Welt im Rahmen unserer alltäglichen Praxis in ihrer Vielfalt zu analysieren und bestehen zu lassen. Putnam fordert deshalb als Antwort auf das skeptische Problem eine “second naiveté” (JoP 458), deren zweite Natur sich der Tatsache verdankt, um die unlösbaren skeptischen Probleme zu wissen, die ein Verlust des alltäglichen Realismus nach sich zieht. Man darf als Leser gespannt sein, ob es Putnam gelingt, eine Erkenntnistheorie und eine Philosophie des Geistes zu entwickeln, die den damit verbundenen Anforderungen gerecht wird.
Reviews
379
Wolfgang J. Mommsen, Bürgerliche Kultur und künstlerische Avantgarde 1870-1918. Kultur und Politik im Kaiserreich, Propyläen, Frankfurt am Main, Berlin 1994, 205 Seiten Peter Hoeres Seit der Debatte um die Kriegszielpolitik des Deutschen Reiches im Ersten Weltkrieg, der sog. Fischer-Kontroverse der sechziger Jahre, ist das Kaiserreich zu einem bevorzugten Forschungsfeld der Historiographie geworden. Mit Studien über das Kaiserreich etablierte Hans-Ulrich Wehler, beeinflußt von Eckart Kehr und Jürgen Habermas, das neue Paradigma einer Historischen Sozialwissenschaft. Das Kaiserreich spielte auch in den Kontinuitätsdebatten um die Vorgeschichte des Nationalsozialismus eine wichtige Rolle und bietet mit der Industriellen Revolution und der Disparität zwischen ökonomischer und politischer Entwicklung einen wichtigen Argumentationsgegenstand für die Frage nach einem Sonderweg Deutschlands in der modernen Geschichte. Der renommierte Düsseldorfer Historiker Wolfgang Justin Mommsen hat nun eine Studie über die kulturelle Modernisierung im Kaiserreich vorgelegt. Mommsens Buch ist ein Auszug aus der “Propyläen Geschichte Deutschlands”, der gegenüber dieser Reihe den Vorzug besitzt, daß er um den wissenschaftlichen Apparat ergänzt wurde. Aber auch im Textteil wird schnell deutlich, wie souverän der Autor den Forschungsstand verarbeitet. Für den Fachfremden sei angemerkt, daß der in Mommsens Arbeit verwendete Begriff “Halbkonstitutionalismus” für das Verfassungssystem des Kaiserreiches das Resultat einer langen Diskussion innerhalb der Geschichtswissenschaft ist, die zwischen den Polen
“Scheinkonstitutionalismus”
und
“konstitutionelle
Monarchie”
oszillierte. Die eigentliche Relevanz der Arbeit liegt für Mommsen darin, daß sich durch die Herausforderung der Avantgarde und schließlich deren Durchbruch die Auflösung eines homogenen Bürgertums vollzog, das bis zum Ersten Weltkrieg Träger der hegemonialen Kultur im Deutschen Reich war. Der Niedergang des bürgerlichen Ethos und die Dekomposition des Bürgertums
380 markiert für Mommsen den Beginn einer Epoche, für die der formale Begriff “Moderne” steht. Mommsen unterscheidet zunächst zwischen dem aristokratischen, bürgerlichen (protestantischen), katholischen und sozialdemokratischen Kulturmillieu, wobei trotz mannigfacher Interventionen von Wilhelm II. das aristokratische Kulturideal mehr und mehr zu einer Fassade degenerierte. Für die eher marginale Stellung des Katholizismus führt Mommsen die Verankerung in einer kleinbürgerlichen Schicht, die klassische Unterrepräsentanz im wissenschaftlichen und kulturellen Sektor sowie den Kulturkampf der siebziger Jahre an, der auch nach seiner Beilegung die Positionen der “Reichsfeinde” katholischer Konfession nachhaltig schwächte. Für die Arbeiterschaft kommt Mommsen zu dem Fazit, daß deren Kultur “[...] weitgehend ein Substrat der hegemonialen bürgerlichen Kultur dargestellt hat, wenn auch mit einer deutlichen Gewichtung zugunsten aufklärererischer und emanzipatorischer Ideale” (S.13). Dies resultierte aus einem weitgehend noch erhaltenen Traditionsbestand der bürgerlichen Arbeiterbildungsvereine, denen die qualifizierte Arbeiterschaft zu einem großen Teil angehört hatte. Aber auch eine Integration in das bürgerliche System gelang trotz mancher Hoffnungen, z.B. auf Gerhard Hauptmann, nicht. Mommsen selbst spricht von einem “kulturellen Subsystem” (S. 13.) der Arbeiterschaft. Wenn man deren Bibliotheken, Zeitungen, Lesezirkel, Vereine auswertet, wird Mommsens Einschätzung dieses Subsystems als Substrat der dominanten Kultur bestätigt. Die Arbeiter lasen bürgerliche Romane, Marx und Engels wurden dagegen kaum rezipiert. Auch die Mentalität der Arbeiter war, zumindest was Familie, Stellung der Geschlechter und Kunstgeschmack betrifft, der des Bürgertums nicht unähnlich. Mommsen erklärt die Vorrangstellung der bürgerlichen Kultur dankenswerterweise mit Hilfe eines historischen Überblicks über die Entwicklung vor der Reichsgründung (1850-1871). Die Identität von liberalen und national-emanzipatorischen Ideen, durch die das Bürgertum geprägt war, zeigte sich besonders auf den Musik- und Dichterfesten, die an die politische Praxis des Vormärzes anknüpften. Die Schillerverehrung dieser Zeit führte zu derartiger Beunruhigung bei der Regierung Manteuffel, daß, wie Mommsen berichtet, die
Reviews
381
deutschen Klassiker aus dem Schulunterricht verbannt wurden. Die Reichsgründung erzeugte trotz manch enttäuschter Erwartung eine nationale Euphorie, die analog zur politischen Lage Staat und bürgerliche Kultur aussöhnte. Mommsen referiert den künstlerischen Triumphalismus, der nach dem Sieg über Frankreich ausbrach, und seinen Höhepunkt in der Ausgestaltung der Berliner Siegesfeier am 16. Juni 1871 fand. Mommsen resümiert über die Anfangsperiode des Kaiserreiches: “Hier, so schien es, war die bürgerlich-liberale Idee der national geprägten Kulturnation eine Symbiose mit dem monarchischen Gedanken und der höfisch-aristokratischen Kultur eingegangen”. (S. 27/28). Freilich brachte das Epizentrum der Macht, Berlin, zu dieser Zeit keine entscheidenden Impulse für das künstlerische Leben. Der Direktor der Königlichen Akademie der Schönen Künste, Anton von Werner, kommt bei Mommsen außerordentlich schlecht weg. Positiver beurteilt Mommsen die Lage in Süddeutschland und im Rheinland, wo getragen vom Wirtschafts- und Bildungsbürgertum kulturelle Zentren entstanden. In der Vorliebe der Künstler für historische Sujets, in der Monumentalmalerei, im Neoklassizismus sieht Mommsen, ähnlich den Anstrengungen in der Jurisprudenz und der Historiographie, das Bedürfnis, das Kaiserreich zu legitimieren und zu idealisieren. Eine Ausnahme in dieser Symbiose bildet die Musik, bzw. dort Wagner, der zum “Symbol einer romantisch-mystischen Gegenkultur zur bürgerlich-rationalen Kultur der Zeit” (S. 41) wurde und die traditionellen Komponisten herausforderte. Die erste Herausforderung an die Gründerkultur hielt auf literarischem Gebiet in Gestalt des Naturalismus Einzug. Hinzu kamen die Symbolisten, hier nennt Mommsen Stefan George, Rainer Maria Rilke und Hugo von Hofmannsthal. Diese sieht Mommsen als Vorbereiter der künstlerischen Avantgarde, wobei man hier ergänzen muß, daß diese Autoren keineswegs als progressiv-emanzipatorisch einzuordnen sind, was bei dem Wort “Avantgarde” mitklingt. Gerade George und Hofmannsthal leisteten eher jener unpolitischen Stimmung Vorschub, die sich dann als sozialkonservativ und national orientiert erwies. In der bildenden Kunst gingen zunächst auf heftigen Widerstand stoßende Veränderungen von den Münchener und Berliner “Secessionisten” aus, die vom französischen Impressionismus beeinflußt waren. Möglich wurde dies
382 durch einen entstehenden Kunstmarkt und industrielles Mäzenatentum, das die Künstler nicht mehr unbedingt auf staatliche Förderung angewiesen sein ließ. Im Gegensatz zu einer eher rückständigen offiziellen Kunstpolitik bewertet Mommsen die preußische Wissenschaftspolitik als durchaus fortschrittlich. Besonders dem Kultuspolitiker Friedrich Althoff schreibt er eine Schlüsselrolle bei der Akademisierung der bürgerlichen Welt zu. Dabei wurde der idealistische Neuhumanismus zunehmend von einem pragmatisch-positivistischen, freilich imperialistisch gefärbten Wissenschaftsverständnis abgelöst. Mit diesem Prozeß ging die schon früh von Max Weber erkannte Rationalisierung und Entzauberung der Lebenswelt einher. “Spekulative Geschichtstheorien und metaphysische Systeme waren nicht mehr gefragt, es sein denn, sie kleideten sich in das Gewand einer Propädeutik der empirischen Wissenschaften. An ihre Stelle war ein vergleichsweise naiver Fortschrittsglaube getreten, der zwar eine säkularisierte Variante des christlichen Heilsdenkens darstellte, sich aber dessen nicht mehr bewußt war.” (S. 83). Die christliche Bindung sollte durch eine “wissenschaftliche Weltanschauung” (S. 92) substituiert werden. Teilweise wurde diese durch einen biologistischen und rassistischen Sozialdarwinismus ausgefüllt, auch ein popularisierter Nietzscheanismus hatte Konjunktur. Weit verbreitet war eine nationale Mystik, die antiwestlichen und antizivilisatorischen Impulsen folgte. Der Siegeszug des Wissenschaftspositivismus forderte Kritik geradezu heraus. Das letzte Vorkriegsjahrzehnt steht für Mommsen folgerichtig unter dem Paradigma einer “ästhetische[n] Revolution der Avantgarde” (S. 109), die mit der sozialen Ausdifferenzierung und Dekompensation des Bürgertums korrelierte. In der Beziehung zwischen der avantgardistischen Kritik und dem Niedergang der bis dahin hegemonialen bürgerlichen Kultur liegt Mommsens eigentliches Forschungsinteresse. Die Bedeutung dieses Phänomens besteht für Mommsen darin, daß mit dem Heraufkommen der Avantgarde in Kunst und Kultur keineswegs die bürgerlichen Ideale fortentwickelt wurden. Vielmehr löste sich eine weitgehend homogene bürgerlichen Welt auf. Ihr Fortschrittsbegriff und ihre Wissenschaftsgläubigkeit wurden ebenso wie ihre Kulturwerte durch einen “rückhaltlosen Indiviualismus” (S.109) ersetzt, der die Bindungskraft des bürgerlichen Ethos schwinden ließ. Die von Dresden nach
Reviews
383
Berlin, das nun doch noch zur Kulturhauptstadt wurde, gewechselte Künstlervereinigung “Die Brücke” und der Münchener “Blaue Reiter” lehnten sich gegen Uniformierung, Rationalisierung und Industrialisierung auf und versuchten von der Wirklichkeit abgelöste, von Mommsen kritisch bewertete Gegenwelten zu erschließen. Die Spannung zwischen Bürgertum und Künstlertum wurde durch den Ausbruch des Ersten Weltkrieges zumindest zeitweilig aufgehoben. Denn nicht nur die akademische Welt begrüßte, ja bejubelte geradezu den Krieg, der als Kampf der deutschen Kultur gegen die westliche Zivilisation gesehen wurde, auch die künstlerische Avantgarde fand sich zu einer “poetischen Mobilmachung” (S. 131) bereit. Ebenso sah die bildende Kunst im Krieg eher eine Chance, den Nihilismus der Zeit zu überwinden und zu einer breit verankerten, neuen Kunst zu gelangen. Erst als die Schrecken des Krieges auch für die einzelnen, teilweise als Freiwillige an die Front gezogenen Künstler greifbar wurden, kam es zur Opposition. Eine tragende Rolle weist Mommsen dabei dem in Zürich entstandenen Dadaismus “als ästhetischer Version des Anarchismus” (S. 152) zu, der großen Einfluß auf expressionistische Künstler und Literaten gewann. Andere Intellektuelle versuchten dagegen gegen Ende des Krieges die Idee einer nationalen Sammlung wiederzubeleben. Die Polarisierung des kulturellen Lebens brach erneut und verstärkt auf. Denn Künstler und Schriftsteller hatten sich auf der einen Seite der politischen Linken zugewandt, andererseits wie Thomas Mann mit seinen “Unpolitischen Betrachtungen” und Oswald Spengler mit dem dann 1919 erschienenen “Untergang des Abendlandes” an einem positiv gefaßten deutschen Sonderweg festgehalten. So gelangt Mommsen zu dem Fazit: “Der Traum von der Wiedergeburt einer gemeinsamen nationalen Kultur im Schmelztiegel des Krieges, der die kulturtragenden Eliten bei Kriegsbeginn einander immerhin ein ganzes Stück des Weges nähergeführt hatte, war ausgeträumt, die Gegensätze unter den kulturellen Eliten waren unversöhnlich unüberbrückbar geworden.” (S. 173). Unter dieser Prämisse sieht Mommsen die Weimarer Republik von vornherein belastet, die Avantgarde, die sich durchgesetzt hatte und in Weimar “zu Hause” (S. 173) fühlte, geriet sofort wieder unter den Druck der traditionellen, aber vor allem der neuen völkischen und organizistischen Strömungen.
384 Betrachtet man diese von Mommsen genannte erneute Polarisierung der kulturell
tonangebenden
Schichten
und
die
damit
spannungsreiche
Ausgangslage für die Weimarer Republik, so wird deutlich, daß die künstlerische
Avantgarde
mit
ihrer
“Sprengung
des
bürgerlichen
Kulturbegriffes” (S. 97) tatsächlich das Ende einer homogenen Bürgertumskultur markierte. Zu diskutieren wäre Mommsen Einordnung des Ersten Weltkrieg als eine nur kurzzeitige Unterbrechung des Siegeszuges des modernen individualistischen Weltverständnisses. Zweifellos sind Modernisierungstendenzen festzustellen, welche die Epochengrenzen der deutschen Geschichte überlappen. Aber war der Erste Weltkrieg nicht auch eine entscheidende Zäsur, die gravierende Folgeerscheinungen für die Nachkriegsepoche heraufbeschwor? Ist das Entwicklungsschema Bürgertum, Avantgarde, Moderne nicht durch die politische Radikalisierung überholt worden? Ein anderer Einwand ergibt sich vor dem Hintergrund des Werkes von Thomas Nipperdey zum deutschen Kaiserreich. Nipperdey läßt die Avantgarde aus dem Bürgertum hervorgehen und sieht somit nicht den Gegensatz zwischen Bürgertum und Avantgarde, den Mommsen herausarbeitet. Hier ist die Forschungsdiskussion sicherlich noch nicht abgeschlossen. Mommsens Studie stellt eine gelungene kritische Verarbeitung des kulturellen Lebens und seiner Wechselwirkung mit der Sozialstruktur, der bürgerlichen Welt und der politischen Entwicklung im Modernisierungsprozeß Deutschlands dar. Dabei bietet Mommsen auch eine fundierte Quellenanalyse, die seine in ihrer Zuspitzung noch zu debattierende These von der Ablösung der bürgerlich-liberalen Kultur durch das andersartige, von Individualismus und Ausdifferenzierung geprägte System der Moderne am Ende des Kaiserreiches stützt.
Reviews
385
Wolfgang Ludwig Schneider, Die Beobachtung von Kommunikation. Zur kommunikativen Konstruktion sozialen Handelns, Westdeutscher Verlag, Opladen 1994, 296 Seiten Hubert Knoblauch Kommunikation ist sicherlich zu dem Leitbegriff verschiedener gegenwärtiger deutschsprachiger soziologischer Theorien geworden. Wer nun auch nur den Titel dieses Buches überfliegt, ahnt schon, welcher dieser Theorien sich Schneider verpflichtet fühlt. Hat doch Niklas Luhmann wiederholt den Anspruch einer Grundlegung der Soziologie durch Handlungstheorien vehement bestritten und an dessen Stelle den Begriff der Kommunikation gesetzt. So erwartete auch der Rezensent von Schneiders Buch zunächst eine exegetische Darlegung und Erläuterung der Luhmannschen Theorie. Tatsächlich
behandelt
Schneider
auch
den
Luhmannschen
Kommunikationsbegriff, doch geschieht dies in aller (durchaus prägnanten) Kürze. Denn zusätzlich bespricht er eine ganze Reihe unterschiedlicher Theorieansätze (in deren Zentrum zweifellos der Luhmannsche steht), um auf dieser Grundlage einen eigenen Begriff der Kommunikation zu entwickeln. Dieser theoretische Versuch verdient deswegen Beachtung, weil er empirische Forschungstraditionen (darunter besonders die Konversationsanalyse) nicht nur mit berücksichtigt, sondern als eigenständige Beiträge zur Theorie betrachtet und empirisch begründet. Doch der Reihe nach: Schneider beginnt zunächst mit einer Darlegung des soziologischen Handlungsbegriffs bei Weber, Parsons, Schütz und Schütz/ Luckmann. Keineswegs
überraschend
versucht
er
herauszustellen,
daß
der
Handlungsbegriff, der doch als Grundlage der soziologischen Begriffsbildung dienen soll, lediglich eine Folge von Zuschreibungsprozessen - also nicht grundlegend, sondern sozusagen epiphänomenal sei. Handlung, so Schneider, ist kein deskriptiver, sondern ein askriptiver Begriff, gewissermaßen ein Artefakt der Kommunikation. Anhand der analytischen Handlungstheorie, die ja in der Soziologie (vielleicht aus gutem, schon in der Schütz/Parsons-Debatte herausgestelltem Grunde) bisher kaum rezipiert wurde, erläutert er die
386 Probleme, die diese Theorie aufwirft, am Beispiel der Handlungszuschreibung im Strafrecht. Hier schon stellt Schneider den Kern seines Arguments heraus: Handlungen entpuppen sich als “Synthesen kommunikativer Selbst- und Fremdzuschreibungen”, die eine minimale dreizügige Interaktionssequenz von Verhalten, Reaktion und Folgeverhalten erforderlich machen. Gerade vor dem Hintergrund der intentionalistischen Searleschen Sprechakttheorie zeigt sich, ex negativo
sozusagen,
die
Bedeutung
dieser
Sequenz
gerade
in
der
Kommunikation (die einer doppelten Kontingenz von Selbstdeutung und Fremddeutung unterworfen ist). Während die Sprechakttheorie sich lediglich auf die Untersuchung sprachlicher Elementarereignisse beschränkt, war es vor allem Mead, der durch seine Untersuchungen der gestischen Kommunikation die Grundstruktur sozialer Kooperation herausgestellt hat, nämlich die Sequenz von Ankündigung und Aufforderung. Eine solche Struktur findet Schneider denn auch bei Luhmann ausgearbeitet, der ja ohnehin davon ausgeht, daß Kommunikation gewissermaßen abgekoppelt von den “psychischen Systemen” vonstatten geht: als “kommunikative Minimaleinheit von Mitteilung und Reaktion” (172). Bekanntlich funktioniert die Kommunikation laut Luhmann rigide abgetrennt vom Bewußtsein. Und genau an dieser Stelle hakt Schneider ein: Wenn mämlich die Trennung von Bewußtsein und Kommunikation intuitiv nicht einleuchtet und wenn der Fortgang der Kommunikation mit der Reproduktion von Intersubjektivität verklammert ist, dann bedarf der Ablauf der Kommunikation einer Rückkopplung ans beteiligte Bewußtsein. Kurz: Die minimale Kommunikationssequenz bedarf einer dritten Sequenzposition, in der bestätigt oder widerrufen wird, ob der Sinn der vollzogenen Akte intersubjektiv geteilt wird. Erst im Vollzug des dritten Schrittes wird für beide Beteiligte deutlich, welche Gesamthandlung vollzogen wurde. Eine empirische Stütze für diese Grundstruktur sucht Schneider nun in der Konversationsanalyse. Die dreigliedrige Sequenz betrachtet er als eine Ausweitung des für Konversationen so grundlegenden Redezugpaares (“adjacency pair”). Belege dafür findet er etwa in der Analyse institutioneller Gespräche, in denen der dritte Zug institutionsspezifische Ausprägungen annehmen kann. Unter der Annahme, die Konversationsanalyse betrachte Kommunikation als einen unabhängig vom individuellen Handlungssinn
Reviews
387
ablaufenden Apparat, wendet sich Schneider sodann einer besonderen “Ordnungsform für die Kommunikation” zu: Am Konflikt nämlich zeige sich, wie Kommunikation trotz divergierender subjektiver Geltungsansprüche funktionieren könne. Wie schon im Falle der grundlegenden Kommunikationssequenz
zielt
er
auch
beim
Konflikt
auf
Elementarformen
(“Konfliktnukleolen” bzw. “Protokonflikte”, 204). Die Untersuchungen solcher Elementarformen sollen belegen, daß die psychische Deckung von Geltungsansprüchen erst nachträglich durch die Kommunikation erzeugt wird. Um diesen Beweis zu führen, erläutert Schneider einige Arbeiten aus der interpretativen Soziolinguistik und der Konversationsanalyse. Daß die dreigliedrige Sequenz dem entspricht, was Habermas das Erheben eines Geltungsanspruchs nennt, will er an den empirischen Untersuchungen aufzeigen. Naturgemäß war der Autor dieser Rezension erfreut, daß dabei eine seiner empirischen Untersuchungen erläutert wird (232-245) - und er hat nicht einmal grundsätzliche Einwände gegen Schneiders Darstellung, die sich hier, wie auch an anderen Stellen des Buches, oftmals sehr eng an die referierten Texte hält. Allein der Umstand, daß Schneider englisch zitierte Transkripte anführt, die aus dem Schwäbischen übersetzt wurden, und glaubt, daraus schlagkräftige Argumente entwickeln zu können, erscheint befremdlich. Und Schneiders eigene empirische Untersuchung zitiert lediglich Ausschnitte aus einer einzigen Fernsehdiskussion, worauf ein etwas kurzatmiges Resümee folgt, das auf zwei Seiten eine Zusammenfassung der Arbeit versucht. Gerade angesichts der eher bruchstückhaften empirischen Exkurse fragt sich der Rezensent, welchen Stellenwert diese - methodisch doch recht eigenartigen empirischen Beispiele einnehmen? Weil meine eigene, von ihm referierte Untersuchung Gespräche aus einem sehr spezifischen Kontext untersucht - und das auch gesondert betont -, stellt sich überdies die Frage, ob Schneider den Allgemeinheitsanspruch seiner Theorie methodologisch überhaupt einlösen kann. Sind diese Sequenzen tatsächlich grundlegend (wenigstens für Konflikte), oder handelt es sich nicht um spezifische Formen bzw. “kommunikative Gattungen”, die lediglich in besonderen Konflikttypen, sozialen Situationen und Milieus auftreten? Denn in einigen von Schneider referierten Arbeiten wird ja zu belegen versucht, daß alltägliche Argumentationen nicht als kontextfreie
388 “Ordnungstypen” betrachtet werden können; und auch der Soziolinguist Gumperz, auf den Schneider sich ausdrücklich beruft, betont immer wieder, daß die “Konventionen” dieser Gesprächstypen nicht “systemimmanent” erzeugt werden, sondern von den sozialen Kontexten abhängig sind. Wie aus solchen kontextspezifischen (Familientischgespräche, Fernsehdiskussionen) kommunikativen Strukturen eine quasi universale Grundstruktur (sei es auch nur für den “Kommunikationstyp” Konflikt) abgeleitet werden kann, ist nicht nur angesichts der schmalen empirischen Basis mehr als fragwürdig und bedürfte mindestens der methodologischen Reflektion. Auch der Versuch, die Konversationsanalyse nutzbar zu machen, gelingt keineswegs vollständig. Denn es gibt zwar zahlreiche Untersuchungen längerer Redezugsequenzen, doch hat die Paarsequenz eine Rolle für die Konversation, die der These Schneiders geradezu widerspricht. Während Schneider nämlich davon ausgeht, daß der die subjektive Intention überschreitende Sinn der Kommunikation (hier wäre die Berücksichtigung von Freges Unterscheidung von Sinn und Bedeutung oder von Grice’s Konzept der kommunikativen Intention sicherlich von Nutzen gewesen) erst durch den dritten Zug deutlich wird, geht die Konversationsanalyse doch (übrigens durchaus im Einverständnis mit Schütz) davon aus, daß dies schon von einfachen Paarseqzenzen geleistet wird. Der Widerspruch entsteht dadurch, daß Schneider ein grundlegendes Konzept der Konversationsanalyse übersieht: die Reflexivität kommunikativer Handlungen, die es u.a. ermöglicht, daß schon der zweite Zug als Deutung des ersten Zuges vom ersten Sprechenden verstanden werden kann. Daß überdies die Deutung der Redezüge durch die - sowohl wissenschaftlichen wie alltäglichen - Interpreten auf den typischen Sinn der einzelnen Äußerung rekurrieren müssen, gehört nicht nur zu den Grundprinzipien des hermeneutischen Vorgehens; es widerspricht auch völlig dem Oberflächeneindruck, die Konversationsanalyse statuiere “methodologisch die Autonomie der Kommunikation”. Grundlegender noch wiegt Schneiders Vorwurf, Handlungstheorien seien verkappte Ontologien bzw. “sekundäre Ontologisierungen” (64). Denn es ist keineswegs richtig, daß etwa Schütz, dem er diesen Vorwurf macht, der Selbstzuschreibung von Handlungen eine “quasi-ontologische Priorität” (52)
Reviews
389
zuschriebe; daß die Handelnden selbst besser wissen, was ihre Handlung war, folgt nicht aus einer ontologischen Annahme, sondern aus der schlichten, aber dennoch immer noch nicht widerlegten methodologischen Überlegung, daß sie eben einen besseren Einblick in das haben, was sie selber tun. Dabei übergeht Schneider auch, daß Schütz die Analyse der Handlung aus der subjektiven Perspektive grundsätzlich von der Beobachtung des Handelns unterschieden und diesem Thema einen großen Teil seiner Analysen des Fremdverstehens, der Intersubjektivität und damit der bei einer solchen “Zuschreibung” vorausgesetzten Prozesse gewidmet hat. Denn auch wenn er behaupten wollte, die Leute könnten nicht darüber verfügen, wie und wann ihnen eine Handlung zugeschrieben wird - woher weiß der Beobachter, daß er eine Handlung beobachtet? Und auch wenn die Entscheidung, wie (im Grunde: die Zuschreibung von) Handlungen von Nicht-Handlungen unterschieden wird, der Empirie überantwortet werden müßte (65), setzt doch diese Empirie eben einen Begriff der Handlung schon wieder voraus. Trotz dieser Kritik muß Schneiders Versuch dennoch gewürdigt werden. Denn er legt die Finger sicherlich in die Wunde, und er deutet an, wie die Kluft zwischen den
verschiedenen
kommunikationssoziologischen
Ansätzen
überwunden werden kann. Daß er zudem noch die Grenzen zwischen theoretischer und empirischer Kommunikationssoziologie zu überwinden versucht, ist zweifellos der zweite Vorzug dieser Arbeit. Und schließlich ist auch die von ihm herausgestellte Kommunikationsstruktur sicherlich ein Erkenntnisgewinn. Ob es sich jedoch um eine elementare Struktur handelt oder nicht vielmehr um einen bloßen Typus, bleibt meines Erachtens eine zu klärende Frage. Ob diese Frage von einer “empirischen Phänomenologie spezifischer kommunikativer Ordnungsformen” (268) beantwortet werden kann, die Schneider am Ende fordert, ist schwer zu sagen, da es bei der bloßen Forderung bleibt; der Rezensent jedoch hat den Eindruck, daß Schneider damit das Feuer noch einmal erfinden würde, mit dem andere bereits schmieden.
390 Bernhard Waldenfels, Antwortregister, Suhrkamp Verlag, Frankfurt am Main 1994, 500 Seiten Toni Tholen Mit seinem Buch Antwortregister legt der Bochumer Phänomenologe Bernhard Waldenfels eine neue Studie zum Thema Responsivität vor. Unter diesem Stichwort lassen sich die Forschungen des Autors seit Mitte der 80er Jahre zusammenfassen. Schon in dem Band In den Netzen der Lebenswelt (1985) ließ sich Waldenfels von der Frage leiten, in welcher Weise die auf den Handelnden zukommenden Ansprüche eine Antwort provozieren. Unter dem Begriff der responsiven Rationalität entfaltete der Autor in einer weiteren Studie den Gedanken, daß sich in einem solchen Rationalitätskonzept eine offene Regelung verkörpere, “da das, was geordnet wird, nicht selber dieser Ordnung entstammt” (Ordnung im Zwielicht, 1987, 47). Und in Der Stachel des Fremden (1990) wird versucht, das Fremde als einen Überanspruch zu beschreiben, auf das wir beim Antworten so eingehen, daß wir das Fremde als solches nicht aufhebend aneignen. An diese Themenkomplexe knüpft Antwortregister an. Das Buch umkreist dabei in drei Teilen die zentrale Frage nach dem Worauf des Antwortens, ohne daß es selbst in ein Etwas verwandelt wird. Waldenfels’ Fragen nach dem, worauf wir antworten, haben selbst antwortenden Charakter, denn sie lassen sich durchgängig responsiv auf markante Positionen des philosophischen Denkens über Frage und Antwort ein. So wird in einem ersten Teil ein kritischer Durchgang durch die philosophischen (linguistischen und sprachlogischen) Theorien gemacht, die zum Verhältnis von Frage und Antwort Stellung beziehen. Der Autor konstatiert vorab, daß bei allen von ihm detektivisch durchforschten Theorien die Frage viel ausführlicher als die Antwort behandelt wird: “Die Antwort scheint der Frage seltsam hinterherzuhinken, wie ein Ergänzungsstück im Puzzle...” (24). Im Falle Husserls etwa reihen sich Frage und Antwort in die Reihe intentionaler Akte ein, die sich dadurch auszeichnen, daß sie etwas als etwas meinen. Waldenfelst weist auf, daß der Frage bei Husserl eine Bedeutungsintention zukommt, die sie
Reviews
391
vorab in eine Sinnteleologie einschreibt. Das Fragliche findet seinen Sinn in einer Vorläufigkeit auf das Erfragte hin. Die Frage in dieser Übergangsstellung verweist somit auf das Ideal einer Vollkommenheit und Einstimmigkeit der Erfahrung (43). Die mögliche Beantwortung einer Frage ist nach Husserl in der Frage als solcher immer schon mitenthalten. Damit kommt sie in ihrer eigenständigen Funktion gar nicht erst in den Blick. Ähnliches gilt für die Sprechakttheorie. Diese definiert das Fragen als speziellen Fall von Aufforderung, nämlich zur Wissensauskunft bzw. Information (51). Als Auskunftsfrage ist sie zugleich eine Erkenntnisfrage, für die eine Antwort schon bereitsteht. Frage und Antwort erscheinen also reduziert auf die Funktion der Aufforderung zur Wissensvermittlung. Dies stellt nach Waldenfels eine unzulässige Restriktion des Frage-Antwort-Geschehens dar. Das besondere Manko für die Antwort sei, daß sie in der Definition der Sprechakttheorie zum bloßen Lückenfüller der Frage werde. Bei den Ansätzen von Tugendhat und Habermas, die die Frage als kommunikative Handlung bestimmen, kritisiert der Autor im Falle Tugendhats, daß dieser im Rahmen einer formalen Semantik die Antworten auf Ja/Nein- Operationen reduziere (71). Damit trete der dialogische Aspekt von Frage und Antwort hinter die satzimmanente Logik in die zweite Reihe zurück. Ähnliche Tendenzen ließen sich auch bei Habermas finden, obwohl dieser gerade auf der Ebene der Kommunikation ansetze und nicht, wie Tugendhat, auf der Vorebene der Kommunikabilität. In Habermas’ geltungsorientierter Trichotomie der Grundmodi kommunikativen Handelns (konstative, expressive und regulative Sprechhandlungen) bleibe kein Platz für Frage und Antwort, da es Habermas eben nicht in erster Linie um Dialogik, sondern um universale Geltungsansprüche gehe (77). Danach untersucht Waldenfels Ansätze, bei denen die Frage nicht als Akt unter möglichen anderen betrachtet wird und die Antwort nicht die Rolle des bloßen Erfüllungsgehilfen der Frage spielt, sondern in denen sich die Sequenz von Frage und Antwort als die minimale Einheit darstellt, ohne die ein dialogisches Geschehen gar nicht zustande käme (Goffman, Grice, Wunderlich). Daran anschließend nimmt er die Konzepte dialogischer Logik von Lorenzen und Jacques bis hin zu Gadamers Dialogik als Textauslegung ins Visier.
392 Gadamers Hermeneutik wird deshalb eingehend behandelt, weil der Autor in der Rekonstruktion des Gadamerschen Frage-Antwort-Modells eine für seine Überlegungen bedeutsame Gedankenfigur findet: den Chiasmus, d.h. die Überkreuzung von Frage und Antwort in der Textauslegung (126). Wichtig ist die hermeneutische Einsicht, daß alles Fragen bereits ein Antworten ist, während das Antworten selbst noch ein Fragen ist, indem es mögliche Antworten erprobt. Kritik an Gadamer wird laut im Hinblick auf die Zielorientierung des hermeneutischen Zirkels. Dabei wird bezweifelt, daß der Frage ein hermeneutischer Vorrang zukomme. Die Frage stünde bei Gadamer von vornherein in einem “rechten Fragehorizont”, und dieser verleihe ihr einen “eindeutigen ‘Richtungssinn’” (135). Waldenfels urteilt kritisch: “Dies sind die Folgen eines Fragens, das auf die Bahn eines Wissensstrebens und Wissenwollens zurückfindet.” (ebd.) Im hermeneutischen Zirkel werde dem Fremden sein Stachel geraubt. Die folgenden Analysen zu Foucault und Lyotard stellen eine Art Übergang zum eigenen Konzept dar, da in der Diskursanalyse Foucaults eine “entsubjektivierte und entkommunizierte Form des Dialogs” (138) begegnet, die ein durchgängiges Korrektiv gegenüber allen Versuchen sei, “eine Ordnung des Dialogs zu erschleichen” (138). Die These von der Entsubjektivierung von Diskursen und ihrer Neubestimmung als (extradiskursive) Ereignisse durch Lyotard nimmt der Autor kritisch auf. Von der Bestimmung von Frage und Antwort als Wissensstreben und vermittlung leitet Waldenfels über zu den phänomenologischen Möglichkeiten, die Frage in ihrer Offenheit, d.h. in ihrer Fraglichkeit zu thematisieren. Das Problem hierbei sieht er allerdings einmal darin, daß solche Erwägungen immer noch innerhalb einer Ziel- und Regelordnung gedacht sind und zweitens die Fraglichkeit als solche in den Zirkel einer unendlichen Rückbezüglichkeit gerät. Am Ende des ersten Teils steht der Autor somit vor der zweifelhaften Alternative: “Entweder fügt sich die Frage ein in eine fraglose Ordnung und büßt damit ihren genuinen Fragecharakter ein, oder sie bewährt ihren genuinen Charakter, indem sie sich in das Nirwana ihrer eigenen Fraglosigkeit zurückzieht.” (186)
Reviews
393
Statt die Aporie innerhalb der Vorrangstellung der Frage zu lösen, macht Waldenfels eine Kehrtwende und rollt die Thematik des ersten Teils vom Verhältnis von Anwort und Anspruch her auf. Die Leitfrage lautet: Worauf antworten wir, wenn wir etwas erfahren, sagen und tun? Die Teile II (Antwort und Anspruch) und III (Dimensionen der Antwort) entwerfen in detaillierten Analysen das Spektrum einer Theorie der Responsivität, die sich selbst in dem Anspruch wiederfindet, Antworten auf das komplizierte Verhältnis von Frage und Antwort zu geben, indem sie die Antwort ‘immer schon’ im Verhältnis zum Anspruch verortet sieht. Erst so könne die Antwort in ihrer Antwortlichkeit in den Blick kommen und hätte nicht länger die Lückenbüßerfunktion innerhalb einer ‘Logik’ der Frage. Um einen Querschnitt durch das weitverzweigte Begriffsnetz von Antwortregister zu legen, soll kurz auf vier Untersuchungsebenen eingegangen werden: (a) auf Grundzüge einer Responsiven Phänomenologie, (b) auf den relationalen Charakter von Frage und Antwort, (c) auf die Dimensionen einer responsiven Rationalität und (d) auf Hinweise zu einer responsiven Ethik. (a) Waldenfels arbeitet eine Verdoppelung des Begriffs Antwort heraus. Einmal ist es möglich, die Antwort in ihrer Funktion als Aussage (enoncé) zu betrachten; in diesem Fall spricht man davon, daß etwas als etwas beantwortet wird. Im zweiten Fall wird die Antwort als Aussagevorgang (énonciation) betrachtet; dann steht die Antwort im Modus eines Antwortens auf... Entscheidend für die responsive Theorie ist nicht der Aspekt des Beantwortens einer Frage, die sich in der Wahrheit des Gesagten erfüllt, sondern das Antworten auf ein Fragen, oder anders formuliert: das Sagen im Gesagten. Dabei ist zu beachten, daß das Sagen nicht einfach neben dem Gesagten vorkommt, sondern das Sagen bildet vielmehr einen “Überschuß” (199) im Gesagten selbst. Den Unterschied zwischen der Beantwortung von etwas als etwas und dem ‘Antworten auf’ etwas hält Waldenfels in den Termini einer signifikativen und responsiven Differenz (242) fest. Betont wird, daß jeder Versuch, den Antwortvorgang, der auch “Ereignis des Sagens” genannt wird, in Ordnungen einzufangen, “aus einem Vergessen der responsiven Differenz” (ebd.) hervorgeht. Die Methode, mittels derer der Autor das “Ereignis des Sagens” und damit die Ereignishaftigkeit der Responsivität einzuholen versucht, nennt er
394 responsive Epoché. Die Einnahme dieser Perspektive des Innehaltens ermöglicht die Rückführung des Gesagten auf das Sagen des Gesagten, auf das Ereignis des Sagens, responsiv gewendet: “Eine Methode, die mit dem Bann des Gesagten und Gesehenen bricht und in allen gegebenen Antworten das Antworten selbst durchscheinen läßt, könnte man als responsive Epoché bezeichnen.” (538) Diese Epoché, auf das Antwortereignis abhebend, führe zu einer Definalisierung, Entsubjektivierung,
Depersonalisierung,
mithin
zu
einer
“gezielten
Desorganisation” (197) des responsiven Denkens, Tuns und Handelns. Das Ereignis der Responsivität, das in der Epoché freigesetzt wird, ist impersonal im Sinne eines “es spricht” (217). (b) Entscheidend für die Explikation der Responsivität ist ihr relationaler Charakter. Untersucht wird die Frage, worauf die Antwort eine Antwort ist. Der Bezugspunkt ist nun aber nicht mehr so sehr die Frage, sondern der Anspruch. So gehen die Bemühungen des Autors dahin, in vielerlei Hinsicht die appellativen Strukturen der Sprache freizulegen. Anspruch ist dabei für ihn genau das in der Frage, worauf die Antwort antwortet (241). Dabei wohnt dem Anspruch immer eine Fremdheit inne, an die die Antwort nur anknüpfen kann, ohne sie jemals in Eigenes verwandeln zu können. Der Fremdbezug, der sich im Anspruch bekundet, läßt sich nicht durch einen Wechselbezug von Frage und Antwort aufheben bzw. aneignen. Deshalb ist das Verhältnis von Anspruch (Frage) und Antwort nicht durch Reziprozität bestimmt. Fragen und Antworten werden als “Zwischenereignisse” (234) betrachtet, wobei Ereignis nur an Ereignis anknüpfen kann (im Laufe der Analysen treten immer wieder chiasmatische Beschreibungen der Zwischenereignisse auf). Damit wird jegliche Zirkelhaftigkeit des Denkens responsiv unterbrochen. Das, was der Antwort im Anspruch begegnet, ist immer auch ein Überschuß, ein Fremdes oder auch ein Außer-ordentliches. Die responsiven Zwischenereignisse setzen sich von jeder Form von Holismus, Kontextualismus, Situationismus (279) und von dialogischer face-to-face-Beziehung (577f.) ab. Ein irreduzibler Hiatus zwischen Frage und Antwort sprengt den Holismus des Gesprächs. Das responsive Gespräch gleicht daher eher einem ‘zerklüfteten Gebirge’. (c) Das, was sich im Anspruch stets einer antwortenden Aneignung bzw. Entsprechung (adäquatio) entzieht und somit das Frage-Antwort-Geschehen
Reviews
395
allererst eröffnet, prägt die Responsivität als generellen Grundzug sprachlicher und außersprachlicher Akte und Handlungen. Wird die Betonung so sehr auf das gelegt, was sich entzieht bzw. in keiner Ordnung aufgeht, so ist nur mit Einschränkung von einem Konzept responsiver Rationalität zu sprechen. Antwort und Anspruch sind nicht von vornherein informellen oder formellen Rationalitätskriterien zu unterwerfen. Es gilt vielmehr darauf zu bestehen, “daß Rationalität als allgemeine Gestalt der Ordnung und möglichen Unordnung im Antworten entsteht, ähnlich wie nach den konkurrierenden Ansätzen Sinn in der Intention entsteht, Geltungsansprüche in der Kommunikation erhoben und eingelöst werden” (333). Es gibt, so Waldenfels, einen responsiven Logos “hinter aller Apophantik und Hermeneutik und hinter allen dialogisch zu erzielenden Homologien” (ebd.). Rational ist das Antworten nur, insofern es repititive Züge aufweist, d.h. immer schon geantwortet hat. Waldenfels’ weitere Bemühungen gelten der Ausarbeitung der Elemente einer Antwortlogik, die die verschiedenen Dimensionen des Antwortens begrifflich zu fassen versucht. Zu den wichtigsten Begriffsfiguren des Antwortregisters zählen der Hiatus (Riß, Spalte), die Irreziprozität, die Diastase und die Figur des Überschusses. Dieses Begriffsgeflecht erprobt der Autor an den einzelnen Dimensionen des Antwortens: in der Sprache des Begehrens, in den Dimensionen der Zeitlichkeit (zwischen Vergessen und Erinnern), im Bereich der Wahrhaftigkeit, in bezug auf die Leiblichkeit und vor allem auch im Bereich des Handelns. Für die beiden letzteren Bezugspunkte etabliert er die Begriffe einer Hetersomatik (478) und einer Heteropraxie (462). (d) Das leibliche Responsorium und das antwortende Handeln führen Waldenfels schließlich zur Erörterung einer responsiven Ethik. Diese Ethik untersteht keinem Prinzip, sie hat vielmehr “eine nicht-ethische Herkunft” (557), da sie mit dem Anderen beginnt. Wenn gefragt wird, worauf sich in ethischer Einstellung das Antworten richtet, dann kann im Anschluß an Levinas gesagt werden: auf das Antlitz bzw. die Spur des Anderen. Der fremde Anspruch des anderen Antlitzes ist immer schon an den Antwortenden ergangen. Dieser steht im Anruf des Anderen. Das fremde Antlitz ist un-nahbar, unantastbar, insofern es sich jedem identifizierenden Zugriff entzieht (536). Der
396 Anspruch des Fremden gebietet uns Achtung. Die Rücksicht vor dem Anderen ist als Form der Achtung “das zentrale Moment der ‘responsio’” (537). Mit Überlegungen zum Verhältnis von Geben und Nehmen (im Ausgang von M. Mauss und unter Berücksichtigung der Arbeiten von J. Derrida) führt Waldenfels sein Konzept einer responsiven Ethik weiter aus. Er argumentiert von einer Ethik des Gebens her, wobei er die Gabe (das Geschenk) als einen Überschuß betrachtet, von dem aus - in chiasmatischer Verflechtung - ein nehmendes Geben und ein gebendes Nehmen denkbar wird. Dieser ethische Chiasmus wird allerdings in einer ursprünglichen Irreziprozität verankert. Die Gabe wird im außer-ordentlichen Sinne als ein Schenken verstanden. Im Schenken bekundet sich ein Mehr, ein plus ultra, das keine Mehr- oder Übergegebenheit bedeutet sondern “das Ereignis des Gebens selbst” (635), ein “Außer-ordentliches, das die Ordnungen durchbricht und damit unser Begehren, Sehen, Tun und Reden in Atem hält” (ebd.). Waldenfels stellt sich mit seinen Studien zu einer Theorie der Responsivität in die Tradition der französischen Weiterentwicklung bzw. Verwindung der Phänomenologie, wie sie u.a. von Merleau-Ponty, Levinas und Derrida geleistet worden ist. In intensiver Auseinandersetzung mit philosophischen Positionen unseres Jahrhunderts kommt er zu einer originellen Antwort auf die bisherige Deutung der Frage-Antwort-Bewegung. Die Stärke des Buches erweist sich in dem Versuch, die Responsivität als grundlegenden Modus unseres Selbst- und Weltverhältnisses herauszuarbeiten. Dies besagt, daß das Antworten nicht nur neben anderen Weisen des Denkens und Tuns vorkommt, sondern daß wir immer schon in Antwort sind. D.h. nichts anderes, als daß wir zu antworten haben; wir sind gleichsam “zur Antwort verdammt” (584). Die vielfältigen Ansprüche, die uns beständig zum Antworten anhalten, bilden unvordenkliche Imperative, die sich allerdings nicht vollkommen transparent machen lassen. Es sind eben keine Geltungsansprüche, die durch rationale Argumentation auch grundsätzlich in Frage gestellt werden könnten. Ansprüche in dem ontologischen Sinn, wie der Autor sie versteht - unverkennbar ist die Nähe zu Heideggers Epoché des Seins, wie er sie etwa im Spruch des Anaximander formuliert -, stellen sich vor jedem begrifflich fixierbaren und kritisierbaren Anspruch und verpflichten den Menschen auf ein Antwortverhalten, das den
Reviews
397
Ansprüchen niemals gerecht zu werden vermag. Der Anspruch als solcher ist nicht einholbar, ansonsten würde er den Stachel seiner Fremdheit verlieren. Darin, nämlich in der Ontologisierung von Anspruch und Antwort, liegt aber zugleich auch das Problem der Theorie von Waldenfels: Der ontologisierte Begriff der Responsivität schließt m.E. eine unnötige Verunsicherung in bezug auf das Worauf des Antwortens ein. Dies geschieht dadurch, daß viel zu sehr der Ereignischarakter von Anspruch und Antwort betont wird und somit die Irreziprozität die Reziprozität von Frage und Antwort gänzlich zu verdrängen scheint. Daraus folgt, daß das Worauf der Antwort (der Anspruch) vollkommen anonymisiert wird. Waldenfels spricht von der “Impersonalität” (216) des Ereignisses des Sagens. Damit aber wiederholt er nur einen Mangel, den er gerade Theorien wie der von Habermas vorwirft, nämlich den der Nichtberücksichtigung der Dialogik. Es gehe Habermas um universale Geltungskriterien, aber nicht um die Wahrnehmung des Kommunikationsvorgangs als solchem. Weiterhin hält Waldenfels in Abgrenzung von den unmittelbaren Ich-Du-Beziehungen der Dialogphilosophie an der Unnahbarkeit des fremden Antlitzes fest und meint damit der völligen Aneignung des Fremden durch das fragende und antwortende Identifizieren entkommen zu können. Die Frage ist aber, wie die Konzepte der Zwischenleiblichkeit oder Zwischenereignisse, die ihre dialogphilosophische Herkunft ja wohl nicht ganz verleugnen können und wollen, überhaupt gedacht werden können, wenn zumindest der eine Pol der responsiven Relation von Anspruch und Antwort, der Anspruch nämlich, sich immer schon in die Anonymität und Impersonalität des Ereignisses zurückgezogen hat. Aus dieser ‘unvordenklichen Vergangenheit’ des fremden Anspruches müßte doch zunächst ein Weg hinausführen, um ein wie auch immer a-symmetrisches dialogisches Zwischen denken zu können.
398
STATE OF THE ART
Marcus Birke Externalismus in der Philosophie des Geistes Versucht man einen Überblick über die Flut neuer Veröffentlichungen zur analytischen Philosophie des Geistes zu erlangen, lassen sich zwei besonders hohe Flutwellen erkennen. Die erste wird von einem neu erwachten Interesse am Phänomen des Bewußtseins gebildet. Die zweite von externalistischen Positionen und Problemen, die daraus für liebgewonnene Überzeugungen innerhalb der Philosophy of Mind erwachsen. Ich werde mich im folgenden auf Beiträge zum Problem des Externalismus konzentrieren, der mittlerweile den Status einer Art Orthodoxie innerhalb der Philosophy of Mind erreicht hat.1 Die möglichen Wege, eine externalistische Theorie des Geistes zu entwickeln und mit ihren Problemem umzugehen, lassen sich zunächst grob zwei Lagern zuordnen, dem repäsentationalistischen und dem nichtrepräsentationalistischen. Die Vertreter einer repräsentationalistischen Theorie orientieren sich vorwiegend am Paradigma der kognitiven Wissenschaften oder einer anderen Form, eine ‘Naturalisierung’ des Geistes anzustreben. Bei den Vertretern einer nichtrepräsentationalistischen Theorie läßt sich als übergreifendes Merkmal eine wie auch immer geartete Beeinflussung durch den späten Wittgenstein ausmachen.2 Der
Kontrast
zwischen
Repräsentationalisten
und
Nichtrepräsentationalisten wird von einem weiteren Gegensatz überlagert und steht zum Teil in einem engen Bedingungsverhältnis mit ihm: Gemeint ist der Gegensatz zwischen Versuchen, unserem alltagspsychologischen Begriff des Geistes gerecht zu werden, und Versuchen, eine Semantik mentaler Zustände zu erarbeiten, die den Anforderungen einer wissenschaftlichen Psychologie gerecht wird. Der erste Versuch ist vornehmlich dem Lager der Nichtrepräsentatio-
State of the Art: Externalismus in der Philosophie des Geistes
399
nalisten zuzuordnen, der zweite den Repräsentationalisten, wobei kein Deckungsverhältnis besteht. Im folgenden wird eine Einordnung verschiedener Ansätze innerhalb der vier Alternativen, die durch diese beiden Kontraste ermöglicht werden, vorgenommen. Zunächst aber ist noch auf ein entscheidendes Problem hinzuweisen, das in der Vagheit des Externalismus-Begriffes besteht. Schon bei den ‘Vätern’ des Externalismus, Putnam und Burge, ist nicht ganz klar, was unter Externalismus zu verstehen ist. In der Folge hat sich eine geradezu verwirrende Vielfalt von Konzeptionen des Externalismus und entsprechenden internalistischen Gegenpositionen herausgebildet und so kommt es dazu, daß sich einige Autoren auf dem Kontinuum von ‘starkem Externalismus’ zu ‘starkem Internalismus’ z.B als Externalisten einordnen, obwohl sie nach anderer Definition des Begriffs eher dem internalistischen Pol nahestehen. Ich hoffe, daß in der Diskussion jeweils deutlich wird, welche Form des Externalismus einer bestimmten Theorie zugrunde liegt. Repräsentationalisten Als Paradebeispiele repräsentationalistischer Theoretiker können Fodor, Dretske und Sterelny gelten. Letzterer bietet in Sterelny (1990) eine umfassende Einführung in eine computerfunktionalistische und repräsentationalistische Theorie des Geistes. Bezeichnend für Sterelnys Buch ist die große konzeptionelle Spannung, die entsteht, will man eine zwar intentionalistische, aber trotzdem individualistische Theorie entwickeln3. Gut erkennbar wird diese Spannung an seinen Bemühungen, überhaupt ein echt funktionalistisches System4 zu definieren und innerhalb eines solchen Systems die repräsentationale Ebene intern zu bestimmen. Seine diesbezüglichen Versuche können letztlich nicht befriedigen, zumal seine Zuflucht zur Evolutionstheorie ein Verlassen der systeminternen Ebene bedeutet. Auch Sterelnys Auseinandersetzung mit Problemen des Externalismus für eine computerorientierte Theorie des Geistes bleibt, wohl aufgrund des einführenden Charakters des Buches, an einer Stelle stehen, an der weitere Ausführungen dringend wünschenswert erscheinen. Der Autor sieht, bei
400 Anerkennung der Tatsache, daß intentionale Gehalte zunächst einmal externalistisch zu bestimmen sind, zwei Motive, trotzdem auf der Notwendigkeit einer wie auch immer gearteten individualistischen Ebene zu bestehen. Diese sind zum einen das Motiv der mentalen Verursachung, zum anderen die etwas vage Vorstellung davon, daß ein ‘computational system’ wohldefiniert, wenn auch nicht physikalisch abgeschlossen sein müsse. Sämtliche einem ‘computational system’ zur Verfügung stehenden Daten seien dem System intern, nur die intrinsiche Natur eines Stimulus etwa könne das System kausal beinflussen. Wollte man das Gegenteil behaupten, würde man Zuflucht zu ‘magischen’ kausalen Fähigkeiten eines solchen Systems nehmen müssen. Somit müsse die Supervenienzbasis der Prozesse, die die Psychologie interessiere, von Prozessen innerhalb des Systems gebildet werden. Auch die Notwendigkeit, daß ein ‘computatioanl system’ wohldefiniert sein müsse, bedinge den Individualismus: Inputs, Verarbeitungskanäle, motorische Outputs etc. müssen innerhalb des Systems definierbar sein. Diesen Anforderungen an ein ‘computational system’ will Sterelny dadurch gerecht werden, daß er sie als Systeme betrachtet, die externalistische mentale Gehalte implementieren. Eine internalistische Theorie würde dann mit kausalen Rollen mentaler Zustände arbeiten, die gegebenenfalls teleologisch angereichert werden müßten. Da Sterelny eine nur mit ‘narrow contents’5 arbeitende intentionalistische Theorie des Geistes für nicht realistisch hält und auf der Notwendigkeit externalistischer mentaler Gehalte besteht, bleibt vor allem fraglich, wie das Verhältnis zwischen ‘wide contents’ und ihren internalistischen Realisationen aussehen soll, besonders wenn diese repräsentational bleiben sollen. Die Möglichkeit eines teleologischen Ansatzes wird leider nur angedeutet und nicht weiter ausgeführt. Insgesamt
bietet
Sterelny
eine
reichhaltige
Einführung
in
die
funktionalistische Theorie des Geistes, die nicht an einer Rekonstruktion der Alltagspsychologie, sondern an einer vermeintlich wissenschaftlichen Konzeption des Geistes orientiert ist. Leider wird letztlich nicht klar, wie ein Ansatz innerhalb dieses Paradigmas auszusehen hätte, der das aus der Alltagspsychologie geerbte Repräsentationsproblem klärt.
State of the Art: Externalismus in der Philosophie des Geistes
401
Mit den Schwierigkeiten einer Naturalisierung mentalen Gehalts innerhalb einer wissenschaftlichen Psychologie setzt sich Fodor bereits sehr lange auseinander. Bis zum Erscheinen seines letzten Buches war er einer der Hauptwortführer der internalistischen Richtung, der stets die Notwendigkeit von ‘narrow content’ einklagte. In Fodor (1994) untersucht er die Möglichkeit, ohne diesen auszukommen und trotzdem eine intentionalistische und funktionalistische Theorie des Geistes zu vertreten. Überraschend ist diese Wende innerhalb Fodors Theorie allemal, auch wenn er nicht versucht, irgendeine Inkonsistenz im Begriff von ‘narrow content’ nachzuweisen, sondern es ihm lediglich darum geht, zu untersuchen, ob die Kognitionswissenschaften ohne diesen Begriff auskommen können. Fodor diagnostiziert ein Dilemma, in das er sich hineinmanövriert habe, weil er drei Punkte für attraktiv halte, die nur schwer miteinander zu vereinbaren seien: 1.
Psychologische Erklärungen arbeiten mit Gesetzen über gehaltvolle mentale Zustände.
2.
a) Intentionaler Gehalt ist auf Information reduzierbar. b) Die Reduktion geschieht mit Hilfe einer kausalen Semantik, die (i) die Naturalisierbarkeitsforderung und (ii) die Bedingung des semantischen Atomismus6 erfüllt. Dieser metaphysische Ansatz bezüglich mentalen Gehalts konstruiert ihn somit externalistisch.
3.
Das Credo der Maschinenfunktionalisten: ‘Computation’ ist die beste Implementierungshypothese für wahrheitserhaltende Prozesse.
Das Problem ist also dasselbe wie bei Sterelny: Wie ist eine Verbindung zwischen internalistischen ‘computational’ Prozessen und dem Externalismus mentaler Gehalte herzustellen oder zumindest deren Vereinbarkeit erreichbar? Die Lösung allerdings, die Fodor anbietet, kann philosophisch kaum überzeugen. Zunächst analysiert er recht eingehend zwei verschiedene Problemtypen, die der Externalismus mentaler Gehalte aufwirft: Zwillingserdeund Frege-Probleme: Bei ersteren tritt eine Diskrepanz zwischen individuellem Zustand des Subjekts und mentalem Gehalt dahingehend auf, daß ein und derselbe physiologische Zustand verschiedene Dinge in der Welt repäsentiert (ein physiologischer Zustand repräsentiert H2O oder XYZ), bei letzteren
402 dahingehend, daß verschiedene physiologische Zustände den gleichen Gegenstand in der Welt repräsentieren (‘Morgensternzustand’ und ‘Abendsternzustand’ repräsentieren die Venus7), ohne daß das Subjekt sich dessen bewußt ist. Am Ende seiner Analyse dieser Schwierigkeiten, gelingt ihm keine begriffliche Lösung und er bedient sich eines ähnlichen Kunstgriffs wie etwa schon bei seiner Behandlung des Problems mentaler Verursachung8: Ist ein Problem begrifflich nicht in den Griff zu bekommen, ist ein Wechsel auf eine vermeintlich empirische Ebene empfehlenswert. In diesem Fall sieht das Ergebnis dieses Kunstgriffs folgendermaßen aus: Zwar ist es begrifflich nicht ausgeschlossen, daß interne Verfassung eines Subjekts und repräsentationaler Gehalt seiner Zustände in der von den Zwillingserde und Frege-Problemen beschriebenen Weise auseinandertreten. Dies aber tritt wohl empirisch derart selten auf, daß diese Fälle, insbesondere in Rücksicht auf den evolutionären Erfolg der Spezies Mensch, zu vernachlässigen sind und keine echten Hindernisse einer wissenschaftlichen Theoriebildung in Rahmen der funktionalistischen Maschinentheorie des Geistes darstellen.9 Eine zumindest intern befriedigendere Art und Weise, mit den Problemen umzugehen, die der Externalismus aufwirft, bietet Dretske (1995), wobei er sich vornehmlich auf Wahrnehmungszustände und deren Gehalt beschränkt. Er bietet ebenfalls das Beispiel eines Theoretikers, der auf den alltagspsychologischen Begriff der Repräsentation nicht verzichten will, obwohl ihm eine wissenschaftliche Theorie des Geistes vorschwebt. Ein entscheidender Unterschied zu Sterelny und Fodor besteht aber schon darin, daß Dretske sich nicht an den mit dem Computermodell arbeitenden Kognitionswissenschaften orientiert, sondern die Biologie als Paradigma zur Entwicklung einer wissenschaftlichen Theorie des Geistes auswählt. Naturalisierung des Geistes heißt dann nicht mehr ‘Computationalisierung’, sondern ‘Biologisierung’. Entsprechend tritt bei Dretske auch keine Diskrepanz zwischen Externalismus und internen Prozessen der Subjekte auf, sondern er findet innerhalb der Biologie und insbesondere der Evolutionstheorie Modelle,
State of the Art: Externalismus in der Philosophie des Geistes
403
die diese Diskrepanz erst gar nicht aufkommen und den Geist als ‘echt externalistisch’ konstruierbar machen. Dretskes entscheidener Schritt, mit den Problemen des Externalismus fertigzuwerden, besteht darin, das Erkenntnisinteresse, das eine externalistische Theorie mentaler Gehalte befriedigt, von demjenigen zu trennen, das eine Theorie individualistisch-physiologischer Prozesse befriedigt. Wichtigster Ansatzpunkt für diese Trennung ist die Feststellung, daß wir mit mentalen Gehalten nicht Körperbewegungen, sondern Handlungen erklären wollen; wie Dretske dies formuliert: “What thoughts, desires, and feelings explain is not why your arm moves (when you move it intentionally), but why you move your arm.” (S. 152) Die Art, wie Handlungen erklärt werden, konstruiert Dretske dann nach dem Muster evolutionsbiologischer Erklärungen. So könnte eine Blume auf der Erde zu einer bestimmten Zeit im Jahr in einer bestimmten Farbe blühen, weil sich das als evolutionär erfolgreich erwiesen hat, da zu dieser Zeit eine bestimmte Insektenart, die auf diese bestimmte Farbe reagiert, besonders verbreitet ist und die Blume bestäuben kann. Eine Blumenart mit exakt derselben biochemischen Zusammensetzung könnte es auf Zwillingserde geben. Allerdings wird deren Verhalten und evolutionärer Erfolg mit dem Vorhandensein einer völlig anderen Insektenart erklärt, die den Pflanzen schädlich ist und von der Farbe abgeschreckt wird. So könnte einer Forscherin bei einer Beschränkung auf physiologische Untersuchungen der beiden Pflanzenarten entgehen, warum sie sich so Verhalten. Die gleiche Relation bestehe zwischen den physiologischen Ursachen menschlicher Körperbewegungen und Handlungserklärungen mit Hilfe mentaler Gehalte, die Dretske eben auch kausal-evolutionär und somit in Form eines ‘historischen Externalismus’10 erklären will. Dieser Ansatz entspricht Dretskes Vorgehensweise in “Explaining Behavior”11, wo er von ‘strukturierenden Ursachen’ spricht. Andererseits bestehen aber auch Ähnlichkeiten mit Dennetts Ansatz in “Real Patterns”12, der das Beispiel eines physikalisch allwissenden Außerirdischen verwendet, der die intentionale Einstellung nicht einzunehmen vermag, aber in der Lage ist, alle unsere Körperbewegungen aufs genaueste vorauszusagen. Er wäre aber nie in
404 der Lage die ‘realen Muster’ im Verhalten von Menschen zu erkennen, die es uns ermöglichen, ihnen mentale Zustände zuzuschreiben und so ihr Verhalten zu erklären und vorauszusagen. So wäre dem Außerirdischen unser diesbezüglicher Erfolg ein vollkommenes Rätsel. Das Spezifische an Dretskes Ansatz ist es, daß er auch evolutionäre bzw. Handlungserklärungen als kausale Erklärungen deutet. Während Dennett die intentionale Einstellung instrumentalistisch interpretiert, ist für Dretske das oben kursiv gedruckte “weil” kausal zu verstehen. Dies setzt freilich eine Erweiterung des gängigen Begriffs der Ereigniskausalität voraus, ist zwar intuitiv nicht unplausibel, bedürfte aber sicher weiterer Argumentation. Immerhin gelingt es Dretske, sollte die Position zu verteidigen sein, die übliche Form des Problems mentaler Verursachung, die eben am Begriff der Ereigniskausalität orientiert ist, so zu umgehen13. Er schafft somit eine Perspektive für die Naturalisierung des Geistes, die zumindest nicht von vornherein unplausibel ist. Nichtrepräsentationalisten Die Vertreter des nichtrepräsentationalistischen Lagers haben gegenüber Repräsentationalisten natürlich per definitionem einen Vorteil: Für sie sind mentale Gehalte von vornherein externalistisch14 und die Vereinbarkeit mit internalistischen Ansätzen muß nicht eigens thematisiert werden. Aber auch so bleibt noch eine Vielzahl von Problemen, die aus teilweise unterschiedlichen Motiven resultieren. Im folgenden sollen die neueren Arbeiten McDowells, McCullochs und Bilgramis besprochen werden. Abschließend werde ich auf die Art und Weise eingehen, wie Davidson mit dem besonders innerhalb einer externalistischen Theorie schwierig zu erklärenden Phänomen erstpersönlicher Autorität umgeht. Seine Auseinandersetzung mit diesem Problem ist erstmals auf Deutsch, mit einer Einführung versehen, leicht zugänglich. In McDowell (1994) entwickelt der Autor eine originelle externalistische Position. Die Originalität des Entwurfs läßt sich auf seine Motivation zurückführen. Diese besteht darin, eine metaphysisch-erkenntnistheoretische Position zu entwickeln, die es erlaubt, zwischen den Klippen des Idealismus auf
State of the Art: Externalismus in der Philosophie des Geistes
405
der einen und denen des ‘Mythos des Gegebenen’ auf der anderen Seite wohlbehalten hindurchzusteuern.15 So spielen in seinem Ansatz die bekannten Zwillingserde- oder Arthritis-Gedankenexperimente keine Rolle. Der Externalismus des Mentalen ergibt sich bei McDowell aus dem Bestreben, unserem Zugang zur Welt die Selbstverständlichkeit zurückzugeben, die er im common sense besitzt und die er, so McDowells Behauptung, erst durch spezifisch neuzeitliche Formen des Philosophierens und der entsprechenden Auffassung von Natur verloren hat. Folgerichtig werden so die Gegenstände der Außenwelt ohne den Umweg über repräsentationale Zustände im Geist zu dessen unmittelbaren Bezugsobjekten. Welt wird somit zu etwas grundsätzlich Verstehbarem, immer schon mit Sinn Angereichertem. Daß diese Position nicht in reinen Idealismus umschlägt, liegt, laut McDowell, an der Passivität von Erfahrung. Der Geist projiziert demzufolge die rationale Struktur nicht auf die Gegenstände der Erfahrung, sondern ist wesentlich passiver Teil einer im Ganzen sinnvollen Natur. McDowells Erläuterungen zu dieser Form des Externalismus sind im einzelnen recht verwickelt und stützen sich häufig auf Philosophen der Vergangenheit, wie etwa Kant, Hegel und Aristoteles. Von besonderem Interesse für eine externalistische Konzeption des Geistes ist dabei seine Anknüpfung an die Idee der ‘zweiten Natur’ bei Aristoteles. So gehöre Intentionalität nicht zur ‘Grundausstattung’ des Menschen, sondern er erlange sie durch Einübung entsprechender Praktiken in der Gesellschaft. Eine solche Erklärung von Intentionalität läßt immer die Frage aufkommen, wie beschaffen die Grundausstattung des Menschen sein muß, damit er durch Einübung in entsprechende Praktiken zu einem wirklichen Denker werden kann. Der Verdacht liegt nahe, daß die Fähigkeit, an solchen Praktiken teilzunehemen und Intentionalität zu entwickeln, die den Menschen vom Tier unterscheidet, selber bereits, zumindest rudimentär, intentional verfaßt sein muß und sich hier ungewollt so etwas wie narrow content durch die Hintertür wieder einschleicht. McDowell spricht in diesem Zusammenhang von ‘Spontaneität’ als menschlicher Fähigkeit, die im übrigen ein Grund für die
406 Irreduzibilität des Geistes ist. Es wird allerdings nicht so recht klar, ob und inwieweit Spontaneität repräsentationalen Charakter hat bzw. haben muß. Insgesamt trägt McDowells Ansatz stark therapeutische Züge im Sinne des späten Wittgenstein, und das vorliegende Buch ist sicher nicht mehr als eine Skizze einer Therapie, die den philosophisch verwirrten Geist zu den Selbstverständlichkeiten des Alltagsrealismus zurückführen soll. So fallen z.B. auch McDowells Erläuterungen zur Anthropologie eher spärlich aus und erschöpfen sich weitgehend in der Nennung von Anknüpfungspunkten in der Historie der philosophischen Anthropologie. Er sieht diese v.a. bei Gadamer, wobei etliche Ähnlichkeiten auch mit der Theorie Plessners deutlich werden. Bei einer McDowellschen Vorgehensweise muß, so wird immerhin klar, der Untersuchungsbereich ausgedehnt werden. In den gängigen Arbeiten zur analytischen Philosophie des Geistes spielen anthropologische Erwägungen z.B. keine Rolle. Wie das komplette Bild einer möglichen Therapie aussehen wird, bleibt mit Spannung abzuwarten. McCulloch (1995) verfolgt eine stark divergierende Herangehensweise, wenn auch seine Theorie Anklänge an McDowell, vor allem aber an den gemeinsamen ‘Urvater’ Wittgenstein aufweist. Es geht McCulloch um eine Theorie des Geistes, die unseren alltagspsychologischen Anschauungen und Verfahren gerecht wird, und er glaubt, dies mit einer ‘ontologischen’ Variante des Externalismus erreichen zu können. Hierzu untersucht er zunächst die Geschichte des Problems der Integration des Geistes in unser Weltbild von Descartes über Locke zu Frege und Wittgenstein. Im zweiten, systematischen Teil vetritt der Autor dann, was er als “strong in-the-world Wittgensteinianism” (S. 217, passim) bezeichnet. Hier diskutiert er das Zwillingserde-Gedankenexperiment und versucht zu zeigen, daß nur sein spezieller ‘Wittgensteinianismus’ in der Lage ist, dessen externalistischen Konsequenzen
in
einer
Weise
gerecht
zu
werden,
die
unser
alltagspsychologisches Empfinden nicht verletzt. Nach McCulloch gehört es zur Phänomenologie16 unseres Alltags, daß wir die Ausstattung der Realität mit mentalen Tatsachen genauso leicht erkennen,
State of the Art: Externalismus in der Philosophie des Geistes
407
d.h. aus dem Geschehen um uns herum ‘ablesen’, wie wir ihre Ausstattung mit festen Körpern wie Tischen u.ä. erkennen. Die Einheitlichkeit dieser Erfahrung hänge dabei in allen Fällen vom Besitz entsprechender Begriffe ab. Dieser wiederum werde duch die entsprechenden Formen des In-der-Welt-Seins konstituiert, und zwar sowohl für Begriffe fester Körper wie für mentale Begriffe. Mein Besitz des Begriffes “Tisch” hängt so von meiner entsprechenden Praxis mit Tischen, mein Besitz der Begriffes “Geist” hängt so von meiner Praxis ab, meine Mitmenschen als belebte, mit Geist ausgestattete Wesen zu behandeln. Daß jemand in einem bestimmten mentalen Zustand ist, wird so zu einer ebenso offensichtlichen Tatsache wie die, daß er ein rotes Hemd trägt. Die starke Variante dieses ‘In-der-Welt-Wittgensteinianismus’ kommt nun durch
Einbeziehung
des
Zwillingserde-Gedankenexperiments
in
den
Gedankengang zustande. Dieses zeige, daß unsere Gedanken die wahre Essenz der Substanzen ‘verfolgten’, diese zum Gegenstand habe. Daß sich unsere Gedanken auf die wahre Essenz beziehen, hat nun für McCullochs nichtrepräsentationalistischen Ansatz zur Folge, daß diese Essenz Bestandteil unserer Praxis und somit der Gedanken wird, was zu seiner ‘ontologischen’ Variante des Externalismus führt: “So be clear: Externalism is the view that some things which are external to the human individual are not Exterior to the mind. For example, it is an external fact about me qua human individual that I inhabit a world which contains H2O rather than XYZ, but according to Externalists this fact is not Exterior to the mind.” (S. 189; Hervorhebungen im Original) Nach dieser Auffassung praktizieren also mein Zwilling auf Zwillingserde und ich verschiedene Lebensformen, obwohl diese oberflächlich ununterscheidbar sind. Das hat jedoch zur Folge, daß mentale Gehalte nicht mehr so einfach in der Erfahrung zugänglich sind wie etwa die Farbe der Krawatte meines Chefs. Dieses Problem erstpersönlicher, und im Falle des Ansatzes McCullochs, auch drittpersönlicher Autorität, tritt aber für praktisch jede Konzeption des Externalismus auf. Eine mögliche Lösung dieses Problems soll weiter unten erörtert werden. Da McCulloch nur an einer Rekonstruktion unserer Alltagspsychologie interessiert ist, lehnt er übrigens Untersuchungen der kognitiven Psychologie und Neurophysiologie zur Natur mentaler Zustände nicht ab. Er meint
408 lediglich, daß diese zum Thema der Untersuchung unserer Alltagspraxis zugrundeliegender Prozesse wechseln und auch entsprechend, um die Verhältnisse nicht zu verunklären, die Terminologie ändern und nicht mehr von mentalen Gehalten etc. sprechen sollten, zumal er sich der These Searles17 anschließt, mentale Zustände müßten zumindest prinzipiell der Möglichkeit nach bewußt sein. Was der Theorie McCullochs letztlich noch fehlt, sind gute Gründe, die auch einen mehr oder weniger eingefleischten Cartesianer von seiner Position überzeugen könnten. Der Autor liefert zwar aufschlußreiche Analysen von Phänomenen wie Erfahrung und Introspektion, die eine unmittelbare Bezogenheit des Geistes auf die Welt plausibel erscheinen lassen, aber ein Hauptproblem eines jeden Wittgensteinschen Ansatzes läßt er unbeachtet, das Problem der petitio principii. Ein Cartesianer wird immer einwenden, um überhaupt an sozialen Praktiken teilhaben und Mentales als solches verstehen zu können, muß ein Subjekt immer schon über eine ‘Grundintentionalität’ verfügen, die somit durch die entsprechenden Lebensformen nicht erst geschaffen werden kann. So bleibt das Problem der Entstehung entsprechender Praktiken, und damit eine Hauptschwierigkeit seines Ansatzes, bei McCulloch ungelöst.18 Eine ebenfalls an der Rekonstruktion der Alltagspsychologie interessierte Theorie bietet Bilgrami (1992). In einem generell holistischen Rahmen und vom Standpunkt eines Davidsonschen radikalen Interpreten aus entwickelt der Autor seine Hauptthesen von der Einheit und Lokalität mentalen Gehalts. Beiden Hauptthesen liegt ein, nach Bilgramis eigener Charakterisiserung, externalistisches Bild des Geistes zugrunde. Ausgehend von der Überzeugung, “that a sincere, non-self-deceived, utterance (or assent to) a sentence by an agent is an utterance of something whose literal meaning gives the content of the belief that is expressed by the utterance” (S. 1), stellt Bilgrami folgendes Interpretationsprinzip auf: “When fixing an externally determined concept of an agent, one must do so by looking to indexically formulated utterances of the agent which express indexical contents containing that concept and then picking that
State of the Art: Externalismus in der Philosophie des Geistes
409
external determinant for the concept which is in consonance with other contents that have been fixed for the agent.” (S. 5; Hervorhebungen im Original) Die These der Einheit mentalen Gehalts besteht dabei in der Ablehnung einer Aufteilung des Gehalts in z.B. einen narrow content und einen wide content oder - positiv gesprochen - in der Behauptung, der nach obigem Prinzip festgestellte externalistische Gehalt sei derselbe, der auch in Verhaltenserklärungen eingehe. Die These der Lokalität mentalen Gehalts ergibt sich aus dem holistischen Charakter obigen Interpretationsprinzips. Es wird genau der externalistische Gehalt zugeschrieben, der sich mit dem Rest der Überzeugungen und anderen mentalen Gehalte des zu erklärenden Subjektes vereinbaren läßt. Aus der Menge aller möglichen mentalen Gehalte werden dabei nur die, je nach Erklärungskontext verschiedenen, relevanten ausgewählt. Das führt dazu, daß die Individuierung mentaler Gehalte extrem ‘feinkörnig’ ist. Anti-Holisten wie Fodor19 werden erwidern, daß diesem Prinzip zufolge nie zwei Subjekte im selben mentalen Zustand seien. Dies aber beunruhigt Bilgrami, in einer generell anti-fundamentalistischen Grundstimmung, keineswegs: Wenn wir mehr nicht erreichen können und so auch in der Praxis gut zurecht kommen, ist alles darüber hinausgehende überflüssig. Die Forderung, mentale Gehalte müßten externalistisch aufgefaßt werden, begründet Bilgrami hauptsächlich mit der Feststellung ihrer ‘Öffentlichkeit’. Eingeschränkt wird diese These auf bestimmte Begriffe. So ist der Begriff der Zahl Fünf z.B. nicht externalistisch festgelegt20. Bilgramis Arbeit erweist sich, v.a. in der Diskussion anderer Positionen, als extrem detailliert und trickreich und es gelingt ihr, durch die Kombination von Externalismus und individuellem Holismus wichtigen Einsichten und Forderungen sowohl der Externalisten als auch der Internalisten Rechnung zu tragen. Eine irreführende Komponente enthält aber Bilgramis Charakterisierung seiner Position als externalistisch. Dieses Prädikat trifft sicher nur in sehr schwachem Sinne auf seine Theorie zu. Das läßt sich anhand der Unterscheidung
zwischen
‘existence-dependence’
und
‘individuation
dependence’ verdeutlichen, wie Edwards sie in “Externalism in the Philosophy of Mind”21 vornimmt:
410 “A particular, P, may be existence-dependent upon another particular, Q, but Q need not be referred to in the individuation conditions of P. E.g. consider a case in which P is a vase, and “Q” names the maker of the vase.” Bilgramis Externalismus ist nun in dem Sinne schwach, daß er lediglich eine ‘Existence-dependence’ mentaler Gehalte vertitt, d. h. sein Externalismus läßt sich auf die These reduzieren, daß ein cartesischer Geist ohne Umwelt keine mentalen Gehalte haben könnte. Die Individuierung mentaler Gehalte aber erfolgt nach Bilgrami ganz wesentlich internalistisch-holistisch. Dieser holistischen Feinindividuierung wird dann, sozusagen nur noch aufgrund der praktischen Forderung nach Beobachtbarkeit mentaler Gehalte22, ein Bezugsgegenstand in der Welt zugeordnet. Wie schwach diese Variante des Externalismus ist, läßt sich durch Kontrastierung mit McCullochs Theorie verdeutlichen. Auch für diesen sind mentale Gehalte ja öffentlich zugänglich. Das gilt aber in wesentlich stärkerem Maße als für Bilgrami. So wird nach McCulloch ein mentaler Gehalt nicht nur durch ‘wahre Substanzen’ individuiert, diese bilden sogar seine Bestandteile. Entscheidend ist weiterhin, daß die internalistisch-holistischen Bestandteile bei Bilgrami die eigentliche Erklärungsarbeit besorgen. Wichtig ist für ihn nicht, ob die Handlung eines Subjektes im Trinken von H2O oder XYZ besteht, sondern wie er seine Handlung konzeptualisiert. So findet sich bei Bilgrami kaum etwas, was einen Internalisten erschrecken müßte oder einen hartgesottenen Externalisten befriedigen könnte. Dies mag lediglich ein Streit um Worte sein. Als tatsächlich unbefriedigend erweist sich Bilgramis Versuch, die Vereinbarkeit von externalistsicher Philosophie des Geistes und erstpersönlicher Autorität darzulegen. Seine Überlegungen laufen darauf hinaus, daß in unserer Kultur das Konzept der erstpersönlichen Autorität für unsere Praxis der Verantwortungszuschreibung unverzichtbar ist und daß Verantwortungszuschreibung wiederum den Kern unserer moralischen Praxis ausmache, ohne den diese nicht haltbar sei. Auf diese Weise erklärt Bilgrami lediglich, warum der Begriff erstpersönlicher Autorität unverzichtbar ist, nicht aber, wie er zu analysieren ist. Dabei dürfte für ihn diese Frage gar nicht derart problematisch sein, weil ja seine Theorie wesentlich internalistischer ist als seine Selbstcharakterisierung vermuten läßt23.
State of the Art: Externalismus in der Philosophie des Geistes
411
Ein Versuch, im Rahmen einer stärker externalistischen und nichtrepräsentationalen Theorie den Begriff erstpersönlicher Autorität zu klären, bietet Davidson (1994a & 1994b). Davidson kritisiert andere Ansätze, das Phänomen erstpersönlicher Autorität konzeptionell in den Griff zu bekommen, mit dem Vorwurf, daß es ihnen zwar teilweise gelinge, eine Analyse, nicht aber eine Erklärung des Phänomens zu liefern. Davidsons Erklärungsversuch entpuppt sich dann als erstaunlich simpel und als konsequente Folge seiner Philosophie: Radikale Interpreten sind demnach dem ‘principle of charity’ verpflichtet und dieses beinhaltet, daß eine Sprecherin die Bedeutung ihrer Worte kenne. In Kombination mit Davidsons Ablehnung des Begriffs der Sprache als sozial verbindliche und konstante Institution in “A Nice Derangement of Epitaphs”24 ergibt sich, daß einer Sprecherin in Bezug auf ihre eigenen Äußerungen eine spezielle Autorität zukommt, selbst wenn deren Gehalt und der ihrer mentalen Zustände externalistisch bestimmt wird. Diese Erklärung erstpersönlicher Autorität verletzt zunächst einmal die weitverbreitete Intuition, daß diese in irgendeiner Weise mit dem Bewußtsein zusammenhängt25. Dies ist ein Kritikpunkt, der Davidson sicher nicht sonderlich große Kopfschmerzen bereiten wird, da er dem “Mythos des Subjektiven”26 schon lange abgeschworen hat. Fraglich ist, ob er sich auch so gut mit einer weiteren Konsequenz seines Ansatzes anfreunden kann, daß nämlich der Unterschied zwischen Selbstzuschreibungen mentaler Zustände und Äußerungen über die Welt verwischt wird.27 Das ‘principle of charity’ und die Ablehnung des gängigen Begriffs der Sprache hat ja für alle Äußerungen eines Subjekts dieselbe Bedeutung. So hat Davidson nicht den Begriff erstpersönlicher Autorität erklärt, der im Zentrum der philosophischen Diskussion steht, sondern bestenfalls einen neuen definiert. Externalismus, eine ungeklärte Orthodoxie Alles in allem läßt sich erkennen, daß innerhalb der Philosophie des Geistes kein Weg mehr um die Probleme des Externalimsmus herumführt. Eine
412 Theorie, die diese unberücksichtigt ließe, müßte als nicht auf der Höhe der (analytischen) Diskussion gelten. Als wirkliches Problem tritt der Externalismus aber naturgemäß für Repräsentationalisten auf, die zumeist noch von der Idee des ‘Geistes im Kopf’ oder ‘im Computer’ geleitet werden. Nichtrepräsentationalisten vertreten per definitionem eine Form des Externalismus, der ihnen aus epistemologischen, metaphysischen oder alltagspsychologischen Gründen attraktiv erscheint. Entsprechende Schwierigkeiten treten aber auch für Nichtrepräsentationalisten auf. Als das Problem erscheint mir dabei, wie eine externalistische Philosophie des Geistes sich mit unserer Vorstellung von erstpersönlicher Autorität vereinbaren läßt. Ich sehe in der Diskussion keinen wirklich befriedigenden Ansatz, das Problem zu lösen, es sei denn man ist entweder bereit, irgendeine Form von ‘narrow content’, über dessen Gehalt dann erstpersönliche Autorität bestünde, in seine Theorie zu integrieren oder aber erstpersönliche Autorität welcher Form auch immer als Illusion abzulehnen. Zu letzterem Schritt sind allerdings bezeichnenderweise viele Externalisten nicht bereit28. Anmerkungen 1 Wenn McCulloch (1995) in seiner Einleitung behauptet, eine Form des cartesischen Internalismus bilde die Hauptströmung innerhalb der Philosophy of Mind, kann er sich damit nur auf alle Positionen beziehen, die nicht seine ‘ontologische’ Variante des Externalismus vertreten. Vgl. u. im Text. 2 Solche Gegenüberstellungen haben natürlich immer etwas Künstliches an sich, können nie ganz trennscharf sein und nicht alle Teilnehmer der Debatte lassen sich zweifelsfrei zuordnen. Trotzdem erscheinen sie mir hilfreich, will man die Motivation der verschiedenen Externalismus-Konzepte verstehen, zumal nichtrepräsentationalistische Theorien per definitionem externalistisch sind, läßt man eliminative und rein syntaktische Theorien außer acht. 3 Der Ausdruck ‘intentionalistisch’ wird hier im wesentlichen bedeutungsgleich mit ‘repräsentationalistisch’ verwendet, wenn es auf das Mentale Bezug nimmt. Die Bezeichnung ‘individualistisch’ wird von Sterelny, nach dem Vorbild Burges, gleichbedeutend mit ‘internalistisch’ verwendet. 4 Auf das Problem, mit dem Sterelny zu kämpfen hat, ist schon häufig hingewiesen worden: Letztlich kann jedes System jede funktionalistische Beschreibung erhalten. 5 Das Gegensatzpaar ‘wide content’ vs. ‘narrow content’ bezeichnet zwei Arten repräsentationalen Gehalts eines mentalen Zustandes und ist vor allem von Fodor in zahlreichen Arbeiten thematisiert worden. ‘Wide content’ ist dabei der nach externalistischer Theorie zugeschriebene Gehalt, ‘narrow content’ ist der mentale Gehalt, den ein Erdenbewohner und sein Zwilling auf Zwillingserde teilen können. ‘Wide content’ ergibt sich als ‘Funktionswert’ aus ‘narrow content’ und der jeweilig verschiedenen Umwelt. 6 Semantik ist dann atomistisch, wenn die Bedeutung einer Repräsentation nicht von den Bedeutungen anderer Repräsentationen abhängig ist, d.h. wenn sie nicht holistisch ist.
State of the Art: Externalismus in der Philosophie des Geistes
413
7 Diese psychologisierende Fregedeutung liegt in Fodors spezifischem Ansatz begründet. Da auch Fodor gerne von ‘Propositionen’ spricht, wäre es allerdings wünschenswert, er würde deren Status näher erörtern. 8 Vgl. hierzu Kap. 5 in Jerry A. Fodor: A Theory of Content. And Other Essays, Cambridge, Massachusetts & London 1992. 9 Daß eine solche, philosophisch letztlich nicht befriedigende, Umgehung des Problems für einiges Mißfallen sorgt, kann nicht überraschen. Siehe etwa McCulloch (1995), S. 182, FN 3, wo er Fodors Position als “uncharacteristically desperate” bezeichnet. 10 Mit ‘historischer Externalismus’ ist hier eine Theorie nach Art Millikans gemeint: Die einem jetzigen internen Zustand vorangehenden externen Zustände eines Subjektes und deren Ursachen bestimmen dessen mentalen Gehalte; zwei intern identische Subjekte mit verschiedener Geschichte können verschiedene mentale Gehalte haben. Siehe hierzu v.a. Ruth Millikan: Language, Thought, and Other Biological Categories, Cambridge 1984. 11 Fred Dretske: Explaining Behavior. Reasons in a World of Causes, 3. Aufl., Cambridge, Massachusetts & London 1992. 12 Daniel C. Dennett: “Real Patterns”, The Journal of Philosophy 89 (1991), S. 27-51. Vgl. auch: Michael Quante: “Rationalität - Zement des Geistes?2, in: Axel Wüstehube (Hg.): Pragmatische Rationalitätstheorien. Studies in Pragmatism, Idealism, and Philosophy of Mind, Würzburg 1995, S. 223-268. 13 Zum Problem mentaler Verursachung sei auf die empfehlenswerte, besonders an dieser Schwierigkeit orientierte Einführung in die Philosophie des Geistes von Kim hingewiesen: Jaegwon Kim: Philosophy of Mind, Boulder, Colorado & Oxford 1996. Vgl. auch: Michael Quante: “Mentale Verursachung. Die Krisis des nicht-reduktiven Physikalismus”, Zeitschrift für philosophische Forschung 47 (1993), S. 615-629. Eine weitere, nicht nur in dieser Hinsicht aufschlußreiche Einführung bietet: Samuel Guttenplan: “An Essay on Mind”, in: ders. (Hg.): A Companion to the Philosophy of Mind, Oxford & Cambridge, Massachusetts 1994, S. 1-107. 14 Vgl. FN 2. 15 Für eine Auseinandersetzung mit McDowells Ansatz siehe: Marcus Willaschek: “Die Wiederentdeckung der Welt als Gegenstand der Erfahrung. Bemerkungen zu John McDowells ‘Mind and World’”, Allgemeine Zeitschrift für Philosophie 21 (1996), S. 163-174. 16 Der Begriff ‘Phänomenologie’ wird von McCulloch nicht im Sinne Husserls verwendet. Er bedeutet bei ihm vielmehr das, was unserem alltagspsychologischen Vorgehen und Empfinden immanent ist. 17 Zuletzt in: John Searle: The Redsicovery of the Mind, Cambridge, Massachusetts & London 1992. 18 Wie oben dargelegt gilt dies natürlich auch für die Theorie McDowells. Dieser bietet aber zumindest einen Hinweis auf eine mögliche Lösung, indem er auf das Konzept der ‘zweiten Natur’ bei Aristoteles und die menschliche Fähigkeit der Spontaneität verweist. 19 Siehe z.B. Jerry A. Fodor & Ernest Lepore: Holism. A Shopper’s Guide, Cambridge, Massachusetts & Oxford 1992. 20 Es scheint eine berechtigte Frage, wie dieser dann allgemein zugänglich sein kann. 21 Steve Edwards: Externalism in the Philosophy of Mind, Aldershot, Brookfield u.a. 1994, FN 16, S. 27. Das Buch bietet im übrigen eine enorm hilfreiche Einführung in die Problematik und verschiedenen Motivationen von Externalismus und Internalismus. Edwards selber ist vor allem am Problem mentaler Verursachung interessiert und vertritt, in Anlehnung an C. Macdonald, eine typenexternalistische Theorie psychologischer Zustände in Verbindung mit einer tokenphysikalistischen Identitätstheorie.
414 22 Eine These, die eigene Probleme aufwirft, vgl. FN 16. 23 Bilgramis Schwierigkeiten mit erstpersönlicher Autorität resultieren allerdings in stärkerem Maße aus dem - an Davidson orientierten - strikt drittpersönlichen Ansatz, den er verfolgt, als aus seinem Externalismus. 24 Donald Davidson: “A Nice Derangement of Epitaphs”, in: Ernest Lepore (Hg.): Truth and Interpretation. Perspectives on the Philosophy of Donald Davidson, Oxford & Cambridge, Massachusetts 1986. Daß die Kombination mit den Ausführungen in diesem Aufsatz sinnvoll und intendiert ist, betont Davidson selbst in: “Reply to Bernhard Thöle”, in: Ralf Stoecker (Hg.): Reflecting Davidson. Donald Davidson Responding to an International Forum of Philosophers, Berlin & New York 1993, S. 248-250. 25 Eine derartige Kritik findet sich z.B. in: Kirk A. Ludwig: “First-Person Knowledge and Authority”, in: Gerhard Preyer, Frank Siebelt & Alexander Ulfig (Hg.): Language, Mind and Epistemology. On Donald Davidson’s Philosophy, Dordrecht, Boston & London 1994, S. 367-398. Vgl. auch meine diesbezügliche Rezension in: Zeitschrift für philosophische Forschung 49 (1995), S. 636642. 26 Donald Davidson: Der Mythos des Subjektiven. Philosophische Essays, übers. & hg. v. Joachim Schulte, Stuttgart 1993. [Reclam Universal-Bibliothek Nr. 8845] 27 Eine Kritik in diese Richtung bietet: Eva Picardi: “First-Person Authority and Radical Interpretation”, in: Ralf Stoecker (Hg.): Reflecting Davidson. Donald Davidson Responding to an International Forum of Philosophers, Berlin & New York 1993, S. 197-209. In seiner Antwort auf Picardi zeigt Davidson selbst sich übrigens sehr unsicher, ob ihm eine Klärung erstpersönlicher Autorität gelungen ist. 28 Vielleicht bildet hier Davidson eine Ausnahme. Seine Position ist sicherlich zwiespältig. Er selber schient, wie gesagt, mit seinem Klärungsversuch nicht recht zufrieden. Johannes Brandl: “How Relational Are Davidson’s Beliefs?” in: Ralf Stoecker (Hg.): Reflecting Davidson. Donald Davidson Responding to an International Forum of Philosophers, Berlin & New York 1993, S. 175-193 z.B. rekonstruiert Davidsons Position als explizite Ablehnung des üblichen Begriffs erstpersönlicher Autorität. Für Verbesserungsvorschläge zu früheren Fassungen des Textes danke ich Michael Quante und Andreas Vieth. BEZUGNAHMEN Bilgrami, Akeel (1992): Belief and Meaning. The Unity and Locality of Mental Content, Blackwell: Cambridge, Massachusetts & Oxford, 301 S. Davidson, Donald (1994a): “Die Autorität der ersten Person, in: Manfred Frank (Hg.): Analytische Theorien des Selbstbewußtseins, Suhrkamp: Frankfurt am Main, S. 635-649. [stw 1151] Davidson, Donald (1994b): “Seine eigenen Gedanken kennen”, in: Manfred Frank (Hg.): Analytische Theorien des Selbstbewußtseins, Suhrkamp: Frankfurt am Main, S. 650-680. [stw 1151] Dretske, Fred (1995): Naturalizing the Mind: Bradford Book, MIT Press, Cambridge, Massachusetts & London, 208 S. Fodor, Jerry A. (1994): The Elm and the Expert. Mentalese and its Semantics: Bradford Book, MIT Press: Cambridge, Massachusetts & London, 129 S. McCulloch, Gregory (1995): The Mind and its World, Routledge: London & New York, 227 S. McDowell, John (1994): Mind and World, Harvard University Press: Cambridge, Massachusetts & London, 191 S. Preyer, Gerhard, Frank Siebelt und Alexander Ulfig (eds.) (1994): Language, Mind and Epistemology. On Donald Davidson’s Philosophy, Kluwer (Synthese Library), Dordrecht.
State of the Art: Externalismus in der Philosophie des Geistes
415
Sterelny, Kim (1990): The Representational Theory of Mind. An Introduction, Blackwell: Oxford & Cambridge, Massachusetts, 252 S.
416
SCIENCE AND HISTORY
Joseph Agassi Die gegenwärtige Rolle des Wissenschafts- und Technikhistorikers
1. Die Disziplin heutzutage Als ich mich verpflichtete, diese Vorlesung zu halten, hatte ich eine ganz einfache Idee über das, was ich sagen wollte: Ich wollte empfehlen, daß die Geschichte der Wissenschaft und die Geschichte der Technik so geschrieben wäre, wie andere Teile der menschlichen Geschichte heutzutage geschrieben werden; so daß wir aus der Geschichte der Wissenschaft und der Technik genau so lernen könnten, wie aus anderen Teilen der menschlichen Geschichte. Das ist meine ganze und meine einzige These hier, doch sie benötigt Erweiterung und Beispiele. Als mein Hauptbeispiel hier möchte ich das Thema Holocaust wählen. Erstens, sollten wir aus der Erfahrung des Holocausts lernen. Zweitens, kann man die Einzigartigkeit des Holocausts nicht verstehen, wenn man nicht bedenkt, daß sich dies in einer hoch entwickelten modernen Gesellschaft ereignet hat, und zwar hoch entwickelt auf allen Gebieten - außer dem der demokratischen Politik. Drittens, ist es unmöglich, die politische Geschichte unserer Zeit zu verstehen, ohne einen Blick auf die Geschichte der Wissenschaft und der Technik zu werfen, zusammen mit ihrem sozialen, wirtschaftlichen und ideologischen Hintergrund. Diese drei Punkte sind recht trivial, genau so trivial, wie die Behauptung, daß das Lernen aus der Geschichte dasselbe sei, wie das Lernen aus den Fehlern der Vergangenheit. Solange aber die Geschichte der Wissenschaft und der Technik traditionell so geschrieben wird, als ob dies ein Gebiet der Geschichte sei, das keine Fehler beinhaltet, kann man nichts aus der Geschichte der Wissenschaft und der Technik lernen. Doch, wie gesagt, kann man meiner Meinung nach, ohne aus der Geschichte der
Die gegenwärtige Rolle des Wissenschafts- und Technikhistorikers
417
Wissenschaft und der Technik zu lernen, auch nicht wirklich aus der Erfahrung des Holocausts lernen. Nun möchte ich zwar keine Zensur an der Historiographie der Wissenschaft und der Technik ausüben, da ich mich als Pluralist ansehe, und als solcher halte ich es für richtig, daß alle so viel wie möglich ihrem eigenen Geschmack folgen sollten. Doch wie viel ist hier möglich? Traditionellerweise wird diese Frage auf zwei Ebenen diskutiert: auf der persönlichen Ebene und auf der gesellschaftlichen Ebene. Auf der persönlichen Ebene ist es vielleicht ziemlich leicht zu bestimmen, was die Grenze des Erlaubten ist. Was unmoralisch ist, ist verboten, und was nicht verboten ist, ist erlaubt. Diese Einstellung widerspricht der allgemein akzeptierten Meinung, daß, was nicht empfohlen ist, verboten sei. Es ist klar, daß wir hier ein sehr schweres Problem haben: Wer bestimmt denn, was zu empfehlen ist und was nicht? Meiner Meinung nach ist - auf persönlicher Ebene - alles erlaubt, was nicht gegen die Moral verstößt. Aber das ist nicht klar genug, da die Schwierigkeit immer auf gesellschaftlicher Ebene liegt. So ist es zum Beispiel ein moralisches Gebot auf gesellschaftlicher Ebene, die Umgebung nicht zu verschmutzen. Tatsachlich beschuldigen mich meine Kollegen, denen ich widerspreche, daß ich durch meine niedrigen Standards die intellektuelle Umweltverschmutzung unterstütze. Noch schlimmer, die Historiker, deren Arbeit ich anerkenne, sind oft Beamte oder Kandidaten für irgendwelche öffentliche Stellungen, und daraus entsteht dann ein Problem der effizienten Nutzung knapper Mittel. Wie läßt sich dieses Problem lösen? Ich weiß es nicht. Doch glücklicherweise - oder nicht glücklicherweise - steht dieses Problem nicht am Anfang der akademischen Tagesordnung. Wichtiger scheint es mir, daß so viele Historiker der Wissenschaft sich entschieden unethisch benehmen. Ich will nicht übertreiben: Die meisten Historiker der Wissenschaft sind Akademiker, und als solche sind sie viel seltener Verbrecher als die Bürger im Allgemeinen. Außerdem beschäftige ich mich hier ja nicht mit nichtintellektuellen ethischen Problemen. Was können schon Intellektuelle als Intellektuelle Unethisches tun? Nur eines, so scheint es mir: Sie können ihr Publikum irreführen. Und das tun leider viele Historiker der Wissenschaft und der Technik ganz regelmäßig und zwar mit einer ganz einfachen Absicht. Sie
418 glauben, daß es ihre Pflicht sei, die Wissenschaft und die Technik öffentlich zu verteidigen. Vielleicht kann man sagen, daß eine Irreführung mit solch einer würdigen Absicht gar nicht als Betrug oder Lüge zu bezeichnen sei. Doch wir kennen es aus langer Tradition, die von Platon selber stammt, daß eine vornehme oder eine weise Lüge auch eine Lüge genannt werden sollte. Die Art der Irreführung in der Geschichte der Wissenschaft ist identisch mit der, die so häufig in der akademischen politischen Geschichtsschreibung zu finden ist. Man erzählt die guten Details und man verschweigt die schlechten. So kann man zum Beispiel Geschichten des Mittelalters lesen, die die Brutalitäten der Zeiten verschweigen, und die weder die Hexenverbrennungen noch die Judenverfolgungen erwähnen. Auch kann man Geschichten über Martin Luther lesen, in denen seine frühe Ermahnung, die Juden sanft zu behandeln, zwar erwähnt wird, doch ohne seinen späteren Aufruf zur brutalen Judenverfolgung zu erwähnen. Meine Absicht ist nicht, das Auslassen von Details anzugreifen, auch nicht von wichtigen Details. Alle Historiker müssen eine Auswahl treffen. Was ich hier angreife, ist die bewußte Irreführung des Publikums. Wenn man ehrlich über Luther schreiben will, ohne seinen brutalen Aufruf zur Judenverfolgung zu erwähnen, muß man sich bemühen, keinen falschen Eindruck zu erwecken. Wie das zu erreichen ist, ist die Sache eines jeden Autors, und ihm oder ihr stehen viele erprobte Methoden zur Verfügung. Man kann immer behaupten, daß Autoren ihr Publikum ohne Absicht irregeführt hätten; doch wenn es sich herausstellt, daß ein Autor die Technik des klaren Schreibens beherrscht, dann kann man annehmen, daß die Irreführung absichtlich war. In meinem ersten Buch Towards an Historiography of Science von 1963 habe ich Beispiele geschildert. Da Historiker der Wissenschaft nicht nur mit PrimärQuellen arbeiten können, müssen sie auch Sekundär-Werke benutzen. Und so kann man verfolgen, wie ein Historiker der Wissenschaft den Anderen irreführt und in welcher Richtung. Ich hoffte damals, daß mein Buch zu einer öffentlichen Debatte führen würde. Obwohl es großen Erfolg hatte, und auch positiv rezensiert wurde, löste es nicht die erwartete Debatte aus. Vielleicht ist es zu unangenehm, für einen Historiker der Wissenschaft zuzugeben, daß
Die gegenwärtige Rolle des Wissenschafts- und Technikhistorikers
419
manche ihrer Kollegen Irreführer sind. Aber die Tatsachen werden nicht verschwinden, nur weil sie unangenehm sind. Und seit der Veröffentlichung meines Buches haben, so scheint es mir, weniger Historiker der Wissenschaft die alten Methoden benutzt, doch haben sie schnell die Benutzung von anderen Methoden der Irreführung, die ich nicht erwähnt hatte, verbreitet; diese Methoden haben mit der Diskussion über die Wahl zwischen dem externen und dem internen Stil in der Wissenschaftsgeschichte zu tun, der in der Mitte der 60er Jahre begann. Die externen Ursachen sind Details, die nicht zur Wissenschaft gehören, wie zum Beispiel die wirtschaftliche Nachfrage oder militärische und nationale Interessen. Daß in der Geschichte der Wissenschaft beide Arten von Ursachen, externe und interne, existieren, ist selbstverständlich: das ist der Fall auf jedem Spezial-Gebiet der Geschichte. Die Debatte über den Stil betrifft, so scheint es, die relative Betonung der externen oder der internen Faktoren in der Geschichtsschreibung. Dieselbe Debatte hat auch zwischen Historikern der Literatur stattgefunden. Was die Meinungsverschiedenheit in diesen Debatten eigentlich war, ist nicht leicht zu entscheiden. Scheinbar war es die Frage: Soll man nur interne Ursachen des wissenschaftlichen Fortschritts diskutieren? Wenn immer ein Ereignis der Wissenschaftsgeschichte mehr als eine Art von Ursachen hatte, und das ist in der Regel so; welche Art von Ursachen soll man dann erwähnen? Ein Beispiel, das einen großen Eindruck auf mich gemacht hat, ist ein zweiteiliger Artikel, in der führenden Zeitschrift “Isis” im 1957 veröffentlicht, von Henry Guerlac, einem der berühmtesten Wissenschafts-Historiker, über Joseph Black, den Chemiker des 18. Jahrhunderts, der ein wichtiger Vorläufer Lavoisier’s war. Der Fall Black ist sehr interessant. Eine wichtige Monographie über seine Forschung war von A.N. Meldrum in den 30er Jahren veröffentlicht worden. Diese Monographie hat Guerlac gar nicht erwähnt. In dieser Monographie war die interessante Tatsache beschrieben worden, daß Black ein Phlogistonist war wie fast alle Chemiker seiner Zeit, doch stand er dieser Theorie kritisch gegenüber und begann den Trend, diese Theorie abzuändern ein Trend, der mit der lavoisierschen Revolution endete. Guerlac zeigte, daß Black ein medizinisches Interesse an den Chemikalien hatte, die er erforschte.
420 Black’s Überzeugung, daß der Phlogistonismus wahr sei, verschweigt Guerlac. Er erwähnte diese Theorie in seinem Artikel, und sogar dreimal; doch sagte er nicht, was Black’s Meinung über diese Theorie war, und er erklärte eindeutig, daß diese Theorie nichts als ein Aberglaube sei. Man kann von diesem Werk keinen
anderen
Eindruck
empfangen,
als
daß
Black
ein
strenger
Antiphlogistonist gewesen wäre. Ich nehme an, daß diejenigen Historiker der Wissenschaft, die die externe Geschichte zu schreiben empfohlen hatten, auch diejenigen waren, die behaupteten, daß es viel leichter sei, externe Geschichte zu schreiben, wenn man die Irrtümer der Vergangenheit verschweigen will. Aber, warum sollte man das denn tun? Hier finde ich es viel vernünftiger, dem Rat des berühmten Literaturwissenschaftlers und Historikers René Wellek zu folgen, nämlich, daß es immer besser sei, interne Ursachen zu diskutieren, als über externe zu berichten. Offensichtlich merkten auch Historiker der Wissenschaft, daß es eine Grenze des willkürlichen Übersehens von unangenehmen Details gibt. Dieser Artikel Guerlac’s wurde zwar kaum je erwähnt. Die Standard-Referenz ist Guerlac’s Artikel über Black in Dictionary of Scientific Biography von 1970. Irrtümer werden manchmal korrigiert, doch nur schweigend. Die interne Geschichte der Wissenschaft gewinnt also. Doch offensichtlich ist es unmöglich, eine rein interne Geschichte der Wissenschaft zu schreiben ohne ein verzerrtes Bild zu malen. Als Beispiel für eine einfache Verfälschung des Bildes der Wissenschaft kann man die Literatur über die mittelalterliche Wissenschaft nehmen. Bücher über die Geschichte der Wissenschaft im Mittelalter zeigen entweder, daß es fast keine Wissenschaft im Mittelalter gegeben habe, oder daß die mittelalterliche Wissenschaft dieselbe Art von Wissenschaft war, wie die unserer Zeit - nur weniger fortschrittlich. Der Eindruck, den das Lesen mittelalterlicher Texte auf einen modernen Leser macht, wird in dieser Literatur überhaupt nicht diskutiert, soweit mir bekannt ist. Diese Beobachtung ist leicht zu verallgemeinern.
Jede Epoche der
Geschichte der Wissenschaft und der Technik hat ihren Ethos, ihre besondere Philosophie, ihre eigene Meinung über den Charakter und die Rolle der Wissenschaft und der Technik. Es ist darum fast unmöglich, eine Geschichte
Die gegenwärtige Rolle des Wissenschafts- und Technikhistorikers
421
der Wissenschaft von verschiedenen Epochen zu schreiben, ohne daß der Autor irgendwelche Meinungsverschiedenheiten mit einem oder mehreren seiner Helden entdeckt. Dies läßt sich nur dadurch vermeiden, daß der Autor immer die Philosophie desjenigen Denkers, den er gerade schildert, unkritisch akzeptiert. Tatsächlich akzeptieren die meisten Historiker der Wissenschaft die Ideen der Aufklärung, und sehen in der Wissenschaft eine Aktivität ohne jegliche Irrtümer. Ich will mich nicht mit dem berühmten Physiker und Wissenschaftshistoriker E.T. Whittaker streiten, weil er die Newtonsche Mechanik als wahr geschildert hat: Er war ein dogmatischer Newtonianer, und das war sein gutes Recht. Aber viele andere Wissenschaftshistoriker schildern die Newtonsche Mechanik als wahr - und nachher akzeptieren sie Einstein’s Kritik derselben Theorie - und das ist nicht sehr erbaulich. Noch schlimmer ist The Mechanization of the World Picture von Dijksterhuis, wo in einem Kapitel St. Thomas gelobt wird, weil er eine Synthese zwischen Aristoteles und Archimedes hergestellt hatte, und in einem späteren Kapitel andere Leute gelobt werden, weil sie den Widerspruch zwischen diesen beiden Denkern entdeckt hatten. Warum erklärt Dijksterhuis diese komische Situation nicht? Vielleicht weil er das überhaupt nicht bemerkt hat. 2. Der konservative Naturwissenschaftler Es ist nicht leicht, einen Ethos zu beschreiben, und es ist vielleicht unmöglich, immer die Errungenschaften einer Epoche mit ihrem Ethos zu verbinden. Die wichtigsten Details, die einen Ethos betreffen, haben mit der generellen Einstellung zur Wissenschaft zu tun; die radikale Einstellung der Aufklärung, die in der Wissenschaft die einzig positive intellektuelle Tätigkeit sieht, und die konservative Einstellung der Romantik, die die Tradition als eine vielleicht noch wichtigere Quelle von Wissen und Weisheit ansieht, sind immer noch die zwei wichtigsten Philosophien. Aber natürlich gibt es manche andere. Die wichtigste unter diesen scheint mir die mittelalterliche zu sein. Es ist nicht leicht, diese zu beschreiben. Doch kann man, ohne den Widerspruch der Historiker des Mittelalters herauszufordern, sagen, daß die Haupteinstellung der mittelalterlichen Denker drei Punkte betraf. Erstens sei es die Aufgabe jeglicher Forschung, die alten Texte zu erklären; zweitens wäre das Kriterium
422 einer guten Erklärung, die Weisheit der Texte zu zeigen; und drittens wäre das Kriterium der Weisheit die Feststellung, daß es keinerlei Widersprüche zwischen den verschiedenen alten Texten gäbe. Ein Beispiel, das ich schon erwähnt habe, ist St.Thomas’ Versuch, den Widerspruch zwischen Aristoteles und Archimedes zu überbrücken. Das Werk El Farabi’s, Aristoteles widerspricht nie Platon, war vielleicht das wichtigste Buch des Mittelalters. Man sollte diesen Titel mit der These der Doktorarbeit des berühmten Renaissance-Denkers Pierre de la Ramée’s vergleichen, um den krassen Unterschied zwischen den beiden Auffassungen zu erkennen. Sie war, “Alles, was Aristoteles gesagt hat, ist falsch”. Woher kam dieser große Wandel? Ich weiß es nicht und ich habe bemerkt, daß Historiker der Wissenschaft diese Frage normalerweise nie diskutieren. Sie führen ihre Leser dadurch in die Irre, daß sie entweder der Philosophie der Aufklärung folgen und im mittelalterlichen Denken nur Vorurteile und Aberglauben sehen, oder sie folgen der Philosophie der Romantik und entdecken im mittelalterlichen Denken einen Vorläufer der modernen Wissenschaft. So übersehen sie den wichtigsten Beitrag Copernicus’, und zwar war das die Idee, daß die antiken Denker sich untereinander im Widerspruch befanden, und daß es deshalb unmöglich sei, sich mit allen antiken Denkern im Einverständnis zu befinden. Die Frage stellt sich sofort: Kann man im Mittelalter echte Wissenschaft finden? Ich sehe nicht, wie man versuchen könnte, diese Frage zu beantworten, ohne eine umfassende Wissenschaftstheorie explizit zu benutzen. Die meisten Historiker der Wissenschaft benutzen nur eine der beiden wichtigsten Philosophien, die der Aufklärung oder der Romantik, oder sie benutzen beide zusammen. Lassen wir dann einmal die Frage über das mittelalterliche Denken beiseite und kehren wir zurück zur modernen Wissenschaft mit ihren radikalen oder konservativen Denkern. Die Frage stellt sich nun: Sind denn nicht alle Wissenschaftler radikal oder gibt es auch konservative Wissenschaftler? Wir wissen, daß viele wichtige Wissenschaftler konservativ waren. Dann stellt sich sofort die nächste Frage: Kann eine Person politisch radikal und wissenschaftlich konservativ sein oder umgekehrt? Die meisten Wissenschaftler sind heutzutage politisch radikal, aber nicht wissenschaftlich radikal, vielleicht weil es nicht leicht ist, wissenschaftlich
Die gegenwärtige Rolle des Wissenschafts- und Technikhistorikers
423
radikal zu sein: Es ist viel leichter mit der Wissenschaft, sowie sie ist, zufrieden zu sein, als sie kritisch zu behandeln. Doch man sollte daraus nicht schließen, daß alle politisch konservativen Wissenschaftler auch wissenschaftlich konservativ seien. In meinem Buch Über Michael Faraday zeigte ich, daß Faraday’s Meinung im allgemeinen konservativ war, und daß trotzdem seine allgemeine Auffassung der Wissenschaft, wie auch seine physikalischen Theorien, sehr revolutionär waren. Überraschende und interessante Fälle sind aber diejenigen Wissenschaftler, deren wissenschaftliche Einstellungen ganz konservativ waren und die doch große Beiträge zum wisssenschaftlichen Fortschritt machten - nicht nur trotz ihrer konservativen Einstellungen, sondern auch wegen ihnen. Man kann daraus schließen, daß beide klassische Einstellungen zur Wissenschaft, die radikale und die konservative, durch diese Beispiele widerlegt sind - obgleich die meisten wichtigen Forscher radikal - sowohl politisch als auch wissenschaftlich - waren. Ich sollte nun ein Beispiel für einen konservativen Beitrag zum wissenschaftlichen Fortschritt geben. Vielleicht das wichtigste Beispiel dafür ist der Fall von Helmholtz und seinem berühmtesten Schüler Planck. Helmholtz war konservativ in seiner Weltanschauung. Er meinte, daß die Naturwissenschaft zwar universal sei, daß aber das Nationalinteresse partikulär sei; darum sei die Politik etwas ganz anderes als die Wissenschaft. Doch war er auch konservativ in seiner wissenschaftlichen Arbeit. Seine sehr wichtigen Untersuchungen über die physikalische Akustik stammen aus seinem konservativen musikalischen Geschmack; seine Ergebnisse widersprachen der Idee der wohltemperierten Tonleiter. Das aber ist bloß ein pikantes Detail, das zu den externen Faktoren der Geschichte der Wissenschaft gehört. Helmhotz’ interne Motive waren aber auch hoch konservativ. So fängt auch sein erster Aufsatz - “Über die Erhaltung der Kraft” von 1847 - mit einem klaren Bekenntnis zu seiner dogmatischen Befürwortung der Newtonschen Metaphysik. Die Absicht dieses Aufsatzes war aber nichts anderes als ein Kompromiß zwischen der Newtonschen und der Faradayschen Metaphysik: Da beide das Gesetz der Erhaltung der Kraft akzeptierten, sollte man dieses Gesetz als Prinzip annehmen. Später sagte er dasselbe über das Gesetz der Erhaltung der Energie. Fast alle seine
424 Untersuchungen über die Elektrodynamik waren auf einen Kompromiß ausgerichtet. Er hat auch die mittelalterliche instrumentalistische Philosophie als Kompromiß wieder belebt: Obwohl er nicht die moderne elektrodynamische Theorie als wahr betrachten konnte, solange sie nicht auf anständigem mechanischem Grunde stand, akzeptierte er sie doch als ein bloßes Instrument. Planck folgte Helmholtz absichtlich, als er die Begründung des Entropiegesetzes als eines der zentralen Prinzipien der Physik, zu seinem Lebensziel machte. So wurden diese zwei Gesetze - das Energiegesetz und das Entropiegesetz - zu Prinzipien, den zwei sogenannten Prinzipien der Thermodynamik. Die dogmatischen Newtonianer waren gar nicht zufrieden mit Planck’s Strategie: Es war nicht schwer für sie zu sehen, daß sie aus einem Kompromiß bestand. Planck kämpfte mit der einzigen Waffe, die er hatte: Er versuchte zu zeigen, wie fruchtbar seine Ideen in der Forschung sind. Und dann, blieb er eines Tages stecken und probierte eine Idee aus, die seinem größten Gegner Ludwig Boltzmann -gehörte; dieser Schritt war so erfolgreich und so revolutionär, daß Planck tief enttäuscht war, trotz des Ruhms, den er ihm einbrachte. In einer wissenschaftlichen Autobiographie behauptete er eindeutig, daß er mit seinem Ruhm nie zufrieden war, da seine Ideen entweder nicht akzeptiert wurden oder aus Gründen akzeptiert wurden, die ihm nicht gefallen hatten. Man sollte sich nicht wundern, daß Historiker der Wissenschaft diese komplizierte Geschichte nie korrekt erzählen. Was etwas peinlich ist, ist, daß sie noch immer Planck’s eigene Darstellung der Tatsachen verschweigen und so ihr Publikum irreführen und verwirren. Aber seit einem Jahrhundert ist der Mythos verbreitet, daß das Gesetz der Erhaltung der Energie in der Mitte des letzten Jahrhunderts entdeckt worden wäre, trotz der unumstrittenen Tatsache, daß Lagrange und Laplace schon im 18. Jahrhundert jenes mathematische Theorem entdeckten, welches die Erhaltung der Energie zu einem Teil der Newtonschen Mechanik machte. Ich habe diese Geschehnisse in meinem Buch über Faraday beschrieben. Doch den meisten Wissenschaftshistorikern fällt es schwer, die Wichtigkeit von wissenschaftlichen Meinungverschiedenheiten zu
Die gegenwärtige Rolle des Wissenschafts- und Technikhistorikers
425
erkennen, weil - der Wissenschaftstheorie der Aufklärung nach - ja gar keine Meinungsverschiedenheiten in der Wissenschaft existieren dürften, oder zumindestens nicht über mehrere Generationen hin. Dies ist die Idee, daß die Wissenschaft ein Corpus bewiesener Theorien sei. In der Mitte des 19. Jahrhunderts wurde das Gesetz der Erhaltung der Energie noch fundamentaler als Newton’s mechanische Prinzipien; wie gesagt, steht das im klarem Widerspruch zu den ersten Sätzen des klassischen Aufsatzes von Helmholtz “Über die Erhaltung der Kraft”. Ich möchte betonen, daß es sich hier um eine Diskussion über wichtige Meinungverschiedenheiten zwischen Denkern handelt, die selber behaupteten, daß Meinungsverschiedenheiten im Allgemein unwichtig seien, und besonders in der Wissenschaft. Das kompliziert zwar die Diskussion, doch kann ich nicht sehen, wie sie zu vermeiden wäre. Die Aufgabe wird leichter mit Planck, weil seine Meinungsverschiedenheit mit Boltzmann sehr bekannt war und als für recht wichtig galt. Wir wissen ja, daß Planck diese Debatte verlor. Doch haben wir eine große Hochachtung für Planck, und wir halten es für ganz natürlich, daß es sehr vorteilhaft für die Geschichte der Wissenschaft war, daß Planck damals so stur war, wie er es manchmal sein konnte; denn so entstand das berühmte Plancksche Gesetz von der Verteilung der Strahlung. Doch auch dieses Kapitel in der Geschichte der Wissenschaft ist nicht ganz klar. Es ist zwar kaum zu glauben, doch tatsächlich ist Planck von den Wissenschaftshistorikern der Verwirrung bezichtigt worden - nur weil er eine Idee seines Gegners ausprobierte. Fair play befindet sich anscheinend noch nicht im Arsenal des normalen Wissenschaftshistorikers. Das letzte Wort über Planck ist ein Buch über ihn von dem etablierten Historiker J. L. Heilbron, das 1986 gleichzeitig auf englisch und auf deutsch erschien und schon als klassisch gilt. Das Hauptthema des Buches ist politisch; es heißt Die Dilemmen eines aufrechten Mannes: Max Planck als Sprecher der deutschen Wissenschaft. Der erste Teil beschäftigt sich natürlich mit Physik und mit Wissenschaftstheorie. Der wissenschaftliche Teil ist weder klar noch bemerkenswert. Heilbron scheint Thomas Kuhn im allgemeinen zu folgen. Da ich Kuhn’s Buch über die Plancksche Revolution anderswo kritisiert habe, will ich es hier nicht wiederholen. Das wichtigste Detail, das Heilbron erwähnt hat,
426 ist, daß Planck nicht leicht seine Meinung änderte. Ist das eine gute Eigenschaft fur einen Forscher oder nicht? Heilbron sagt nichts dazu. Und so kann er dies nicht mit den Errungenschaften Planck’s in Beziehung bringen. Diejenige Eigenschaft Planck’s, die Einstein so geschätzt hat, nämlich seine faire Einstellung zu anderen Meinungen, erwähnt Heilbron nicht: Er nimmt die Eigenschaft der Gerechtigkeit als selbstverständlich für alle Wissenschaftler an. Wenn dem so wäre, könnte man überhaupt nicht verstehen, warum Einstein so tief beeindruckt war von der Gerechtigkeit so weniger Wissenschaftler, und sie so hoch lobte. Heilbron erwähnt, daß Planck sich sehr für den Ersten Weltkrieg begeistert hatte. Er erklärt dies mit der Behauptung, daß Planck glaubte, daß dieser Krieg für Deutschland ein Verteidigungskrieg war. Doch scheint er diese Erklärung nicht sehr ernst zu nehmen: Er erwähnt auch Planck’s Meinung, daß der Krieg einen positiven Einfluß auf das deutsche Publikum hatte, dadurch daß er es zu Einheit und Hingabe brachte; er erzählt auch, daß Planck so enthusiastisch über einen Appell an die Kulturwelt im Namen des deutschen Volkes war, daß er ihn ohne vorher zu lesen, unterschrieb. Er erzählt, wie Planck zu Kompromissen gezwungen wurde, weil er sich als der Sprecher der deutschen Naturwissenschaftler angesehen hatte - Kompromisse, die ihn endlich dazu brachten, öffentlich das Nationalsozialistische Regime mit seinem Gruß anzuerkennen. Die Dilemmas des Buchtitels sind dadurch klar gemacht: Planck hatte die Wahl zwischen seiner Pflicht der wissenschaftlichen Gemeinschaft gegenüber und seiner politischen Pflicht, mit den Nazis nicht zu kooperieren. Er analysiert dieses Dilemma nicht. Er merkt auch nicht, daß als Planck’s Sohn zum Tode verurteilt worden war, Planck nicht stolz auf seine Tapferkeit war. Er erwähnt auch nicht das Ende des Krieges: In einem Paragraphen erwähnt er das Anwachsen des Irrsinns - vermutlich der deutschen Führung -, die Verschlechterung von Planck’s Gesundheitszustand und die Hilfe, die Planck von einigen amerikanischen Offizieren erhielt. Er erwähnt den Holocaust überhaupt nicht. Am Ende des Buches gibt es Hinweise darauf, daß Planck es gewünscht habe, daß Deutschland den Krieg verliere. Es endet mit einem Fragezeichen: War Planck’s Einstellung zum Nazi-Regime die bestmögliche in seiner Lage? Hat sein Weltbild ihm gut gedient oder nicht?
Die gegenwärtige Rolle des Wissenschafts- und Technikhistorikers
427
Ich nehme an, daß Heilbron eigentlich eine andere Frage stellen wollte: Seine eigene Meinung ist ja offensichtlich, daß eine Kollaboration mit solchen Verbrechern wie den N.S. Führern nie zu empfehlen war. Was Heilbron meint, ist wahrscheinlich, daß ohne die Information, die wir haben, die Planck aber vermutlich damals nicht gehabt hatte, sich die Frage anders stellte. Es ist nicht so schwer, Planck zu verstehen, und es ist selbstverständlich, daß er zum Beispiel die Pflicht, Einstein zu entlassen, als sehr peinlich empfand; trotzdem ist es viel angenehmer Schrödinger zu bewundern, denn der ging sofort ins Exil, als Einstein entlassen wurde. Leider finde ich Heilbron’s Schilderung von Planck’s Benehmen, besonders während der ersten Zeit der Nazi-Herrschaft, sehr apologetisch und recht unangenehm zu lesen. Mir scheint, daß Planck und Heilbron den Grundsatz der Wissenschaftstheorie der Aufklärung annehmen. Diesem Grundsatz nach hat der Wissenschaftler als Wissenschaftler nur eine Pflicht: der Wissenschaft ehrlich - das heißt ohne Vorurteil - zu dienen und sich als Wissenschaftler nie mit Religion oder mit Politik zu beschäftigen. Es ist unmöglich, die klassische Literatur der Aufklärung zu lesen, ohne tief beeindruckt zu sein von der Naivität der Denker der klassischen Aufklärung und von ihrem tiefen Glauben an die Ideen, daß Irrtum Sünde sei, daß die Verbreitung der Wissenschaft die wichtigste Aufgabe sei, weil dies der Weg sei, alle gesellschaftlichen Probleme schnellstens zu lösen. Diese Philosophie hatte Planck wohl kaum auf die extremen moralischen Probleme der Nazi-Zeit vorbereitet. Daher kann man Planck’s Benehmen wohl verstehen, auch wenn es schwer ist, es sympathisch zu finden. Schwerer ist es, Heilbron zu verstehen: Hatte er denn nicht genug Zeit und geschichtliche Erfahrung, um sich von Planck’s Mischung von philosophischer Naivität und seinem Chauvinismus zu distanzieren? 3. Integrierte Wissenschafts- und Technikgeschichte Bis jetzt habe ich nichts über die Geschichte der Technik gesagt. Ich möchte hier ganz kurz sagen, daß die Geschichte der Technik bis zur letzten Generation als Teil der Geschichte der Wissenschaft angesehen wurde, weil die Historiker als Technik nur die rationale Anwendung der Wissenschaft verstanden. Aller Mißbrauch der Wissenschaft und aller Gebrauch von nicht-wissenschaftlichen
428 Ideen in der Technik wurden ignoriert oder verachtet. So zum Beispiel wurde die große Industrie von elektrischen Geräten für angeblich medizinischen Gebrauch, die im letzten Jahrhundert florierte, nicht als angewandte Wissenschaft angesehen, da wir sie heute für ganz nutzlos halten. Der Kampf, den Semmelweis gegen die Infizierung von Patientinnen durch Ärzte führte, wird als Paradigma wissenschaftlichen Benehmens angesehen, während das Benehmen seiner Kollegen in dieser traurigen Geschichte als unwissenschaftlich angesehen wird. Gewöhnlich betrachten die Historiker der Technik die ganze medizinische Profession als wissenschaftlich, während sie die Praktiken, die zur Zeit Semmelweis’ in dieser Profession verbreitet waren, als nichtwissenschaftlich abtun. Diese Einstellung änderte sich seltsamerweise beim Schreiben der Geschichte der nuklearen Physiker auf der Seite der Alliierten im zweiten Weltkrieg. Robert J. Oppenheimer, der Leiter des berühmten Manhattan-Projekts, sagte: “wir kennen die Sünde”; mit “wir” meinte er die Gemeinschaft der nuklearen Wissenschaftler. Robert Jungk hat einen Bestseller über die Entwicklung der nuklearen Waffen geschrieben, der eine scharfe Debatte verursachte, die leider unresolviert abgebrochen wurde: Seine Schlüsse wurden nicht akzeptiert, ohne daß seine Annahmen je kritisch untersucht worden waren. Jungk akzeptierte alle diejenigen Vorurteile, die wir von der Philosophie der Aufklärung geerbt haben, und diese führten ihn zu seinen Schlüssen; seine Kritiker akzeptieren aber dieselben Vorurteile, obwohl sie unkonsequenterweise seine Schlüsse abgelehnt hatten. So starb die Debatte. Das wichtigste Vorurteil besagt, daß echte Wissenschaft nicht wissenschaftlich mißbraucht werden kann. Da die verbreitete Annahme war, daß die Anwendung der nuklearen Bombe eine Sünde war, stellte sich die Frage: Wer hatte die Schuld daran? Diese Frage ist als solche nicht besonders interessant. Die interessantere Frage ist, was kann die wissenschaftliche Gemeinschaft tun, um solch ein katastrophales Versagen in der Zukunft zu verhüten? Robert Jungk nahm als selbstverständlich an, daß ein echter Wissenschaftler, ein wichtiger Naturforscher, nicht ein Kollaborateur mit den Nazis sein konnte. Er suchte darum die Schuldigen im anderen Lager. So traf es sich, daß ein Jude und Pazifist im Alliierten Lager als schuldig befunden wurde, während die Physiker, die in Nazideutschland geblieben
Die gegenwärtige Rolle des Wissenschafts- und Technikhistorikers
429
waren, von ihm frei gesprochen wurden. Vielleicht darf ich hier erwähnen, daß Einstein’s Meinung eine andere war. Er verzichtete auf eine Rückkehr nach Deutschland, weil er die deutsche physikalische Gemeinschaft, mit wenigen Ausnahmen, zum Beispiel Max Planck, als schuldig ansah, und es als unerträglich empfand, daß sie auch nach dem Krieg nicht öffentlich ihre Schuld bekannten. Doch hat sich die Situation inzwischen etwas geändert. Die ökologische Bewegung hat einen neuen Standpunkt ins öffentliche Bewußtsein gebracht. Die Leute, die sich mit der neuen Technik beschäftigen, bedrohen die Umwelt und gefährden das Überleben der Menschheit und des Planeten; sie sind Ingenieure mit hohen wissenschaftlichen Qualifikationen; sie sind so radikal verschieden von dem Bild, das sich die Philosophie der Aufklärung vom Wissenschaftler machte, daß es immer klarer wird, daß eine neue Philosophie der Wissenschaft und der Technik dringend gebraucht wird. Doch da die Beiträge der ökologischen Bewegung zur Philosophie der Wissenschaft und der Technik bis heute nur aus einer inkohärenten Mischung von Aufklärung und Romantik bestehen, haben sie nichts zur Lösung des philosophischen Problems beigetragen. Der Historiker der Wissenschaft kann zu dieser Lösung des philosophischen Problems beitragen. Laßt uns nun zu Semmelweis und seinen Kollegen zurückkehren und sie mit den neuen Augen des nuklearen Zeitalters ansehen. Die Mitglieder seines Berufs hatten nichts mit den Meinungsverschiedenheiten zu tun, denn sie wußten nichts von Semmelweis’ Untersuchungen über Infektion. Das Hygiene-Bewußtsein der Ärzte entwickelte sich erst, nachdem Lister und Pasteur das Problem der Infektion an die Öffentlichkeit gebracht hatten. Anders war die Situation der Führer des medizinischen Berufs: Sie ignorierten Semmelweis’ Warnungen absichtlich. Dadurch begingen sie einen tragischen Irrtum und zogen die Verachtung und den Zorn der Historiker der Medizin auf sich. Doch daraus haben wir noch nichts gelernt. Was ich schon für die letzten 25 Jahre empfehle, ist, daß die Historiker der Wissenschaft und der Technik aufhören, Zensuren zu verteilen, und statt dessen anfangen, sich mit Analysen zu beschäftigen, die gleichzeitig Faktoren auf internen und auf externen Gebieten berücksichtigen. Externe Faktoren können von den verschiedensten Gebieten der Geschichte kommen; fur die Geschichtsschreibung der Technik
430 sind oft Sozialgeschichte, Wirtschaftsgeschichte und sogar Rechtsgeschichte unerläßlich. So ist es zum Beispiel unerläßlich, zu wissen, daß es sich bei den Patienten von Semmelweis’ Kollegen fast ausschließlich um arme Frauen handelte, denn nur sie waren damals dazu gezwungen, ihre Babies in einem öffentlichen Krankenhaus zu entbinden. Es handelte sich daher um eine doppelt machtlose Gruppe von Konsumenten der medizinischen Technik. In solch einer Situation besteht wohl eine besonders große Gefahr, daß die Praktiker die Vorurteile
ihrer
Gesellschaft
annehmen
und
die
revolutionären
Errungenschaften der Wissenschaft übersehen. Dies ist ein Beispiel einer Episode, die zu verschiedenen Disziplinen gehört, nicht nur zur Geschichte der Wissenschaft und zur Geschichte der Technik, sondern auch zur Sozialgeschichte und zur Frauenforschung. Natürlich gilt derselbe Faktor, der als intern in einer Disziplin angesehen wird, als extern einer anderen. Ich möchte nun mit der Diskussion über ein Dokument schließen; vor kurzem erschien der Bericht Hartmut Boockmann’s “Die Konzeption für ein ‘Deutsches Historisches Museum’”, im Mai 1986 in der Zeitschrift Geschichte in Wissenschaft und Unterricht. Es handelt sich um den Vorschlag einer offiziellen Kommission zur Errichtung des deutschen historischen Museums in Berlin und es wird zur öffentlichen Diskussion aufgefordert. Ich weiß nicht, ob sich solch eine Diskussion wirklich entwickelt hat oder nicht, und als Fremder kann ich auch kaum an ihr teilnehmen. Ich hoffe aber, daß es mir gestattet ist, meinen Kommentar hier zu geben. Zu dieser Kommission gehörten Historiker, Museumsdirektoren und ein Verleger; ein Kunsthistoriker sollte auch Mitglied sein, nahm aber daran nicht teil. Historiker der Wissenschaft und der Technik wurden nicht erwähnt. Die Fragen oder Themen, die auf die Tagesordnung gestellt wurden, waren die Frage nach der Gemeinsamkeit der deutschen Geschichte, die Frage nach den Bedingungen der Staatsbildung, die Frage nach dem sich ändernden Verhältnis des Menschen zur Natur - und hier werden die Technik und die Wissenschaft erwähnt -, die Frage nach den Formen sozialer Ungleichheit - und hier werden die Juden in Deutschland erwähnt, jedoch nicht der Holocaust -, und zuletzt die Frage nach den Institutionen im Wandel, und hier werden religiöse Institutionen erwähnt, wie auch Institutionen von Erziehung, Bildung und Wissenschaft. Der Rest dieses Aufsatzes behandelt
Die gegenwärtige Rolle des Wissenschafts- und Technikhistorikers
431
museologische Fragen, die sehr interessant sind, aber hier nicht relevant sind. Das Thema Holocaust wird, wie gesagt, nicht explizit erwähnt: Es wird nur als ein Teil eines großen Themas angesehen, und das stimmt überein mit dem allgemeinen Tenor des Aufsatzes, mit der Betonung aller möglichen Verbindungen. Nur die Möglichkeit von Verbindungen zwischen der modernen, spezifisch deutschen Judenverfolgung mit der deutschen Wissenschaft und wissenschaftlicher Technik wurde übersehen. Man sollte von einer offiziellen Kommission nicht mehr erwarten als von allen anderen Historikern, und man sollte von diesen auch nicht mehr erwarten als von den Historikern der Wissenschaft und der Technik. Und solange die Historiker der Wissenschaft nur externe Faktoren nennen, wann immer das ihnen hilft, die Wissenschaft zu loben, werden sie den Holocaust nicht erwähnen, und solange die politischen Historiker die Wissenschaft nur dann erwähnen, wenn sie etwas positives über sie sagen können, solange wird die Einzigartigkeit des Holocausts nicht verstanden werden. Wir befinden uns gerade jetzt in Mitten einer Debatte über die Frage, ob der Holocaust so verschieden von der stalinistischen “Grossen Säuberung”, der Kulakenverfolgung und dem Gulag sei. 4. Die Wissenschaft und der Holocaust Die Einzigartigkeit des Holocausts liegt nicht in seiner Grausamkeit: Leider ist Grausamkeit recht häufig. Auch der Massenmord ist leider nichts einmaliges. Was Völkermord betrifft, so ist auch da der Holocaust tragischerweise nicht einmalig - Völkermord ist seit der Antike häufig praktiziert worden, und wird auch heute noch weiter praktiziert. Der Holocaust ist auch nicht nur eine seltsame Kombination dieser drei schrecklichen Eigenschaften. Was einzigartig ist, ist der Beitrag der modernen Wissenschaft, und zwar auf drei oder mehr Ebenen. Erstens haben alle diejenigen Faktoren, die von den Historikern als wirtschaftliche und soziale Ursachen des Aufstiegs der Nationalsozialisten in Deutschland erwähnt werden, mit moderner Technik zu tun, und zwar durch Industrialisierung und Wirtschaftskrise. Zweitens ist der moderne totalitäre Staat mit seiner vollkommenen Kontrolle ohne moderne Kommunikationsmittel undenkbar. Drittens hat der moderne wissenschaftliche Ethos zur
432 Popularität des Totalitarismus beigetragen, da seine Führer Effizienz im Namen irgendeiner wissenschaftlichen oder wissenschaftlich-ähnlichen Ideologie versprachen. All dies sind Faktoren, die zwar offensichtlich nötige Bedingungen, aber nicht ausreichende Bedingungen für das Geschehen des Holocausts sind. Die besondere, zusätzliche Zutat zur nationalsozialistischen Mischung war die Rassentheorie, die einzigartig war. Rassismus war und ist ein weit verbreitetes Phänomen. Doch der nationalsozialistische Rassismus war etwas besonders, da er sozialdarwinistisch war, und daher als wissenschaftlich angesehen wurde. Schon seit dem letzten Viertel des letzten Jahrhunderts hatten angesehene deutsche Historiker einen modernen deutschen Antisemitismus, in dem sozialdarwinistische Rassentheorie mit älteren christlichen und nationalistischen Elementen des Judenhasses verquickt wurden, salonfähig gemacht. Ich werde also meine Diskussion mit zwei Punkten abschließen, mit dem sozialdarwinistischen Charakter der nazistischen Rassentheorie und mit dem wissenschaftlichen Charakter des Sozialdarwinismus. Wie Lucy S. Dawidovicz gezeigt hat, begann der systematische Massenmord der Nazis mit der Vergasung von deutschen, sogenannten arischen Geisteskranken und geistig Behinderten. Der Nobelpreisträger und wichtige Ethologe Konrad Lorenz befürwortet noch im hohen Alter ein gemäßigtes, doch vermutlich ein Zwangsprogramm der Sterilisation solcher Menschen, um “genetische Degeneration” zu vermeiden. Lorenz betont die Mäßigkeit seiner Einstellung: Er betont, daß er gegen Extreme sei - er lehnt Auschwitz einerseits und den amerikanischen Individualismus andererseits ab. Was Lorenz heute mit Lorenz 1941 gemeinsam hat, ist sein Sozialdarwinismus. Ich vermute, daß meine Darstellung weniger umstritten wäre, hätte ich den Sozialdarwinismus als pseudowissenschaftlich bezeichnet. Der Rassismus der Nazis war ja so vulgär, unintelligent und widerspruchsvoll, daß man ihn kaum mit irgendeiner wissenschaftlichen Idee vergleichen kann. Es ist wohlbekannt, daß jede Idee, die politisch wichtig ist, manche vulgäre Varianten hat, und daß diese vulgären Varianten einer Idee politisch immer einflußreicher sind als ihre besseren Varianten. Doch die politische Wichtigkeit der besseren Varianten ist auch nicht zu übersehen, da die Intellektuellen, auch wenn sie politisch nicht
Die gegenwärtige Rolle des Wissenschafts- und Technikhistorikers
433
aktiv sind, großen Einfluß auf die Bevölkerung haben können. Wo immer das Publikum die Intellektuellen als ausgesprochene Gegner einer Idee in allen ihren Varianten sieht, dann ist es wohl möglich, daß diese Idee ihren politischen Einfluß vollkommen einbüßt. Darum ist es so bedauerlich, daß die deutschen Intellektuellen nie so radikal wie die französischen, oder die dänischen Intellektuellen, die Ideen der Rassentheorie, des Antisemitismus und des extremen, konservativen Nationalismus abgelehnt hatten. Wie uns Heilbron erzählt, hofften deutsche Wissenschaftler, wie Max Planck, den Führer zu beeinflussen. Das war nur möglich, weil sie trotz allem sie Trennendem doch auch Gemeinsames mit ihm hatten. Was die wissenschaftliche Bedeutung des Sozialdarwinismus betrifft, so ist es kein Zufall, daß schon im letzten Jahrhundert wichtige Wissenschaftler wie Sir Francis Galton Rassisten darwinistischer Art waren, und daß manche - bis jetzt wichtige -Forschungen auf dem Gebiet der Statistik und der Genetik von rassistischen, wissenschaftlichen Ideen abstammen. Die Frage, welche Idee wissenschaftlich ist und welche nicht, ist schwer zu beantworten. Der Streit um die Abgrenzung der Wissenschaft und der wissenschaftlichen Technik ist noch nicht abgeschlossen. Wer die beste Theorie der Abgrenzung der Wissenschaft benutzen will, sollte vielleicht die von Karl Popper anwenden: Popper nimmt die Wissenschaft als den Corpus der empirisch widerlegbaren Theorien an. Im Gegensatz zu Popper’s Meinung, daß der Sozialdarwinismus pseudowissenschaftlich sei, verpflichtet uns seine Theorie der Wissenschaftsabgrenzung, den Sozialdarwinismus als wissenschaftlich zu betrachten, da er empirisch widerlegbar - und auch widerlegt - ist. Wir brauchen jedoch das umstrittene Problem der Abgrenzung der Wissenschaft nicht zu entscheiden. Wir können es immer als selbstverständlich annehmen, daß, was die meisten Wissenschaftler als wissenschaftlich betrachten, gewöhnlich wissenschaftlich ist. Leider kann man nicht bestreiten, daß am Anfang des Jahrhunderts viele Biologen, Gesellschaftswissenschaftler und Philosophen Sozialdarwinisten der einen oder der anderen Art waren. Natürlich ist das dogmatische Festhalten an einer widerlegten Theorie die Wurzel des Übels; die wissenschaftliche Haltung war traditionellerweise immer anti-dogmatisch. Daher ist es wichtiger, die wissenschaftliche Haltung zu
434 stärken, als die wissenschaftliche Tagesmeinung zu verteidigen. Diese Lehre zu verbreiten, scheint mir eine wichtige Aufgabe für den Historiker Wissenschaft und der Technik zu sein.
Authors
435 AUTHORS
Articles Prof. Raymond Boudon, Maison des Scients L’ Homme 54, Boulvard Raspail, 75270 Paris, CEDEX 70, France Prof. Peter A. French, Cole Chair in Ethics, University of South Florida, 100 Fith Avenue South, St. Petersburg, Florida 33701-5016, USA Prof. Roger F. Gibson, Washington University, Campus Box 1073, One Brookings Drive, St. Louis, Missouri 63130-4899, USA Prof. John Heil, Davidson College, Department of Philosophy, Davidson, NC 28036, USA Prof. David Henderson, Memphis State University, Department of Philosophy, 327 Clement Hall, Memphis, Tennessee 38152, USA Prof. Pierre Kerszberg, The Pennsylvania State University, Department of Philosophy, 240 Sparks Building, University Park, PA 16802-5201, USA Prof. Keith Lehrer, University of Arizona, Department of Philosophy, Tucson, Arizona 85719, USA Prof. Alfred Mele, Davidson College, Davidson, NC 28036, USA Prof. Paul K. Moser, Loyola University, Department of Philosophy, 6525 North Sheridan Road, Chicago, Ill. 60626, USA Dr. Ralf Naumann, Universität Düsseldorf, Seminar für allgemeine Sprachwissenschaft, Universitätsstr. 1, 40225 Düsseldorf, RFA Prof. Philip Pettit, The Australian National University, Research School of Social Sciences, Canberra ACT 0200, Australia Prof. Harvey Siegel, University of Miami, Department of Philosophy, P.O. Box 248054, Coral Gable, FL 33124, USA Volkmar Taube, M.A., Saalburgstraße 23, 60385 Frankfurt am Main. RFA Prof. Raimo Tuomela, Academy of Finland, University of Helsinki, Department of Philosophy, P.O. Box 24, 00014 Helsinki, Finland Dr. Alexander Ulfig, Johann Wolgang Goethe-Universität, Projekt Protosociology, Senckenberg Anlage, 60054 Frankfurt am Main, RFA Prof. Wolfgang Welsch, Otto-von-Guericke-Universität, Institut für Philosophie, Postfach 4120, 39016 Magdeburg, RFA Privatdozent Dr. Axel Wüstehube, Westfälische Wilhelms Universität, Philosophisches Seminar, Domplatz 2, 48143 Münster, RFA Prof. David Yandell, Loyola University, Department of Philosophy, 6525 North Sheridan Road, Chicago, Ill. 60626, USA Reviews Achim Berndzen M.A., Friedrichstr. 76 52070 Aachen, RFA Wolf-Jürgen Cramm, M.A., Frankfurt am Main, RFA Dr. Hubert Knoblauch, Universität Konstanz, Sozialwissenschaftliche Faktultät, Fachgruppe Soziologie, Postfach 5560, 78464 Konstanz, RFA Peter Hoeres, Paul-Engelhard-Weg 42, 48167 Münster, RFA
436 Dr. Michael Quante, Westfälische Wilhelms Universität, Philosophisches Seminar, Domplatz 2, 48143 Münster, RFA Dr. Toni Tholen, J.W. Goethe-Universität, Fachbereich: Germanistik, Senckenberg Anlage 32, 60054 Frankfurt am Main, RFA Andreas Veith, Westfälische Wilhelms Universität, Philosophisches Seminar, Domplatz 2, 48143 Münster, RFA State of the Art Marcus Birke, Bremer Straße 17, 48155 Münster, RFA Science and History Prof. Dr. Joseph Agassi, York University, Dept of Philosophy, 4700 Keele St., North York Ont M3J 1P3, Canada and Tel-Aviv University, Department of Philosophy, Tel-Aviv, Israel
Bookpublications
437 IMPRESSUM
PROTO SOCIOLOGY An International Journal of Interdisciplinary Research
ISSN 0940-4147
Editor: GERHARD PREYER Johann-Wolfgang-Goethe-University Frankfurt am Main, Department of Social Science Editorial Staff: Angela Mumme, Georg Peter, Alexander Ulfig Editorial of the Vol. 8/9 1996: Rationality II, III: Georg Peter, Alexander Ulfig Project: Frank Siebelt, Mathias Bös Lay-out: Georg Peter Editorial Office: PROTOSOCIOLOGY, Stephan-Heise-Str. 56, 60488 Frankfurt am Main, RFA, Phone: 069-769461, E-Mail:
[email protected] Bank: Dresdner Bank AG, Frankfurt am Main, Kto: 44 121 168 01, BLZ: 500 800 00 Typsetter: Erwin Lokay, 64348 Reinheim Wir danken der Wilhelm-Hahn-Stiftung, Bad Homburg v.d. Höhe für die Förderung des Rationalitätsheftes und dem debis Systemhaus für ihre freundliche Unterstützung.
)))))))))))))))))))))))))))))))))))))))))) Die Zeitschrift soll 1/2jährlich erscheinen. Die Anzahl der jährlich erscheindenden Hefte und Sonderhefte bleibt jedoch vorbehalten. Copyright: Die in dieser Zeitschrift veröffentlichten Beiträge sind urheberrechtlich geschützt. Alle Rechte sind vorbehalten. Übersetzungen, Nachdruck, Vervielfältigung auf fotomechanischem oder ähnlichem Weg oder im Magnettonverfahren, Wiedergabe durch Vortrag, Funk- und Fernsehsendungen sowie Speicherung in Datenverarbeitungsanlagen, auch auszugsweise, sind nur mit Genehmigung des Herausgebers möglich. Für eingereichte Beiträge wird keine Haftung übernommen. Weitere Publikationsrechte von Artikeln bleiben vorbehalten. Zweitpublikationen seitens des Autors werden eingeräumt. Bei einer Zweitpublikation ist das Heft (Nummer, Titel, Erscheinungsjahr) der PROTOSOCIOLOGY zu zitieren. Für unaufgefordert eingesandte Manuskripte wird keine Haftung übernommen. Gerichtsstand ist Frankfurt am Main. Copyright: All rights reserved. This publication may not be reproduced, stored or transmitted in any form or by any means without the prior permission in writing of the publisher. Additional publications of the articles are reserved. The authors retain the personal right to re-use their own articles. Authorization to photocopy items for internal or personal use, or the internal or personal use of specific clients is garanted by PROTOSOCIOLOGY, provided that the base fee is paid directly to VG Wort, Goethestr. 49, 80336 München RFA.
438 The publisher accepts no responsibility for submitted manuscripts.
Bookpublications
439 PROTOSOZIOLOGIE IM KONTEXT
“Lebenswelt” und “System” in Philosophie und Soziologie Gerhard Preyer, Georg Peter, Alexander Ulfig (Hrsg.) in memoriam Paul Lorenzen Einleitung: “Lebenswelt” und “System” in Philosophie und Soziologie, Gerhard Preyer, Georg Peter, Alexander Ulfig Zum Begriff der Lebenswelt: Ernst W. Orth (Trier, Deutschland): Lebenswelt als unvermeidliche Illusion? Husserls Lebensweltbegriff und seine kulturpolitischen Weiterungen, Walter Biemel (Aachen, Deutschland): Gedanken zur Genesis der Lebenswelt, Alexander Ulfig (Frankfurt/Main, Deutschland): Lebenswelt und Reflexion. Anhang: Lebenswelt als Fundament der Wissenschaft, Gerhard Preyer (Frankfurt/Main, Deutschland): Hintergrundwissen: Kritik eines Begriffs, Hubert A. Knoblauch (Konstanz, Deutschland): Soziologie als strenge Wissenschaft? Phänomenologie, kommunikative Lebenswelt und soziologische Methodologie Lebenswelt - Begründung - Wissenschaft Jürgen Mittelstraß (Konstanz, Deutschland): Das lebensweltliche Apriori, Peter Janich (Marburg, Deutschland): Die Rationalität der Naturwissenschaften, Jürgen Mittelstraß (Konstanz, Deutschland): Rationalität und Reproduzierbarkeit, Elisabeth Ströker (Köln, Deutschland):Lebenswelt durch Wissenschaft, Paul Janssen (Köln, Deutschland): Lebenswelt, Wissen und Wissenschaft, Richard T. Murphy (Concord, USA): E. Husserl’s Phenomenology of Reason Lebenswelt/Lebensform - Sprache Pierre Kerszberg (Pennsylvania, USA): Lifeworld and Language, John F.M. Hunter (Toronto, Canada): The Motley Forms of Life in the Later Wittgenstein, Peter A. French (San Antonio, USA): Why did Wittgenstein read Tagore to the Vienna Circle? Georg Peter (Frankfurt/Main, Deutschland): Die Nebenbeschäftigung der Symbole. Zu Wahrheit und Funktion der Metapher System - Sozialsystem - Gesellschaft Niklas Luhmann (Bielefeld, Deutschland): Die Lebenswelt nach Rücksprache mit Phänomenologen, Niklas Luhmann (Bielefeld, Deutschland): Observing Re-entries, Gerhard Preyer (Frankfurt/Main, Deutschland): System-, Medien- und Evolutionstheorie. Zu Niklas Luhmanns Ansatz, Richard Münch (Düsseldorf, Deutschland): Autopoesis per Definition, Hans Zitko (Frankfurt/Main, Deutschland): Ästhetik als Soziologie der Kunst, James Bohman (St. Louis, USA): The Completeness of Macro-Sociological Explanations: System and Lifeworld, Göran Ahrne (Stockholm, Schweden): Outline of an Organisational Theory of Society, Anhang: Karl Otto Hondrich (Frankfurt/Main, Deutschland): Zu Göran Ahrnes Ansatz Verlag Königshausen & Neumann, Postfach 6007, D-97010 Würzburg, ca. 390 Seiten, 68,- DM
440 INTENTION - BEDEUTUNG - KOMMUNIKATION Zur Bedeutung der modernen Sprachtheorie für eine Protosoziologie Gerhard Preyer, Maria Ulkan, Alexander Ulfig (Hrsg.) Intention - Bedeutung - Kommunikation: Maria Ulkan (München): Kommunikative und illokutionäre Akte, Georg Meggle, Maria Ulkan (Leipzig/München): Grices Doppelfehler. Ein Nachtrag zum Griceschen Modell, Jan Nuyts (Wilrijk, Belgium): Intentions and the Functions of Language in Communication, Louise Röska-Hardy (Frankfurt/ Main): Sprechen, Sprache, Handeln, Volkmar Taube (Frankfurt/Main): Bildliche Sprechakte, Karl-Otto Apel (Frankfurt/Main): Illokutive Bedeutung und normative Gültigkeit Die transzendentalpragmatische Begründung der uneingeschränkten kommunikativen Verständigung, Peter Paul König (Münster), Kommunikation und Strategie Systematisierungen: Maria Ulkan (München): Informations- und Aufforderungshandlungen, Dirk Hartmann (Marburg): Konstruktive Sprechakttheorie, Gerhard Preyer (Frankfurt/Main): Sprachpragmatik, Alexander Ulfig (Frankfurt/Main): Präsuppositionen, Peter Rothermel (Darmstadt): Semantische Implikaturen, Frank Siebelt (Frankfurt/Main): Zweierlei Holismus. Zur Interpretationstheorie Donald Davidsons, Georg Peter (Frankfurt/Main): Schemainterpretation von Metaphern Dialogforschung und Argumentationstheorie: Franz Hundsnurscher (Münster): Streitspezifische Sprechakte: Vorwerfen, Insistieren, Beschimpfen, Wilhelm Franke (Hamburg): Konzepte linguistischer Dialogforschung, Dieter Mans (Frankfurt/Main): Argumentation im Kontext, Exkurs: Zu Christoph Lumer “Praktische Argumentationstheorie” State of the Art Gerhard Preyer (Frankfurt/Main): Die Problemsituation der analytischen Philosophie Erscheint Juni 1997, ca. 300 Seiten, 58,- DM Westdeutscher Verlag GmbH, Postfach 1546, D-65005 Wiesbaden
Bookpublications
441
STRUKTURELLE EVOLUTION UND DAS WELTSYSTEM Theorien, Sozialstruktur und evolutionäre Entwicklungen Gerhard Preyer (Hrsg.) Einleitung: Gerhard Preyer: Strukturelle Evolution und das Weltsystem: Theorien, Sozialstruktur und evolutionäre Entwicklungen ZENTRUM UND PERIPHERIE - INSTITUTIONELLE ENTWICKLUNG ASKRIPTIVE SOLIDARITÄT Shmuel Noah Eisenstadt: Social Division of Labor, Construction of Centers and Institutional Dynamics: A Reassessment of the Structural-Evolutionary Perspective, Bernhard Giesen, Kay Junge: Strukturelle Evolution, Gerhard Preyer: Soziale Gesetze und askriptive Solidarität. Eine Skizze zu den Grundlagen der Gesellschaftstheorie, Anhang: Die modernen Gesellschaften verstehen. Richard Münchs Entwicklungstheorie moderner Gesellschaften, Erwin Rogler, Gerhard Preyer: Relationslogische Darstellung der sozialen Gesetze, Gerhard Preyer: Die modernen Gesellschaften “verstehen”. Zu Richard Münchs Entwicklungstheorie moderner Gesellschaften, Dieter Claessens: Bemerkungen zur Entstehung der modernen Ökonomie: Das Organistionsproblem, Richard Pieper: Strukturelle Emotionen, elementare Strukturbildung und strukturelle Evolution DIE EVOLUTION POLITISCHER ORDUNGEN Rainer C. Baum: Parsons on Evolution of Democracy, Mathias Bös: Zur Evolution nationalstaatlich verfaßter Gesellschaften, Konrad Thomas: Das Ethnische und das Staatliche, Volker Bornschier: Die westeuropäische Integration als Gesellschaftsmodell im Zentrumswettbewerb ZUR SOZIOLOGIE DES WELTSYSTEMS Roland Robertson: Globalization and reflexive Modernization, Immanuel Wallerstein: Evolution of the Modern World-System, Christopher Chase-Dunn, Thomas D. Hall: The Historical Evolution of World-Systems: Iterations and Transformations, Albert Bergesen: Postmodernism: A World System Explanation, Richard Münch: Modernity and Irrationality: Paradoxes of Moral Modernization, Walter L. Bühl: Transformation oder strukturelle Evolution? Zum Problem der Steuerbarkeit von sozialen Systemen STATE OF THE ART Michael Schmid: Soziologische Evolutionstheorien Suhrkamp Verlag, Frankfurt am Main, Suhrkamp Taschenbuch Wissenschaft (STW)
442 LEBENSWELT, REFLEXION UND SPRACHE Zur reflexiven Thematisierung der Lebenswelt in Phänomenologie, Existenzialontologie und Diskurstheorie Alexander Ulfig Lebenswelt, Reflexion und Sprache sind die dominierenden Begriffe der Philosophie des 20. Jahrhunderts. In dieser Arbeit werden sie in eine Beziehung zueinander gebracht. Daraus ergeben sich relevante Folgen für Methodenfragen der Philosophie und Sozialwissenschaften. Im Zentrum der Studien steht das Verhältnis von Lebenswelt und Reflexion, das anhand der Lebenswelt-Konzeptionen von Husserl, Heidegger, Wittgenstein und Schütz diskutiert wird. Auch Heideggers Existenzialontologie und Wittgensteins Sprachspiel-Philosophie werden als Reflexionskonstrukte gedeutet. Die Untersuchungen führen zu einer Auseinandersetzung mit der Lebenswelt-Konzeption von Jürgen Habermas; zu einer grundlegenden Kritik an seiner reflexiven Thematisierung der Lebenswelt im Sinne einer Präsuppositionsanalyse von Hintergrundüberzeugungen und einer sozialwissenschaftlichen Analyse der symbolisch vorstrukturierter Wirklichkeit. Abschließend wird ein alternatives, geltungstheoretisches Modell der reflexiven Evaluierung der lebensweltlichen Kommunikation entwickelt, das sich an der Konzeption des “normativen Diskurses” von Herbert Schnädelbach orientiert. LEBENSWELT UND REFLEXION (1) Das Verhältnis von Lebenswelt und philosophischer Reflexion in der Philosophie Edmund Husserls, (2) Lebenswelt und existenziale Analytik in der Philosophie Martin Heideggers, (3) Lebensform, Sprachspiel und Begründung in der Philosophie Ludwig Wittgensteins, (4) Lebenswelt und Reflexion in der phänomenologischen Soziologie von Alfred Schütz, Exkurs: Lebenswelt und Wissenschaft LEBENSWELT UND SPRACHE (1) Der Gebrauch der Sprache in der Lebenswelt und der Gebrauch der Sprache in der reflexiven Bezugnahme auf die Lebenswelt, (2) Evidenz und reine Beschreibung (E. Husserl), (3) Ontische und existenzial-ontologische Rede (M. Heidegger), (4) Sprachspiel und reflexive Beschreibung (L. Wittgenstein), (5) Alltagsrede und wissenschaftliche Rede (A. Schütz), (6) Searle’s Konzeption des backgrounds und die Problematik des Erfassens des lebensweltlichen Hintergrundes LEBENSWELT UND DISKURS (1) Probleme der Diskurstheorie, (2) Die Lebenswelt-Konzeption von Jürgen Habermas, (3) Lebenswelt, Alltagskommunikation und geltungstheoretischer Diskurs
200 Seiten, 48,-DM. Verlag Königshausen & Neumann, Postfach 6007, D-97010 Würzburg
Bookpublications
443 INTEGRIERTES MANAGEMENT Was kommt nach der Lean-Production? Gerhard Preyer/Jakob Schissler
Es gibt heute im Weltmaßstab kein Unternehmen, das seine Umstrukturierung nicht an den Bestandteilen des japanischen Modells der schlanken Produktion und des schlanken Managements, der Lean-Modelle, orientiert. Die Lean-Modelle sind zu einem integrierten Management fortzuentwickeln: dem über Vernetzung integrierten segmentierten Unternehmen, mit durchlässigen, ständig wechselnden Grenzen zwischen Unternehmen, Lieferanten und Kunden. Integriertes Management ist das Unternehmensmodell, das eine erhöhte Qualifizierung der Mitarbeiter und die Fähigkeit, in sich selbst steuernden Teams mitzuarbeiten, erfordert. Das bedeutet aber auch die Entwicklung eines neuen Führungsstils. Mit integriertem Management kann jedes Unternehmen sofort anfangen. Dazu wird in diesem Buch ein Weg gezeigt. Es wird eine wichtige Funktion als Impuls für weitere Entwicklungen haben. Inhalt DIE NEUEN HERAUSFORDERUNGEN 1. Vom japanischen und amerikanischen Management lernen? 2. Information, Wissen und Entscheidungen KREATIVITÄT ORGANISATION FÜHRUNG 1. Managementfähigkeiten 2. Innovative Organisation 3. Management und Führungsstile STRATEGIE - MARKT - KULTUR 1. Unternehmensstrategie 2. Controlling 3. Marketing 4. Zur Unternehmenskultur STICHWORT Was kommt nach der Lean Production? Frankfurter Allgemeine Zeitung, Verlagsbereich Wirtschaftsbücher, 60267 Frankfurt am Main, 164 Seiten, 32,- DM
444 HANDLUNGEN: Beschreiben, Erklären und Verstehen Gerhard Preyer
EINLEITUNG: Überblick über die analytische Handlungstheorie Problemstellungen und ihre I. A.C. DANTO 1. Standardanalysen des Wissens und Handelns, 2. Immanente und transeunte Verursachung, 3. Basishandlungen und Körperbewegungen II. DAS ZWEISPRACHENARGUMENT 1. A. I. MELDEN, 2. I. THALBERG, J.L. AUSTIN, G. FEINBERG, 3. H.L.A. HART: Zuschreibungen III. D. DAVIDSON 1. Davidsons Sprach- und Handlungstheorie. Ein Umriß seiner Philosophie 2. Wahrheit, Bedeutung, radikale Interpretation 1. Wahrheitstheorie als Bedeutungstheorie natürlicher Sprachen, 2. Die Kritik an einer intentionalistischen Bedeutungstheorie, 3. Das Prinzip der Nachsicht und der Autonomie der Bedeutung, 4. Das dritte Dogma des Empirismus: Begriffsschema versus Inhalt, Hintergrundwissen, 5. Die Ideolekttheorie der Sprache, 6. Folgeprobleme: Wahrheits- und Bedeutungstheorie, Wahrheit und Überzeugung 3. Die logische Form von Handlungssätzen und singulären Kausalaussagen 5. Primärgründe und Identitätsthese V. A.I. GOLDMAN 1. Goldmans Davidsons-Kritik, 2. Ebenen der Handlungshervorbringung V. D.S. SHWAYDER 1. Die Verhaltensschichtung 2. LEWIS-Konventionen 1. Koordinationsprobleme als Gleichgewichtskombinationen, 2. Die Definition von Konventionen als Verhaltensregularitäten, 3. Sprachkonventionen, 4. Was heißt es, einer Konvention zu folgen? VI. HANDLUNGSBESCHREIBUNG, HANDLUNGSERKLÄRUNG UND PRAKTISCHES DENKEN 1. Der Begriff der Einstellungsrationalität, 2. Handlungsbeschreibungen und Handlungsverursachung, 3. Eine Handlungserklärung, 4. Praktische Schlüsse VII. DIE SOZIALWISSENSCHAFTLICHE ERKLÄRUNG 1. K.R. Popper, C.G. Hempel, 2. Deduktive Erklärung und Handlungserklärung, 3. Worin besteht unser “eigenes” Wissen über unsere “eigenen” Handlungen? Orders and inforamtions: http://www.rz.uni-frankfurt/protosociology
Bookpublications
445 LEBENSWELT - SYSTEM - GESELLSCHAFT
Konstruktionsprobleme und Kritik der “Theorie des kommunikativen Handelns” von Jürgen Habermas Gerhard Preyer I DIE ENTWICKLUNGSLOGIK VON WELTBILDERN 1. Die Rationalisierung von Weltbildern 2. Strategien der Analyse von Weltbildern 3. Folgeprobleme und Kritik II GESELLSCHAFT ALS LEBENSWELT UND SYSTEM 1. Die Strukturen der Lebenswelt 2. Allgemeine Bezugsprobleme der soziologischen Evolutionstheorie 3. Die Verständigungsformen 1. Weltbilder und soziale Integration 2. Zur Durkheim-Interpretation 4. Kommunikationsmedien und generalisierte Kommunikationsweisen 5. Folgeprobleme und Kritik III DIE FORMAL-PRAGMATISCHE BEDEUTUNGSTHEORIE 1. Die sprechakttheoretische Grundlegung 2. Interpersonal geltende Bedeutungskonventionen 3. Regelbewußtsein und Handlungskompetenz 4. Die Expansion des semantischen Gehalts 5. Verständigung und die Herstellung interpersonaler Beziehungen IV DER ERWERB DES MORALISCHEN BEWUßTSEINS 1. Die sozial-kognitive Grundausstattung 2. Diskurs und moralisches Bewußtsein 3. Folgeprobleme V KONSTRUKTIONSPROBLEME UND KRITIK 1. Rekonstruktionshypothesen 2. Zu den Konstruktionsproblemen ANHANG: Max Webers Religionssoziologie als eine Typologie des Rationalismus
Orders and Inforamtions: http://www.rz.uni-frankfurt/protosociology
446 PROTO SOCIOLOGY An International Journal of Interdiscipary Research
HEFT 6, 1994 RATIONALITÄT I Niklas Luhmann: Observing Re-entries, Nicholas Rescher: Reason and Reality, Jürgen Mittelstraß: Rationalität und Reproduzierbarkeit, Ellery Eells: Bayesian Epistemology: Probabilistic Confirmation and rational Decision, Erwin Rogler: Ist Carnaps Philosophie reflexionslos?, Dale Jacquette: Intentionality and the myth of pure syntax, Peter Gärdenfors: The social Stance, Julian Nida-Rümelin: Die Vielfalt guter Gründe und die Theorie praktischer Rationalität, Stefan Gosepath: Eine einheitliche Konzeption von Rationalität, Gerhard Preyer: Die Rationalitätsbegriffe des Handelns. Eine Grundlegung zu einer Typologie sozialen Handelns, Timo Airaksinen/Katri Kaalikoski: Instrumental Rationality, Dieter Mans: Argumentation im Kontext, Georg Meggle: Das Universalisierungsproblem in der Moralphilosophie, Thomas McCarthy: Legitimacy and Diversity: Dialectical Reflections on Analytical Distinctions, Gerald L. Eberlein: Logik der Sozialwissenschaften - 150 Jahre nach J. St. Mills System of Logic
Rezensionen: Robert Alexy, Begriff und Geltung des Rechts (Ulfrid Neumann), Robert Nozick, The Nature of Rationality (Axel Wüstehube), John Rawls, Political Liberalism (Anna Riek), Elke Brendel, Die Wahrheit über den Lügner (Daniel Schoch), Ralf Naumann, Das Realismusproblem in der analytischen Philosophie; Günter Abel, Interpretationswelten. Gegenwartsphilosophie jenseits von Essentialismus und Relativismus (Michael Quante), Ernst Tugendhat, Philosophische Aufsätze (Uwe Wirth), Oliver R. Scholz, Bild, Darstellung, Zeichen. Philosophische Theorien bildhafter Darstellung (Volkmar Taube), Michael Kober, Gewißheit als Norm. Wittgensteins erkenntnistheoretische Untersuchung in “Über Gewißheit” (Wulf Kellerwessel), Jan Künzler, Medien und Gesellschaft: Die Medienkonzepte von Talcott Parsons, Jürgen Habermas und Niklas Luhmann (André Kieserling) Roland Robertson, Globalization Social Theory and Global Culture (Mathias Bös) Interview with NOAM CHOMSKY: On Linguistics and Politics (Günther Grewendorf); State of the Art: Klaus Puhl, Die Grenzen der Sprache als Grenzen der Welt: Michael Dummetts anti-realistische Bedeutungstheorie; Aktuell: Norbert Walter, Rettung des Standorts Deutschland - Nicht ohne
Bookpublications
447
einen Mentalitätswandel - Tagungsbericht: Eva Jelden Vor-theoretische Voraussetzungen der Wissenschaften? Workshop zum Status der Prototheorien PROTOSOCIOLOGY: Bookpublications in the World Wide Web: http://www.rz.uni-frankfurt/protosociology
ProtoSociology An International Journal of Interdisciplinary Research Vol. 8/9 -1996 ------------------------Rationality II & III P Editor: Gerhard Preyer P Editorial Staff: Georg Peter, Alexander Ulfig P Editorial of the Vol. 10 1997: Georg Peter, Alexander Ulfig P Layout: Georg Peter P Editorial Office: ProtoSociology, Stephan-Heise-Str. 56, 60488 Frankfurt am Main, RFA, Phone: 069-769461, E-Mail:
[email protected]
